Sample records for married male female

  1. Bringing men in: an analysis of male and female fertility

    E-Print Network [OSTI]

    Zhang, Li 1976-

    2009-05-15T23:59:59.000Z

    Prior research has focused on studying female fertility, but male fertility remains overlooked. Using data from the 2001 Demographic Yearbook, the 1964 to 2002 Taiwan-Fukien Demographic Yearbooks, the 2004 National Statistics Reports and the 2002...

  2. Male-female interaction among different geographic strains of the Gulf Coast tick Amblyomma maculatum Koch

    E-Print Network [OSTI]

    Sleeba, Sarah Beth

    2006-08-16T23:59:59.000Z

    dish experiments were used to understand male-female interaction in the field, and to determine if the aggregation attachment pheromone (AAP) produced by fed males of varying strains is attractive to geographic specific strains of unfed female ticks...

  3. Situating Male Fertility: A Demographic Analysis of Male and Female Fertility in the United States

    E-Print Network [OSTI]

    Cherry, Robert Christopher

    2012-02-14T23:59:59.000Z

    are not significantly different from those reported by females (Ratcliffe, Hill, Harrington, and Walraven 2002b). Rendall et al. (1999) explored the qualities of male reported data, and found that while retrospective recollection of fertility events underreport... listing of these articles indicated that the bulk of them (over 2/3rds) dealt with either 1) family planning (Guest 2003; Mesfin 2002; Pearson 2003), fertility control (Colvard, Habenicht, and Harper 2008; Darroch 2008), 14 contraception and condom...

  4. For Immediate Release --Wednesday, March 20, 2013 Treating male and female cancer patients with radiation

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    ? · gender differences in cancer treatment rarely explored · consequences of radiation with radiation treatment of cancer cells and the difference between female and male or female-specific treatments that improve the quality of life for all cancer

  5. The effects of adult male mouse urine odor on evoked potentials in adult female mice

    E-Print Network [OSTI]

    Brown, Troy Edwin

    1985-01-01T23:59:59.000Z

    THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE MAY 1985 Major Subject: Bioengineering THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Approved as to style and content by: Jon F. Hunter (Co ? C airman of Committee...

  6. The functional role and female perception of male song in Zebra Finches

    E-Print Network [OSTI]

    Woolley, Sarah M. N.

    The functional role and female perception of male song in Zebra Finches Mark E. HauberA,C , Dana L and perception of Zebra Finch song has driven theoretical, empirical and technological advances in behavioural ecology, endocrinology and neuroethology, and led to a greater understanding of the evolution of animal

  7. ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility

    E-Print Network [OSTI]

    ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility Stuart P. Bliss. Several studies suggest that ERK1 and -2 are essential modulators of hypothalamic GnRH-mediated regulation-specific depletion of ERK1 and 2 and examined a range of physiological parameters including fertility. We find

  8. Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain

    E-Print Network [OSTI]

    Schluter, Dolph

    Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain Devaleena S increases song behavior and the size of a brain region controlling song (HVC; Reiner et al. 2004), and also the brain (Soma 2006; Demas et al. 2007; Schlinger et al. 2007). Dehydroepiandrosterone can be converted

  9. Male Female

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA Approved:Administration SandiaAdministration NewsAdministrator6

  10. Exploring the Behavioral and Psychological Differences between Male and Female Youth with a History of Fire Involvement

    E-Print Network [OSTI]

    Morris, Ed M.

    2014-08-31T23:59:59.000Z

    . While it is supported that fire-involved youth tend to be males, recent statistics published by the National Fire Protection Association (NFPA) indicated sex differences in the type of fires set. Specifically, the NFPA report found that female youth... expression and found it surprising that females were associated with covert emotional expression through firesetting behavior because they are typically socialized to express emotions overtly. If the female-dominated structure fires documented by NFPA...

  11. Organ doses for reference adult male and female undergoing computed tomography estimated by Monte Carlo simulations

    SciTech Connect (OSTI)

    Lee, Choonsik; Kim, Kwang Pyo; Long, Daniel; Fisher, Ryan; Tien, Chris; Simon, Steven L.; Bouville, Andre; Bolch, Wesley E. [Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear Engineering, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States); Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States)

    2011-03-15T23:59:59.000Z

    Purpose: To develop a computed tomography (CT) organ dose estimation method designed to readily provide organ doses in a reference adult male and female for different scan ranges to investigate the degree to which existing commercial programs can reasonably match organ doses defined in these more anatomically realistic adult hybrid phantomsMethods: The x-ray fan beam in the SOMATOM Sensation 16 multidetector CT scanner was simulated within the Monte Carlo radiation transport code MCNPX2.6. The simulated CT scanner model was validated through comparison with experimentally measured lateral free-in-air dose profiles and computed tomography dose index (CTDI) values. The reference adult male and female hybrid phantoms were coupled with the established CT scanner model following arm removal to simulate clinical head and other body region scans. A set of organ dose matrices were calculated for a series of consecutive axial scans ranging from the top of the head to the bottom of the phantoms with a beam thickness of 10 mm and the tube potentials of 80, 100, and 120 kVp. The organ doses for head, chest, and abdomen/pelvis examinations were calculated based on the organ dose matrices and compared to those obtained from two commercial programs, CT-EXPO and CTDOSIMETRY. Organ dose calculations were repeated for an adult stylized phantom by using the same simulation method used for the adult hybrid phantom. Results: Comparisons of both lateral free-in-air dose profiles and CTDI values through experimental measurement with the Monte Carlo simulations showed good agreement to within 9%. Organ doses for head, chest, and abdomen/pelvis scans reported in the commercial programs exceeded those from the Monte Carlo calculations in both the hybrid and stylized phantoms in this study, sometimes by orders of magnitude. Conclusions: The organ dose estimation method and dose matrices established in this study readily provides organ doses for a reference adult male and female for different CT scan ranges and technical parameters. Organ doses from existing commercial programs do not reasonably match organ doses calculated for the hybrid phantoms due to differences in phantom anatomy, as well as differences in organ dose scaling parameters. The organ dose matrices developed in this study will be extended to cover different technical parameters, CT scanner models, and various age groups.

  12. Male mating behavior and costs of sexual harassment for females in cavernicolous and extremophile

    E-Print Network [OSTI]

    Schlupp, Ingo

    by physicochemical stressors, such as toxic hydrogen sulfide (H2S), or the fish occur in lightless subterranean (cave) habitats. Using five different populations from surface habitats with or without H2S, and from a sulfidic with at least one physicochemical stressor present (H2S or absence of light), a reduction in male sexual

  13. Evaluation of overall setup accuracy and adequate setup margins in pelvic image-guided radiotherapy: Comparison of the male and female patients

    SciTech Connect (OSTI)

    Laaksomaa, Marko, E-mail: marko.laaksomaa@pshp.fi [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Kapanen, Mika [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Tulijoki, Tapio [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Peltola, Seppo; Hyödynmaa, Simo [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Kellokumpu-Lehtinen, Pirkko-Liisa [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland)

    2014-04-01T23:59:59.000Z

    We evaluated adequate setup margins for the radiotherapy (RT) of pelvic tumors based on overall position errors of bony landmarks. We also estimated the difference in setup accuracy between the male and female patients. Finally, we compared the patient rotation for 2 immobilization devices. The study cohort included consecutive 64 male and 64 female patients. Altogether, 1794 orthogonal setup images were analyzed. Observer-related deviation in image matching and the effect of patient rotation were explicitly determined. Overall systematic and random errors were calculated in 3 orthogonal directions. Anisotropic setup margins were evaluated based on residual errors after weekly image guidance. The van Herk formula was used to calculate the margins. Overall, 100 patients were immobilized with a house-made device. The patient rotation was compared against 28 patients immobilized with CIVCO's Kneefix and Feetfix. We found that the usually applied isotropic setup margin of 8 mm covered all the uncertainties related to patient setup for most RT treatments of the pelvis. However, margins of even 10.3 mm were needed for the female patients with very large pelvic target volumes centered either in the symphysis or in the sacrum containing both of these structures. This was because the effect of rotation (p ? 0.02) and the observer variation in image matching (p ? 0.04) were significantly larger for the female patients than for the male patients. Even with daily image guidance, the required margins remained larger for the women. Patient rotations were largest about the lateral axes. The difference between the required margins was only 1 mm for the 2 immobilization devices. The largest component of overall systematic position error came from patient rotation. This emphasizes the need for rotation correction. Overall, larger position errors and setup margins were observed for the female patients with pelvic cancer than for the male patients.

  14. Essays on Married Women Labor Supply

    E-Print Network [OSTI]

    Li, Xinrong

    2012-02-14T23:59:59.000Z

    One of the very interesting demographic features in the US over the last three decades of the 20th century is the increase of the married women labor force participation rate. Over the same period, estimated labor supply elasticity varies...

  15. The Role of Androgens in Male Pregnancy and Female Competitive Behavior in a Sex Role Reversed Pipefish

    E-Print Network [OSTI]

    Scobell, Sunny Kay

    2012-02-14T23:59:59.000Z

    of the male reproductive cycle in seahorses. I predicted that androgens would be low during the early stages of pregnancy and increase during the end of pregnancy as males go through another cycle of spermatogenesis in preparation for the next mating event. My...

  16. Chat up lines: effect of the menstrual cycle and sociosexuality on female response to male sexual displays 

    E-Print Network [OSTI]

    Kubicki, Natalie E

    2008-06-27T23:59:59.000Z

    al., who asked participants to judge how a typical woman would respond to particular chat up lines, this study investigated fertility as having a possible effect on responses and asked female-only participants (N=85) how they themselves would respond...

  17. Biotransformation of 2,3,3,3-tetrafluoropropene (HFO-1234yf) in male, pregnant and non-pregnant female rabbits after single high dose inhalation exposure

    SciTech Connect (OSTI)

    Schmidt, Tobias [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany); Bertermann, Rüdiger [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany)] [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany); Rusch, George M. [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States)] [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States); Hoffman, Gary M. [Huntingdon Life Sciences., East Millstone, NJ (United States)] [Huntingdon Life Sciences., East Millstone, NJ (United States); Dekant, Wolfgang, E-mail: dekant@toxi.uni-wuerzburg.de [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)

    2012-08-15T23:59:59.000Z

    2,3,3,3-Tetrafluoropropene (HFO-1234yf) is a novel refrigerant intended for use in mobile air conditioning. It showed a low potential for toxicity in rodents studies with most NOAELs well above 10,000 ppm in guideline compliant toxicity studies. However, a developmental toxicity study in rabbits showed mortality at exposure levels of 5,500 ppm and above. No lethality was observed at exposure levels of 2,500 and 4,000 ppm. Nevertheless, increased subacute inflammatory heart lesions were observed in rabbits at all exposure levels. Since the lethality in pregnant animals may be due to altered biotransformation of HFO-1234yf and to evaluate the potential risk to pregnant women facing a car crash, this study compared the acute toxicity and biotransformation of HFO-1234yf in male, female and pregnant female rabbits. Animals were exposed to 50,000 ppm and 100,000 ppm for 1 h. For metabolite identification by {sup 19}F NMR and LC/MS-MS, urine was collected for 48 h after inhalation exposure. In all samples, the predominant metabolites were S-(3,3,3-trifluoro-2-hydroxypropanyl)-mercaptolactic acid and N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine. Since no major differences in urinary metabolite pattern were observed between the groups, only N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine excretion was quantified. No significant differences in recovery between non-pregnant (43.10 ± 22.35 ?mol) and pregnant female (50.47 ± 19.72 ?mol) rabbits were observed, male rabbits exposed to 100,000 ppm for one hour excreted 86.40 ± 38.87 ?mol. Lethality and clinical signs of toxicity were not observed in any group. The results suggest that the lethality of HFO-1234yf in pregnant rabbits unlikely is due to changes in biotransformation patterns or capacity in pregnant rabbits. -- Highlights: ? No lethality and clinical signs were observed. ? No differences in metabolic pattern between pregnant and non-pregnant rabbits. ? Rapid and similar metabolite excretion in all groups. ? Very low amount of biotransformation in all groups (< 0.1%).

  18. The effects of waist-to-hip ratio and body weight on male judgements of female physical attractiveness, wife desirability, and health, both within and between cultures. 

    E-Print Network [OSTI]

    McLean, Julia

    2007-01-01T23:59:59.000Z

    Evolutionary theories maintain that female physical attractiveness has evolved to honestly signal health and reproductive potential. Both a low waist-to-hip ratio (WHR) and a critical range of body weight have received ...

  19. PRE-MATING COMMUNICATION AND HYBRIDIZATION BETWEEN TWO MEADOW KATYDIDS, ORCHELIMUM NIGRIPES AND O. PULCHELLUM (ORTHOPTERA: TETTIGONIIDAE): MALE CALLING SONG AND ASYMMETRIC FEMALE PREFERENCE

    E-Print Network [OSTI]

    Miller, Ginger

    2010-12-06T23:59:59.000Z

    , males of both parental species and the hybrids would sing from lower grassy vegetation as well as high in kudzu and trees. They were also observed feeding on seeds and insect prey (which were ubiquitous), so this hybrid zone is not likely an ecotonal...

  20. Conflict ln Married Couples: Personality Predictors of Anger and Upset

    E-Print Network [OSTI]

    Pillow, Jonathan

    Conflict ln Married Couples: Personality Predictors of Anger and Upset David M. Buss University (Buss, 1989; Muehlenhard & Linton, 1987). Men and women perform actions that upset and anger their dates of this article. Correspondence should be addressed to David M. Buss, Department of Psychology, University

  1. ORIGINAL PAPER The effect of perceived female parasite

    E-Print Network [OSTI]

    Jones, Adam

    in behavioral ecology have resulted in a deeper appreciation of post-mating processes and sexual conflict and that a male's perception of female parasite load can be altered by tattooing females. We manipulated-copulatory sexual selection is dependent on a male's perception of female parasite load in pipefish. Our results

  2. Guidance on the Use of Hand-Held Survey Meters for radiological Triage: Time-Dependent Detector Count Rates Corresponding to 50, 250, and 500 mSv Effective Dose for Adult Males and Adult Females

    SciTech Connect (OSTI)

    Bolch, W.E. [University of Florida; Hurtado, J.L. [University of Florida; Lee, C. [University of Florida; Manger, Ryan P [ORNL; Hertel, Nolan [Georgia Institute of Technology; Burgett, E. [Georgia Institute of Technology; Dickerson, W. [Armed Force Radiobiological Research Institute

    2012-01-01T23:59:59.000Z

    In June 2006, the Radiation Studies Branch of the Centers for Disease Control and Prevention held a workshop to explore rapid methods of facilitating radiological triage of large numbers of potentially contaminated individuals following detonation of a radiological dispersal device. Two options were discussed. The first was the use of traditional gamma cameras in nuclear medicine departments operated as makeshift wholebody counters. Guidance on this approach is currently available from the CDC. This approach would be feasible if a manageable number of individuals were involved, transportation to the relevant hospitals was quickly provided, and the medical staff at each facility had been previously trained in this non-traditional use of their radiopharmaceutical imaging devices. If, however, substantially larger numbers of individuals (100 s to 1,000 s) needed radiological screening, other options must be given to first responders, first receivers, and health physicists providing medical management. In this study, the second option of the workshop was investigated by the use of commercially available portable survey meters (either NaI or GM based) for assessing potential ranges of effective dose (G50, 50Y250, 250Y500, and 9500 mSv). Two hybrid computational phantoms were used to model an adult male and an adult female subject internally contaminated with 241Am, 60Cs, 137Cs, 131I, or 192Ir following an acute inhalation or ingestion intake. As a function of time following the exposure, the net count rates corresponding to committed effective doses of 50, 250, and 500 mSv were estimated via Monte Carlo radiation transport simulation for each of four different detector types, positions, and screening distances. Measured net count rates can be compared to these values, and an assignment of one of four possible effective dose ranges could be made. The method implicitly assumes that all external contamination has been removed prior to screening and that the measurements be conducted in a low background, and possibly mobile, facility positioned at the triage location. Net count rate data are provided in both tabular and graphical format within a series of eight handbooks available at the CDC website (http://www.bt.cdc.gov/radiation/clinicians/evaluation).

  3. Analyses of the number of times married: U.S. women 1995-1996 

    E-Print Network [OSTI]

    Melick, Emily A

    2003-01-01T23:59:59.000Z

    of times women marry, and the main variables associated, which are age, race, metropolitan status, and education. Based on this review, I then develop several hypotheses, which I will test in Chapter IV, the analysis chapter of this thesis. This thesis... was influential in rates of dissolution after a remarriage. Within a ten year period, almost half (47 percent) of the women who experienced a marital dissolution and remarried before age 25 had ended their new marriage as well. Women, who married, divorced...

  4. Male body image: critical measurement issues

    E-Print Network [OSTI]

    Brown, Joshua Daniel

    2002-01-01T23:59:59.000Z

    12 16 RESULTS. . . 18 Companng the SM and the BIA m the Assessment of Body Image. How Accurate Were Males and Females m Gauging Their Musculanty and Body Fatness' ?. . . How Accurate Were Males and Females m Gauging What the Opposite Sex Found...-wise Compansons for Quesuon Main Effects wtth BF%. Male and Female. 49 9 Comparmg Effect Sizes (Current vs. Ideal) Body Image Assessment (BIA) vs Somatomorphic Matnx (SM) 50 10 Factor Structure of the Affective Body Satisfaction (ABS). 51 11 Comparing Explamed...

  5. Female Biology Professor: Jennifer Dever

    E-Print Network [OSTI]

    Dever, Jennifer A.

    grandmother did not & vice versa? n What are the most pressing issues for women today? (locally & globally's philosophy on women Hysteria - - - hysterectomy #12;8/15/12 3 n Females and males ARE different... more than to keep in mind for the Health field NOW - Re-defining women's roles, the feminist perspective science

  6. Health status and the labor force participation decisions of married couples

    E-Print Network [OSTI]

    Lin, Peng

    2009-05-15T23:59:59.000Z

    This thesis examines the labor force participation decisions of married couples, and special attention is paid to a spouse’s health conditions affecting their own and the spouse’s labor force participation decision. I used the Health and Retirement...

  7. Costs influence male mate choice in a freshwater fish

    E-Print Network [OSTI]

    Keogh, Scott

    Costs influence male mate choice in a freshwater fish Bob B. M. Wong* and Michael D. Jennions that female mate choice decisions depend on the direct costs of choosing (either because of search costs or male-imposed costs). Far less is known about how direct fitness costs affect male mate choice. We

  8. Mothers' perceptions of housing space : an analysis of 3 married student housing sites: Eastgate, Westgate and Peabody Terrace

    E-Print Network [OSTI]

    Racki, Reena

    1974-01-01T23:59:59.000Z

    What is a good housing environment for nurturing, a place where the physical environment reinforces the lives of both parents and child? This thesis looks at three married student housing sites in Cambridge, Massachusetts, ...

  9. Female preference for complex male displays in hybridizing swordtails

    E-Print Network [OSTI]

    Cress, Zachary Pierce

    2009-05-15T23:59:59.000Z

    five traits (standard body length, body depth, dorsal fin width, sword length and vertical bar number) correlate to one another within natural variation of populations of X. birchmanni, X. malinche and three hybrid populations and created synthetic 3...

  10. Female Figurines (Pharaonic Period)

    E-Print Network [OSTI]

    Waraksa, Elizabeth

    2008-01-01T23:59:59.000Z

    be translated “clay figure (of Isis). ” A spell to relieve arpyt Ast or “female figure of Isis. ” The term rpyt may ben sDt , a “female figure of Isis in firewood” (BM EA 9997 +

  11. Journal of Insect Behavior, Vol. 15, No. 2, March 2002 ( C 2002) Breeding Strategies in Females of the Parasitoid

    E-Print Network [OSTI]

    King, Bethia H.

    , females are generally larger than males (Napoleon and King, 1999). It is possible that some S. endius, appears to be affected by host size (Napoleon and King, 1999). Thus, large hosts may benefit mated females

  12. Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Orthoptera: Tettigoniidae)

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Anabrus simplex, a katydid in which there can be intense sexual selection on females in nature (Gwynne B I O L O G Y Keywords: Anabrus simplex; female competition; male choice; Orthoptera; selection

  13. The Female Grotesque Amid the Carnival of Renaissance Drama

    E-Print Network [OSTI]

    Guy, Corinee Wooten

    2009-04-24T23:59:59.000Z

    ’s experience.” 41 Additionally, Jacobean writers often dramatized unlicensed celebration to express concern over “their increasingly unfamiliar and unruly city” and reflected authority’s anxiety about “the symbols of its coherence, the devices of its... version of the hot, dry, well-regulated man’s, 108 so that quiet and submissive seemed a natural assignment for the female. Some Renaissance authorities suggested that overlaps between male and female humoral balances occur due to life style, climate...

  14. 0 Springer-Verlag 1989 Female turtles from hot nests

    E-Print Network [OSTI]

    Canberra, University of

    or proportion of development at high temperatures that matters? Arthur Georges Applied Ecology Research Group nests of fresh- water turtles with temperature-dependent sex determination is known to be a poor species, females are produced at high temperatures and males at low temperatures. A very narrow range

  15. Poverty and Productivity in Female-Headed Households in Zimbabwe

    E-Print Network [OSTI]

    Horrell, Sara; Krishnan, Pramila

    A household survey conducted in rural Zimbabwe in 2001 is used to compare the position of de facto and de jure female-headed households to those with a male head. These households are characterised by different forms of poverty that impinge...

  16. FEMALE SINGERS on CD IN THE MUSIC LIBRARY

    E-Print Network [OSTI]

    Lennard, William N.

    FEMALE SINGERS on CD IN THE MUSIC LIBRARY Choose the CATALOGUE, and perform a KEYWORD search, using *GRAHAM, Sandra *GREEN, Patricia # HAMARI, Julia HELLING, Hilke HODGSON, Alfreda HORNE, Marilyn *KRAUSE Librarian Music Library - Western Libraries Western University 2012/04/07 #12;MALE SINGERS ON CD

  17. Science faculty's subtle gender biases favor male students

    E-Print Network [OSTI]

    Handelsman, Jo

    of the faculty participants did not affect responses, such that female and male faculty were equally likely demands over the next decade (1). To help close this formidable gap, the report calls for the increased training and retention of women, who are starkly underrepresented within many fields of science, especially

  18. Reduced Metabolsim in Brain 'Control Networks' Following Cocaine-Cues Exposure in Female Cocaine Abusers

    SciTech Connect (OSTI)

    Volkow, N.D.; Wang, G.; Volkow, N.D.; Tomasi, D.; Wang, G.-J.; Fowler, J.S.; Telang, F.; Goldstein, R.Z.; Alia-Klein, N.; Wong, C.T.

    2011-03-01T23:59:59.000Z

    Gender differences in vulnerability for cocaine addiction have been reported. Though the mechanisms are not understood, here we hypothesize that gender differences in reactivity to conditioned-cues, which contributes to relapse, are involved. To test this we compared brain metabolism (using PET and {sup 18}FDG) between female (n = 10) and male (n = 16) active cocaine abusers when they watched a neutral video (nature scenes) versus a cocaine-cues video. Self-reports of craving increased with the cocaine-cue video but responses did not differ between genders. In contrast, changes in whole brain metabolism with cocaine-cues differed by gender (p<0.05); females significantly decreased metabolism (-8.6% {+-} 10) whereas males tended to increase it (+5.5% {+-} 18). SPM analysis (Cocaine-cues vs Neutral) in females revealed decreases in frontal, cingulate and parietal cortices, thalamus and midbrain (p<0.001) whereas males showed increases in right inferior frontal gyrus (BA 44/45) (only at p<0.005). The gender-cue interaction showed greater decrements with Cocaine-cues in females than males (p<0.001) in frontal (BA 8, 9, 10), anterior cingulate (BA 24, 32), posterior cingulate (BA 23, 31), inferior parietal (BA 40) and thalamus (dorsomedial nucleus). Females showed greater brain reactivity to cocaine-cues than males but no differences in craving, suggesting that there may be gender differences in response to cues that are not linked with craving but could affect subsequent drug use. Specifically deactivation of brain regions from 'control networks' (prefrontal, cingulate, inferior parietal, thalamus) in females could increase their vulnerability to relapse since it would interfere with executive function (cognitive inhibition). This highlights the importance of gender tailored interventions for cocaine addiction.

  19. Available online at www.sciencedirect.com Female mate choice copying affects sexual selection in wild

    E-Print Network [OSTI]

    Indiana University

    in wild populations of the ocellated wrasse SUZANNE H. ALONZO Department of Ecology and Evolutionary and importance of nonindependent female choice in wild popula- tions. In a species with male territoriality under natural conditions in the wild. I further show that a short- term experimental increase

  20. The Female of the Species is More Deadly than the Male

    E-Print Network [OSTI]

    Wright, Meg

    1982-01-01T23:59:59.000Z

    here eyes off tho delicate: HlrlnG for a moment and eyed him.ruefully. "It'd be a lot oasior if I could lift tho Hho18 suction (Jut, but those old Ac4ll models aren r t dos ignod to come a,part." He tried. to nod, found it impossibln. "Easters has.... In my u~1iv(:rsc, Or climol1S:L0n, or whcrovcr,'l .').Iil the Captain of the Ento:cprise." uIn you:-c imaGination, maybo. In your H ishcs, I \\.iarosay. In realit.y,? never. 11 HHoY! aTC you Going to link with Urock?" She stood ,:tncl facod hiii1p...

  1. MALE QUALITY INFLUENCES INTERSEXUAL DYNAMICS, BUT NOT FEMALE INTRASEXUAL COMPETITION, IN A MONOGAMOUS, BIPARENTAL FISH

    E-Print Network [OSTI]

    Robart, Ashley Rogers

    2015-01-01T23:59:59.000Z

    carotenoids and clutch quality in the two- spotted goby (relationship between signal quality and physical condition:investment when mate quality varies: Differential allocation

  2. The Autoimmune Regulator (AIRE) preserves fertility in male and female Balb/c mice.

    E-Print Network [OSTI]

    Warren, Bryce

    2014-12-31T23:59:59.000Z

    of GnRH or gonadotropin release, or third, the infringement of the hypothalamic-pituitary portal circulatory system. Examples resulting in functional 22 destruction include hypothalamic/pituitary tumors or cysts (Citron et al., 1996) as well..., & Chipps, 1986) and artificially elevated gonadal steroids (Turek, Williams, Gilbaugh, & Lipshultz, 1995). Finally, a disruption of the pituitary portal circulatory system, which prevents GnRH from reaching the pituitary or gonadotropins from entering...

  3. FEMALE CONDITION AND DELAYED BENEFITS TO MALES THAT PROVIDE PARENTAL CARE: A REMOVAL STUDY

    E-Print Network [OSTI]

    (e.g.Da- vies 1989)hasled studentsof reproductivebe- havior to questionmore critically why malesin some

  4. A comparison of range of joint mobility in college females and males

    E-Print Network [OSTI]

    Staff, Kathy Rene

    1983-01-01T23:59:59.000Z

    the weighted end of the needle downward during the movement. This measuri ng techni que does not requi re extra equipment and the technique oi' administration was carefully described by Leighton ( 1966) so that comparative studies can be easily made. Roebuck..., et al. ( 1975) point out that the flexometer can be easily used to measure the human body in protective equipment as well as nude (except for some ankle measures). However, they also note that this method does not cons ider shi fti ng joint...

  5. Gender and stress as predictors of psychopathology in male- and female-dominated graduate disciplines

    E-Print Network [OSTI]

    Valentine, Eugenia Michelle

    1996-01-01T23:59:59.000Z

    and expectations defined by society as being culturally appropriate for each gender (O' Neil, 1982). Gender-role stereotypes, therefore, are rigid and exaggerated expectations of how each gender should behave (Basow, 1992). The stereotype that certain roles... to high occupational achievement may find that co-workers are socially unresponsive to them (Banziger a Hooker, 1979) They are often viewed as social oddities, and this may sabotage and restrict their opportunities for professional relationships...

  6. Courtship and Multi-Stage Transfer of Material to the Female's Wings During Copulation in Microsepsis armillata (Diptera: Sepsidae)

    E-Print Network [OSTI]

    Bermingham, Eldredge

    to brushes on his hind tibiae, from there to his middle tarsi, and finally to the bases of the female's wings during copulation. Males of many other sepsids also have brushes on their hind tibiae, indi cating, the osmeterium, on his hind tibia (Pont, 1979). The setae of the osme terium are said to be hollow, and to draw

  7. aging female sencar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    should increase with age after puberty. To test this, we examined age Pierce, Graham 57 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  8. .Female Pupils Perception of Electrical Engineering

    E-Print Network [OSTI]

    Tal, Ayellet

    1 .Female Pupils Perception of Electrical Engineering OrzitHazzan Technion--Israel Institute. BACKGROUND The Department of Electrical Engineering at Technion1 TheDepartmentofElectricalEngineeringatTechnion is ranked among the top-10 electrical engineering and computer science departments in the world

  9. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    Towers, S

    2008-01-01T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females.

  10. Interventional Radiology of Male Varicocele: Current Status

    SciTech Connect (OSTI)

    Iaccarino, Vittorio, E-mail: vittorio.iaccarino@unina.it; Venetucci, Pietro [University of Naples 'Federico II', Diagnostic Imaging Department-Cardiovascular and Interventional Radiology, School of Medicine (Italy)

    2012-12-15T23:59:59.000Z

    Varicocele is a fairly common condition in male individuals. Although a minor disease, it may cause infertility and testicular pain. Consequently, it has high health and social impact. Here we review the current status of interventional radiology of male varicocele. We describe the radiological anatomy of gonadal veins and the clinical aspects of male varicocele, particularly the physical examination, which includes a new clinical and ultrasound Doppler maneuver. The surgical and radiological treatment options are also described with the focus on retrograde and antegrade sclerotherapy, together with our long experience with these procedures. Last, we compare the outcomes, recurrence and persistence rates, complications, procedure time and cost-effectiveness of each method. It clearly emerges from this analysis that there is a need for randomized multicentre trials designed to compare the various surgical and percutaneous techniques, all of which are aimed at occlusion of the anterior pampiniform plexus.

  11. Sexual partner concurrency among female sex workers and their intimate male partners in two Mexico-U.S. border cities

    E-Print Network [OSTI]

    Robertson, Angela Marie; Robertson, Angela Marie

    2012-01-01T23:59:59.000Z

    que tienen clientes de una-sola-vez o no- regulares. Desdeno regulares o de una-sola-vez? ¨? ¿Cuánta información creesean regulares o de una-sola-vez)? ¨? ¿Usted cree que su

  12. Refined understanding of sulfur amino acid nutrition in hybrid striped bass, Morone chrysops (male symbol) x M. saxatilis (female symbol)

    E-Print Network [OSTI]

    Kelly, Mark Christopher

    2005-08-29T23:59:59.000Z

    Previous studies have indicated the level of total sulfur amino acids (TSAA) (methionine + cystine) is most limiting in practical diet formulations for hybrid striped bass (HSB), especially if animal feedstuffs are replaced with plant feedstuffs...

  13. The role of constrictor prostanoids in the development of aortic coarctation-induced hypertension in male and female rats

    E-Print Network [OSTI]

    Baltzer, Wendy Irene

    2005-02-17T23:59:59.000Z

    function and arterial blood pressure (MAP) during development of aortic coarctation-induced hypertension (HT). M and F rats, (15-18 wks.) in four groups: normotensive (NT), hypertensive (HT), ovariectomized (OVX), and OVX estrogen-replaced (OE), underwent...

  14. First male sperm precedence in multiply-mated females of the cooperative spider Anelosimus studiosus (Araneae, Theridiidae)

    E-Print Network [OSTI]

    Jones, Thomas C.

    University, Johnson City, Tennessee 37614, USA. E-mail: jonestc@etsu.edu Patricia G. Parker: Department

  15. O Que Não Dá Chupa: The Male-to-Female ‘Homosexual’ As Star of Brazil’s Economic Boom

    E-Print Network [OSTI]

    Costa, Diego

    2012-01-01T23:59:59.000Z

    Homosexual” As The Star of Brazil’s Economic Boom (earlyof Southern California Two of Brazil’s most re-occurringabout itself are that Brazil is the country of the future,

  16. Self-selection contributes significantly to the lower adiposity of faster, longer-distanced, male and female walkers

    E-Print Network [OSTI]

    Williams, Paul T.

    2006-01-01T23:59:59.000Z

    depend upon the sample percentile of the BMI or body1 shows that the 90 th percentile of BMI declines morevelocity than lower BMI percentiles, a phenomenon also

  17. The effects of two situational variables on the self-confidence of males and females in achievement settings

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  18. The effects of two situational variables on the self-confidence of males and females in achievement settings 

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  19. Early career outcomes of male and female agricultural graduates: a synthesis of human capital and comparable worth theories

    E-Print Network [OSTI]

    Hamer-Cotten, Jennifer Faye

    1991-01-01T23:59:59.000Z

    spring 1987. Forty-two percent (n=2, 284) of the alumni responded. To adjust for institutional response bias, the sample of respondents was weighted according to each institution's proportion of the total 1977 agricultural enrollment. Men represent... with agricultural alumni in 1987 resulted in 2, 049 respondents. Overall, gender disparity occurred during graduates' early career development. Relative to men, women received lower employment compensation (i. e. , salary and benefits) regardless of similarities...

  20. CS 302 Data Structures Programming Assignment 6

    E-Print Network [OSTI]

    Gunes, Mehmet Hadi

    Jimmy Lillian AND John BEGET SON Bill Jimmy MARRIES Rosy FEMALE Sally EXISTS Sally MARRIES Bill FEMALE Jane EXISTS FEMALE Barb EXISTS Jane MARRIES Fritz Barb MARRIES Tom Jimmy AND Rosy BEGET SON Kevin Tom AND Barb BEGET SON Marvin Barb AND Tom BEGET DAUGHTER Mary Rosy AND Jimmy BEGET DAUGHTER Amy Jimmy AND Rosy

  1. Mathematical models and specific absorbed fractions of photon energy in the nonpregnant adult female and at the end of each trimester of pregnancy

    SciTech Connect (OSTI)

    Stabin, M.G.; Watson, E.E.; Cristy, M.; Ryman, J.C.; Eckerman, K.F. [Oak Ridge National Lab., TN (United States)] [Oak Ridge National Lab., TN (United States); Davis, J.L. [Tennessee Univ., Chattanooga, TN (United States)] [Tennessee Univ., Chattanooga, TN (United States); Marshall, D. [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering] [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering; Gehlen, M.K. [San Diego State Univ., CA (United States)] [San Diego State Univ., CA (United States)

    1995-05-08T23:59:59.000Z

    Mathematical phantoms representing the adult female at three, six, and nine months of gestation are described. They are modifications of the 15-year-old male/adult female phantom (15-AF phantom) of Cristy and Eckerman (1987). The model of uterine contents includes the fetus, fetal skeleton, and placenta. The model is suitable for dose calculations for the fetus as a whole; individual organs within the fetus (other than the skeleton) are not modeled. A new model for the nonpregnant adult female is also described, comprising (1) the 15-AF phantom; (2) an adjustment to specific absorbed fractions for organ self-dose from photons to better match Reference Woman masses; and (3) computation of specific absorbed fractions with Reference Woman masses from ICRP Publication 23 for both penetrating and nonpenetrating radiations. Specific absorbed fractions for photons emitted from various source regions are tabulated for the new non;pregnant adult female model and the three pregnancy models.

  2. asymptomatic female patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 33 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  3. anaesthetized female rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a 16-mg lead or a control solution for 30 days... Rocha, Angelica 2009-05-15 55 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  4. allotriploid hybryd females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 10 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  5. Abnormal reproductive function in female homozygous leaner mice

    E-Print Network [OSTI]

    Serpedin, Nesrin

    2004-09-30T23:59:59.000Z

    Major Subject: Toxicology ABNORMAL REPRODUCTIVE FUNCTION IN FEMALE HOMOZYGOUS LEANER MICE A Thesis...) (Chair of Toxicology Faculty) December 2003 Major Subject: Toxicology iii ABSTRACT Abnormal Reproductive Function in Female Homozygous...

  6. Impaired Visuospatial Processing in Young Adult Female Fragile X

    E-Print Network [OSTI]

    Nguyen, Danh

    Trends in Children Yingratana Bella McLennan, Ling Wong, Naomi Goodrich-Hunsaker, Danielle Harvey, FloraXPCs show faster psychomotor speed compared to HCs Female Motor Reaction Times Female Oral Reaction Times was accounted for but had no significant difference in error rates as compared to controls However, female

  7. Male body image: testosterone's response to body comparisons

    E-Print Network [OSTI]

    Brown, Joshua D.

    2006-08-16T23:59:59.000Z

    Although there have been only a few etiological studies that have examined the development and maintenance of body image in males, research fairly consistently reports that exposure and presumed comparison to images of ideal male bodies increases...

  8. The role of human and social capital in explaining the lack of female head coaches in women's intercollegiate sports

    E-Print Network [OSTI]

    Stumph, Kelly J

    2013-02-22T23:59:59.000Z

    likely receiving lower salaries than males. vet the 1'cmales did not report less career satisfaction (Parks et al. , 1995). There are specific factors attributed to the disparity ol' 1'emale head soccer coaches. 'I'he intrinsic measure of career success... that this salary deficit is simply a result of vvomen earning lower salaries in an array of industries not just that of coaching. For instance, it was reported that in 1995, a full-time female communications manager earned $. 86 for every $1. 00 earned bv her...

  9. adolescent female rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 48 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  10. adolescent female football: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    56 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  11. american female adolescents: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  12. american adolescent females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  13. adolescent female attendance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    35 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  14. adolescent female distance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    distance 26 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  15. adolescent females affected: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 42 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  16. adult female giraffe: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of 14 ESTIMATION OF ANNUAL AND SEMI-ANNUAL SURVIVAL OF ADULT FEMALE BLUE CRABS AND ASSESSMENT OF THE EFFECTIVENESS OF THE Biology and Medicine Websites Summary: ESTIMATION...

  17. A chimera embryo assay reveals a decrease in embryonic cellular proliferation induced by sperm from X-irradiated male mice

    SciTech Connect (OSTI)

    Obasaju, M.F.; Wiley, L.M.; Oudiz, D.J.; Raabe, O.; Overstreet, J.W.

    1989-05-01T23:59:59.000Z

    Male mice were divided into three experimental groups and a control group. Mice in the experimental groups received one of three doses of acute X irradiation (1.73, 0.29, and 0.05 Gy) and together with the control unirradiated mice were then mated weekly to unirradiated female mice for a 9-week experimental period. Embryos were recovered from the weekly matings at the four-cell stage and examined by the chimera assay for proliferative disadvantage. Aggregation chimeras were constructed of embryos from female mice mated to irradiated males (experimental embryos) and embryos from females mated to unexposed males (control embryos) and contained either one experimental embryo and one control embryo (heterologous chimera) or two control embryos (control chimera). The control embryo in heterologous chimeras and either embryo in control chimeras were prelabeled with the vital dye fluorescein isothiocyanate (FITC), and the chimeras were cultured for 40 h and viewed under phase-contrast and epifluorescence microscopy to obtain total embryo cell number and the cellular contribution from the FITC-labeled embryo. Experimental and control embryos that were cultured singly were also examined for embryo cell number at the end of the 40-h culture period. In control chimeras, the mean ratio of the unlabeled cells:total chimera cell number (henceforth referred to as ''mean ratio'') was 0.50 with little or no weekly variation over the 9-week experimental period. During Weeks 4-7, the mean ratios of heterologous chimeras differed significantly from the mean ratio of control chimeras with the greatest differences occurring during Week 7 (0.41 for chimeras of 0.05 Gy dose group, 0.40 for chimeras of the 0.29 Gy dose group, and 0.17 for chimeras of the 1.73 Gy dose group).

  18. aged male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. adult male subjects: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. adolescent male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. american male smokers: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. asymptomatic older male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male voxel: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. aging male symptoms: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. adult male rural: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male circumcision: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. adult males crustacea: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male offspring: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. adult male subantarctic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult male rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. adult male case: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. abortive cytoplasmic male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. adult male rhesus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. adult male patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. adult male population: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. adolescent male physical: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. adult male sprague: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. adult male canaries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. adolescent male evidence: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adult male albino: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. atlantic male walruses: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male guppy: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. anesthetized male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male acquired: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. adult male patients: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male reproductive: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. affects male type: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male leather: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. abdominalis choosy males: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult males pt: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. adult males characterized: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. adolescent male kalenjin: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. adult male spinal: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. altered male physiologic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. apoe ko male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. adult male mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. aging male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. aging male focus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. anopheles gambiae male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adult male wistar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. aging male treatment: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. advance transobturator male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. affecting male fertility: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. affected male demonstration: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. Limits of Equivalence: Thinking Gay Male Subjectivity Outside Feminist Theory

    E-Print Network [OSTI]

    Galloway, Samuel R.

    2010-01-01T23:59:59.000Z

    Limits of Equivalence: Thinking Gay Male Subjectivityor this limit of equivalence? The problem, of course, ispaper, the limits of equivalence emerge: while all subjects

  7. Management of Male Breast Cancer in the United States: A Surveillance, Epidemiology and End Results Analysis

    SciTech Connect (OSTI)

    Fields, Emma C., E-mail: emma.fields@ucdenver.edu [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States); DeWitt, Peter [Colorado Biostatistics Consortium, University of Colorado, Aurora, Colorado (United States); Fisher, Christine M.; Rabinovitch, Rachel [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States)

    2013-11-15T23:59:59.000Z

    Purpose: To analyze the stage-specific management of male breast cancer (MBC) with surgery and radiation therapy (RT) and relate them to outcomes and to female breast cancer (FBC). Methods and Materials: The Surveillance, Epidemiology, and End Results database was queried for all primary invasive MBC and FBC diagnosed from 1973 to 2008. Analyzable data included age, race, registry, grade, stage, estrogen and progesterone receptor status, type of surgery, and use of RT. Stage was defined as localized (LocD): confined to the breast; regional (RegD): involving skin, chest wall, and/or regional lymph nodes; and distant: M1. The primary endpoint was cause-specific survival (CSS). Results: A total of 4276 cases of MBC and 718,587 cases of FBC were identified. Male breast cancer constituted 0.6% of all breast cancer. Comparing MBC with FBC, mastectomy (M) was used in 87.4% versus 38.3%, and breast-conserving surgery in 12.6% versus 52.6% (P<10{sup ?4}). For males with LocD, CSS was not significantly different for the 4.6% treated with lumpectomy/RT versus the 70% treated with M alone (hazard ratio [HR] 1.33; 95% confidence interval [CI] 0.49-3.61; P=.57). Postmastectomy RT was delivered in 33% of males with RegD and was not associated with an improvement in CSS (HR 1.11; 95% CI 0.88-1.41; P=.37). There was a significant increase in the use of postmastectomy RT in MBC over time: 24.3%, 27.2%, and 36.8% for 1973-1987, 1988-1997, and 1998-2008, respectively (P<.0001). Cause-specific survival for MBC has improved: the largest significant change was identified for men diagnosed in 1998-2008 compared with 1973-1987 (HR 0.73; 95% CI 0.60-0.88; P=.0004). Conclusions: Surgical management of MBC is dramatically different than for FBC. The majority of males with LocD receive M despite equivalent CSS with lumpectomy/RT. Postmastectomy RT is greatly underutilized in MBC with RegD, although a CSS benefit was not demonstrated. Outcomes for MBC are improving, attributable to improved therapy and its use in this unscreened population.

  8. Regulation and Execution of Meiosis in Drosophh Males

    E-Print Network [OSTI]

    9 Regulation and Execution of Meiosis in Drosophh Males lean Maines and Steven Wasserm. Identification of Male Meiotic Mutant\\ IT. Regulation of the Meiotic Cell Divisions A. Entry into Meiosis B. Regulation of the Cell Cycle Machinery C. Coordination of Meio\\i\\ with Diflerentiation D. Regulation

  9. Adult Female English Language Learners: Investment, Identity and Benefits 

    E-Print Network [OSTI]

    Wharton, Anna

    2013-07-31T23:59:59.000Z

    for investing in the English language. This study explores the self-recounted experiences of three adult female English language learners’ (ELLs) motivation for investing in English language learning, their identities and the benefits gained in a nonacademic...

  10. adult female mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 18 19 20 21 22 23 24 25 Next Page Last Page Topic Index 1 The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice MIT - DSpace...

  11. Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model

    E-Print Network [OSTI]

    Brinton, Roberta Diaz

    Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model and suggests therapeutic targets for prevention of AD. ABAD aging bioenergetics brain hypometabolism mitochondria The essential role of mitochondria in cellular bioenergetics and survival has been well

  12. Communication Standards for the Female Technical Sales Professional

    E-Print Network [OSTI]

    Macke, Brenda

    2005-12-16T23:59:59.000Z

    Communication techniques to be used by female technical sales professionals (FTSP) with clients were explored by researching gender communication, technical communication, and sales communication. It was found that by ...

  13. Fertility, Female Participation in Employment and Reconciliation Policies in Spain 

    E-Print Network [OSTI]

    Ibanez, Marta

    2010-01-01T23:59:59.000Z

    Different aspects of decisions regarding parenthood are analysed. From an institutional perspective, reconciliation policies and features of the female labour market are studied, as well as the values and life views that ...

  14. Diet composition and performance of female collegiate soccer players 

    E-Print Network [OSTI]

    Clark, Mandy Michele

    2001-01-01T23:59:59.000Z

    intake. In conclusion, female soccer players appear to meet caloric needs during periods of training, but fail to meet minimum CHO and micronutrient recommendations. Foods higher in protein and fat, in addition to foods with low nutrient value may...

  15. The effects of ethylene dibromide on the reproductive system of male mice and male rabbits

    E-Print Network [OSTI]

    Hess, Kay

    1978-01-01T23:59:59.000Z

    Ethylene dibromide (EDB) is used as an addit1ve in leaded gasolines, as a fumigant and pesticide, as a solvent and as an intermediate to various products. But recently, due to some speculat1on, concern has grown over the possible effects of EDB... has terminated in ei ther conflicting reports or unpublished data. The newspapers caption front page articles--"Worries Are Growing Over Male Infertility Because of Job Hazards". And due to growing I Citations used on the following pages follow...

  16. The relationship of male socialization and personality pathology in male batterer subtypes

    E-Print Network [OSTI]

    Shefferman, Lee

    2007-09-17T23:59:59.000Z

    invaluable. I always joked that you were my Texas mother and yet there is a lot of truth in that statement. You fed me (love the wine mushrooms) and looked out for me. I would also like to thank John Wagner for sitting me down and giving me a talking... techniques may not be the sole or most effective 9 therapeutic intervention for treating male batterers. Specifically, such a finding may provide further evidence for the need to tailor treatment approaches based on batterer subtype and to consider...

  17. SWET for the Summit: Exploration of Singapore’s First All-female Mount Everest Team

    E-Print Network [OSTI]

    Goh, Tan Leng

    2009-01-01T23:59:59.000Z

    FEMALE MOUNT EVEREST TEAM SWET for the Summit: ExplorationAll-female Mount Everest Team Tan Leng Goh California Statecommunity. The first all female team to summit Mount Everest

  18. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    S. Towers

    2008-04-19T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females. The author has a PhD in particle physics and worked for six years as a postdoctoral research scientist, five of which were spent collaborating at Fermilab. She is currently completing a graduate degree in statistics.

  19. A Crack in the Pipeline: Why Female Underrepresented Racial Minority Students Leave Engineering

    E-Print Network [OSTI]

    Vazquez-Akim, Jenn

    2014-01-01T23:59:59.000Z

    Espinosa, Lorelle L. (2011). Pipelines and pathways: womenAngeles A Crack in the Pipeline: Why Female UnderrepresentedA Crack in the Pipeline: Why Female Underrepresented Racial

  20. Exploration of pathways related to the decline in female circumcision in Egypt

    E-Print Network [OSTI]

    Modrek, Sepideh; Liu, Jenny X

    2013-01-01T23:59:59.000Z

    decline in female circumcision in Egypt. BMC Public HealthFemale circumcision in Egypt: social implications, currentfemale circumcision in Egypt: evidence and interpretation.

  1. SWORDTAIL MATE CHOICE AND REPRODUCTIVE ALLOCATION: EFFECTS OF MALE CONDITION

    E-Print Network [OSTI]

    Simpson, Suzanne

    2011-04-26T23:59:59.000Z

    were placed on a ?High-food? (HF) or ?Low-food? (LF) diet with 30 HF and 30 LF. Within each group (HF or LF) the males were then divided into tanks with 5 males per tank. Thus we had 6 HF replicates and 6 LF replicates. The males were consistently fed... of covariance GLM Generalized linear model GLMM Generalized linear mixed model HF High-food LF Low-food R Statistical program used for data analysis vi TABLE OF CONTENTS Page ABSTRACT...

  2. adolescent male health: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROMOTION AMONG RACIAL AND ETHNIC MINORITY MALES Funding Opportunity Number: PA-10-236. CFDA Number(s): 93.361, 93.847, 93.837, 93.399. Engineering Websites Summary: initial and...

  3. Alternative mating tactics and extreme male dimorphism in fig wasps. 

    E-Print Network [OSTI]

    Cook, James M; Compton, Steven G; Herre, E Allen; West, Stuart A

    1997-01-01T23:59:59.000Z

    The dimorphisms in morphology and behaviour of male fig wasps are among the most extreme in the animal kingdom, and offer excellent oppotunities to test the predictions of certain sexual selection models.

  4. Nils G. M. Brunsson Married, four children.

    E-Print Network [OSTI]

    Moeller, Ralf

    les organisations. Paris: L'Harmattan, 2004. A:46 Marknad, organisation och reform, in Claes, no 3, 2005 (with G. Ahrne). A:49 Reform als routine, in Corsi, G. and Esposito, E. Reform un Innovation- Andersson (eds.) Transnational Governance. Cambridge University Press 2006. A:54 Reforms, organization

  5. Are you currently married? Place of Birth

    E-Print Network [OSTI]

    Lin, Zhiqun

    or one of its subsidiaries? Yes No If so, what is the Location? Do you have an interest in working Metallurgy? If so, describe your interest? Do you have an interest in working in Iowa upon graduation? Yes stay in school if you were not working? Yes No Do you have an interest in bridge design

  6. Zinc levels in hair of pre-adolescent females

    E-Print Network [OSTI]

    Earp, Cheryl Fricke

    1978-01-01T23:59:59.000Z

    values in the same row, bearing a, common super- script letter, are not (P+. 05) significantly different. 29 Figure 3. Zinc Content of Hair from Medium Income Females According to Age and Ethnic Origin. IOyr. olds 9 yr. olds cd I I yr. olds l50... loo Negro Ethnic Origin Mexican CaUcasian 31 Figure 4. Zinc Content oi Hair from Low Income Females According to age and Ethnic Origin. 9yr. olds O z lO r O C N II yr, olds 100 Negro Ethnic Origin Mexican Caucasian The hair zinc means...

  7. Female Health Issues: Part I Gynecological Dif:iculties

    E-Print Network [OSTI]

    Dever, Jennifer A.

    care provider B. The Progressive Era (1890's-1920's) · Reformers worked to change availability of prenatal & child health care #12;10/29/12 3 C. 60's & 70's redefining10/29/12 1 Female Health Issues: Part I ­ Gynecological Dif:iculties I

  8. A Female Homo erectus Pelvis from Gona, Ethiopia

    E-Print Network [OSTI]

    Utrecht, Universiteit

    A Female Homo erectus Pelvis from Gona, Ethiopia Scott W. Simpson,1,2 Jay Quade,3 Naomi E. Levin,4 of Gona, Afar, Ethiopia. This obstetrically capacious pelvis demonstrates that pelvic shape in H. erectus), in the Gona Paleoanthropological Research Project study area in the Afar Regional State, Ethiopia (Fig. 1

  9. Women & early-stage entrepreneurship : examining the impact of the venture funding crisis on male and female-led technology start-ups

    E-Print Network [OSTI]

    Swaminathan, Shuba

    2010-01-01T23:59:59.000Z

    Women in technology have always been a minority and the number of women who are founders of venture backed start-ups is even lower. This research empirically investigates venture capital funding received by entrepreneurs ...

  10. An exploratory study of the effects of job characteristics on wage determination and wage differentials between workers in male-dominated and female-dominated occupations

    E-Print Network [OSTI]

    Allen, William Keith

    1984-01-01T23:59:59.000Z

    in construct validity. Past studies in the area of wage determination and wage differentials have ttvually looked at wage differentials between men and women. After the introduction of legislation such as the Equal Pay Act of 1963 and Title VII of the Civil... the passage oi' the Equal Pay Act of 1963 and at that time it wss not unusual to find men receiving higher wages than women for virtually the same work). The results of studies by McNulty (1967) and Buckley (1971) support Fuchs' (1971) findings...

  11. Fiona R.L. Burford Peter K. McGregor Rui F. Oliveira Male-like mudballing behavior of some female fiddler crabs (Uca tangeri)

    E-Print Network [OSTI]

    are carried from within the burrow to the mudflat surface and placed in the area surrounding the burrow

  12. Quantitative genetics of growth, carcass-quality traits, and disease resistance in hybrid striped bass (Morone chrysops [female] x Morone saxatilis [male])

    E-Print Network [OSTI]

    Wang, Xiaoxue

    2009-05-15T23:59:59.000Z

    A 10 x 10 factorial mating design and a ‘common-garden’ rearing approach were employed to examine genetic effects and heritability of growth, carcass-quality traits, and disease resistance, important production traits in the aquaculture of hybrid...

  13. Race and Male Employment in the Wake of the Great Recession

    E-Print Network [OSTI]

    Saldin, Dilano

    Race and Male Employment in the Wake of the Great Recession: Black Male Employment Rates by this Center), nearly half of working-age black males were not employed in many inner city neighborhoods.1 another devastating blow to inner city economies and the employment prospects of African American males

  14. The female protagonists in the novels of Romulo Gallegos

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  15. The female protagonists in the novels of Romulo Gallegos 

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  16. The evolution of infanticide by males in mammalian societies

    E-Print Network [OSTI]

    Lukas, Dieter; Huchard, Elise

    2014-11-14T23:59:59.000Z

    of social monogamy in mammals. Science 341, 526-530 (2013). 10. C. Opie, Q. D. Atkinson, R. I. M. Dunbar, S. Schultz, Male infanticide leads to social monogamy in mammals. Proc. Natl. Acad. Sci. U. S. A. 110, 13328-13332 (2013). 11. G. R. Pradhan, C. P. Van...

  17. Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini)

    E-Print Network [OSTI]

    Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini) Simone C 2011 ­ Accepted 23 June 2011 Abstract ­ Several groups of solitary bees, known as oil-collecting bees, oil-collecting bees belong to the tribes Centridini, Tapinotaspidini, and Tetrapediini (Apidae: Apinae

  18. An Analysis of Three White Male High School Assistant Principal Perceptions of Black Males Students in a Suburban District

    E-Print Network [OSTI]

    Ragsdale, Laura Anne

    2013-05-09T23:59:59.000Z

    Introduction ????.????????????????.. 28 Employment ????????????????????.. 31 Equity of Salary and Low Wages ????????????. 37 Mobility ?????????????????????? 38 Structure of a Nuclear Family ?????????????.. 41 Discrimination in Society...-Identification ???????????????.??? 57 ?Acting White? ???????????????????. 61 Discipline ?????????????????????.. 65 Theories Impacting Achievement of Black Males ?????????. 71 Discrimination and Prejudice in Society ?????????... 71 Expectations by Schools...

  19. Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective

    E-Print Network [OSTI]

    Fedigan, Linda M.

    Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective MARY S; reproductive termination ABSTRACT This study explores the question of reproductive termination (loss used a large sample of completed lives to identify reproductively terminated female Japanese macaques

  20. Berries Bittersweet: Visual Representations of Black Female Sexuality in Contemporary American Pornography

    E-Print Network [OSTI]

    Cruz, Ariane Renee

    2010-01-01T23:59:59.000Z

    moving image porn featuring gay male anal penetration usings Anal Show (1-5). Renowned originator of gonzo porn, John

  1. Factors Influencing a Female’s Selection of a Construction Management Degree: A Study of Junior- and Senior-Level Undergraduate Students

    E-Print Network [OSTI]

    Ritter, Lisa M

    2014-07-24T23:59:59.000Z

    the industry so they may tap into this market segment. Many influential factors have been identified as to a female’s decision to pursue a career in the construction industry, starting with their decision to pursue an undergraduate construction management (CM...

  2. ORIGINAL PAPER A lover, not a fighter: mating causes male crickets

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    studies have examined the effects of mating experience on agonistic behaviour, despite the fact that dominant males usually acquire more matings. We investigated the effect of mating experience on male weapon size) and conducted two experiments. In the first, we varied male mating experience by allowing

  3. Adenosine analogs inhibit fighting in isolated male mice

    SciTech Connect (OSTI)

    Palmour, R.M.; Lipowski, C.J.; Simon, C.K.; Ervin, F.R.

    1989-01-01T23:59:59.000Z

    The potent adenosine analogs N-ethylcarboxamide adenosine (NECA) and phenylisopropyladenosine (PIA) inhibit fighting and associated agonistic behaviors in isolated male mice. These effects are reversed by methylxanthines; moderate doses of NECA which inhibit fighting have minimal effects on spontaneous locomotor activity. At very low doses, both NECA and PIA increase fighting in parallel with previously reported increases of motor activity. Brain levels of (/sup 3/H)-NECA and (/sup 3/H)-PIA achieved at behaviorally effective doses suggest an involvement of adenosine receptors. The biochemical mechanism of adenosine receptor action with respect to fighting is unknown, but may include neuromodulatory effects on the release of other, more classical neurotransmitters.

  4. Embryonic effects transmitted by male mice irradiated with 512 MeV/u {sup 56}Fe nuclei

    SciTech Connect (OSTI)

    Wiley, L.M.; Van Beek, M.E.A.B.; Raabe, O.G.

    1994-06-01T23:59:59.000Z

    High-energy, high-charge nuclei may contribute substantially to the yearly equivalent dose in space flight from galactic cosmic radiation (GCR) at solar minimum. The largest single heavy-ion component is {sup 56}Fe. We used the mouse embryo chimera assay to test 512 MeV/u {sup 56}Fe nuclei for effects on the rate of proliferation of embryonic cells transmitted by sperm from irradiated mice. Male CD1 mice were acutely irradiated with 0.01, 0.05, or 0.1 Gy (LET, 184 keV/{mu}m; fluence, 3.5 x 10{sup 4}-3.3 x 10{sup 5} nuclei/cm{sup 2}; average dose rate, 0.02 Gy/min) at the Lawrence Berkeley Laboratory BEVATRON/BEVALAC Facility in Berkeley, CA. Irradiated males were bred weekly for 7 weeks to nonirradiated females and their four-cell embryos were paired with control embryos, forming aggregation chimeras. After 30-35 h of culture, chimeras were dissociated to obtain {open_quotes}proliferation ratios{close_quotes} (number of cells contributed by the embryo from the irradiated male/total number of cells in the chimera). Significant dose-dependent decreases in proliferation ratios were obtained across all three dose groups for postirradiation week 2 (P < 0.05 to P < 0.003). The 0.01- and 0.05-Gy dose groups also produced significant decreases in proliferation ratios for postirradiation week 1 (P < 0.05 to P < 0.01) and the 0.05-Gy dose group produced significant decreases in proliferation ratios for postirradiation week 6 (P < 0.05). Postirradiation weeks 1, 2 and 6 correspond to irradiation of epididymal sperm, testicular spermatids and spermatogonia, respectively. We calculate that only about 5% of sperm in the 0.1-Gy, 2.5% in the 0.05-Gy and 0.5% in the 0.01-Gy dose groups sustained direct hits from {sup 56}Fe nuclei. However, up to 47% of sperm during postirradiation weeks 1 and 2 transmitted proliferation ratios that were at or below one standard deviation from control mean proliferation ratios. 26 refs., 4 figs., 10 tabs.

  5. The Effects of Alcohol and Age on Astrocytes In Female Rats Following an Inflammatory Stimulus

    E-Print Network [OSTI]

    Simpson, Ashley

    2009-09-30T23:59:59.000Z

    THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING AN INFLAMMATORY STIMULUS A Senior Scholars Thesis by ASHLEY NICOLE SIMPSON Submitted to the Office of Undergraduate Research Texas A...&M University In partial fulfillment of the requirements for the designation as UNDERGRADUATE RESEARCH SCHOLAR April 2006 Major: Biology THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING...

  6. IMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK DIETS WITH

    E-Print Network [OSTI]

    tested, menhaden fish oil provided female white bass broodstock the fatty acids (~3.9% n-3 long fish oil are essential for embryonic survival, sunshine bass appear to have lower n-3 LCIMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK

  7. Why have there been so few female Nobel laureates in science and just

    E-Print Network [OSTI]

    Barbosa, Marcia C. B.

    Why have there been so few female Nobel laureates in science ­ and just two in physics? The usual werecausedbyoxidationatthetipsof thecarbonanodes.Shetookoutmany patents for searchlights and cinema projectors, and in 1902 be secondary." She ended up abandoning science. But being single did not make the life of the female scientist

  8. aging male hypothalamic-pituitary-gonadal: Topics by E-print...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. advertisement-call modification male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. Human exploitation of male fiddler crab claws: behavioural consequences and implications for conservation

    E-Print Network [OSTI]

    during low tide and the major claw is pulled off and the male is then released on the mudflat. This human

  11. Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males

    E-Print Network [OSTI]

    Rüedi, Peter

    Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males on wild banded mongooses, Mungos mungo, suggests that overmarking may primarily affect behavioural mating

  12. Chemical mediation of male mate location behavior in the parasitoid Cardiochiles nigriceps (Hymenoptera: Braconidae)

    E-Print Network [OSTI]

    Syvertsen, Thomas Charles

    1992-01-01T23:59:59.000Z

    . nigriceps on the downwind edge of the slide (Figure 4). After the male became relaxed the air stream was turned on and the responses of the male were recorded with a video camera. Each male was allowed 1. 0 minute to respond. If the response was positive... and courtship was elicited no max- imum observation time was set and the behaviors were observed until the male dismounted the model. Video recordings of the experiments were re- played at a later time and events were logged with an event recorder. Courtship...

  13. The role of male-male relationships in partner violence treatment groups: the effects of improving same sex relationships on attachment

    E-Print Network [OSTI]

    Barnes, Ashley D.

    2009-05-15T23:59:59.000Z

    ; Gondolf, 1997; Holtzworth-Munroe & Meehan, 2004). Outcome research has demonstrated that of those males who completed treatment for domestic violence, recidivism rates ranged from 24% to 40% within 6 to 24 months 3 following termination (Gondolf...

  14. LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA)

    E-Print Network [OSTI]

    LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA) IN SHARK BAY Management Title of Thesis: Large-Scale Movement Patterns of Male Loggerhead Sea Turtles (Caretta caretta) in Shark Bay, Australia Report No. 524 Examining Committee: Chair: Christine Gruman Master of Resource

  15. Mechanisms of Mating-Behavior Deterioration in Early Aging Male C. elegans 

    E-Print Network [OSTI]

    Guo, Xiaoyan

    2014-08-06T23:59:59.000Z

    . This is consistent with the observation that old males exhibit reduced control over their ability to mate. Caloric restriction is an efficient non-genetic intervention to increase lifespan. I demonstrated here that it also improves mating behavior in 3-day-old males...

  16. Gene expression divergence and nucleotide differentiation between males of different color morphs and mating

    E-Print Network [OSTI]

    Gene expression divergence and nucleotide differentiation between males of different color morphs sequencing, it is possible to obtain data on both nucleotide sequence variation and gene expression. We have between males, but many genetic markers showed nucleotide differentiation between different color morphs

  17. The Conditional Effects of Female Descriptive Representation: A Study of Policy Influence in State Legislatures, 1983-2002

    E-Print Network [OSTI]

    Barnes, Mary Elizabeth

    2012-02-14T23:59:59.000Z

    (Phillips 1995; Weldon 2002). This study will examine female descriptive representation and incorporation and its effect on substantive representation of female group salient issues and answer the following research question: Does an increase in female...), but there is also a significant amount or literature negating this claim. Women may behave in an isolated manner when legislating and they may not be able to articulate what females as a group really want (Weldon 2002). There may be no way to establish...

  18. Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals to work on rural projects that

    E-Print Network [OSTI]

    Richner, Heinz

    Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals. Policy message n Pakistan is a highly gender-segregated society, and more well-qualified female field for well-educat- ed Pakistani women Pakistan has one of the lowest female labour force

  19. Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan

    E-Print Network [OSTI]

    Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan Xavier Giné Akbar at the Pakistan Poverty Alleviation Program (PPAF) in Islamabad for their support

  20. The perceived influence of past mentoring experiences on the mentoring practices of selected female school executives

    E-Print Network [OSTI]

    Ashley, Betty Diane

    2009-05-15T23:59:59.000Z

    Although research on mentoring dates back to the early 1980’s, there is little research available which examines the influence of past mentoring experiences on relationships in which female school executives, in turn, serve as the mentors...

  1. POETISA CHIC: FASHIONING THE MODERN FEMALE POET IN CENTRAL AMERICA, 1929-1944

    E-Print Network [OSTI]

    Finzer, Erin S.

    2008-01-01T23:59:59.000Z

    This dissertation explores the cultural and literary "fashionings" of Central American female poets of the 1930s in order to demonstrate how some of these poets entered the lettered city (Ángel Rama's term for the nexus ...

  2. The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice

    E-Print Network [OSTI]

    Eisenberg, Rahel E. (Rahel Esther)

    2009-01-01T23:59:59.000Z

    This research sought to create an animal model of secondary hyperparathyroidism through continuous infusion of parathyroid hormone (PTH) in adult female mice, and to subsequently study the catabolic effects of PTH. Osmotic ...

  3. Osteopontin-mediated neutrophilic infiltration and higher liver injury in a female rodent alcoholic steatohepatitis model

    E-Print Network [OSTI]

    Banerjee, Atrayee

    2009-05-15T23:59:59.000Z

    Females are known to be more susceptible to alcoholic liver disease (ALD), but the precise mechanism behind this increased susceptibility is not well understood. The objective of this study was to identify the molecular mechanism behind...

  4. This Is “Ladies’ Night”: A Case Study of a Grassroots Golf Program for Black Females

    E-Print Network [OSTI]

    Rosselli, Anthony C

    2014-07-24T23:59:59.000Z

    beginner golfers. Individual interviews with the golf instructor and seven of her participants were conducted. These women were self-identifying Black and female who attended at least three of the original ladies’ clinics. Additional data were gathered...

  5. "Imbued with the science of Venus": Female Fallenness, Sexual Pedagogy, and Victorian Pornography

    E-Print Network [OSTI]

    Wicktor, Emily D.

    2010-12-16T23:59:59.000Z

    As a decidedly heterogeneous genre, Victorian pornography offers a wide range of sexual narratives, including those that directly challenge both real and fictional narrative constructions of female fallenness by foregrounding ...

  6. Identifying the Predictors of Female Project Managers' Salaries in the United States

    E-Print Network [OSTI]

    Kamranzadeh, Amineh

    2012-11-30T23:59:59.000Z

    This study seeks to explore the predictors of female project managers’ salary in the construction industry, and to analyze their impacts on determining the salary. Experience, age, marital status, motherhood, having children at home, and the number...

  7. A dyadic protocol for training complex skills: a replication using female participants 

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  8. A dyadic protocol for training complex skills: a replication using female participants

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  9. Menstrual Support for Females with Developmental Disabilities: Survey and Interview of Parents or Caretakers

    E-Print Network [OSTI]

    Park, Hye Ran

    2013-12-31T23:59:59.000Z

    ramifications of the eugenics movement, however, have proved much more durable. Simultaneously, the state’s interests in requiring sterilization started outweighing the rights of a person with retardation (Vitello, 1978). In addition, the various movements (de...; Williams & Nind, 1999); and for many years little research investigated the perspectives of females with developmental disabilities (Rodgers, Lipscombe, & Santer, 2006). Although several publications have addressed contraceptive management in females...

  10. Effect of age on vibration sensitivity and motor nerve conduction among females

    E-Print Network [OSTI]

    Crumpton, Lesia LaWon

    1990-01-01T23:59:59.000Z

    EFFECT OF AGE ON VIBRATION SENSITIVITY AND MOTOR NERVE CONDUCTION AMONG FEMALES A Thesis by LES IA LA WON CRUMPTON Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE December 1990 Major Subject: Industrial Engineering EFFECT OF AGE ON VIBRATION SENS~ AND MOTOR NERVE CONDUCTION AlvIONG FEMALES A Thesis by LESIA LAWON CRUMPTON Approved as to style and content by: erome J. nglet (Chair...

  11. For Immediate Release --Wednesday, July 17, 2013 Counselling in female-only groups shows promise as

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    of the participants in gambling addiction treatment programs. Many programs designed to help with gambling problems, the traditional male-oriented treatment model for addiction, as well as economic and child-care concerns surrounding treatment, among many other

  12. The Black Male Youth Academy: Understanding the impact of a critical literacy intervention program on underserved youth

    E-Print Network [OSTI]

    Scorza, D'Artagnan

    2013-01-01T23:59:59.000Z

    of your participation in the Black Male Youth Academy? 5.recommend the Black Male Youth Academy to your peers? PleaseJournal of the American Academy of Child & Adolescent

  13. A male of the bee genus Agapostemon in Dominican amber (Hymenoptera: Halictidae)

    E-Print Network [OSTI]

    Engel, Michael S.; Breitkreuz, Laura C.V.

    2013-09-04T23:59:59.000Z

    The first fossil species of the caenohalictine bee genus Agapostemon Guérin-Méneville (Halictinae: Caenohalictini:Agapostemonina) is described and figured from a single male preserved in EarlyMiocene (Burdigalian) amber ...

  14. Investigating the influence of media on male body image: in search of a potential moderator

    E-Print Network [OSTI]

    Mignogna, Joseph

    2013-02-22T23:59:59.000Z

    of all three of the body image assessment measures (Body Image Assessment, BIA; Body Morph Assessment, BMA; and Somatomorphic Matrix, SM) in measuring various aspects of male body image. The BIA and BMA were mainly sensitive to measuring "thinness...

  15. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds 

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  16. Fitting It All Together: How Courtship- and Mating-Responsive Genes Affect Drosophila melanogaster Male Behavior

    E-Print Network [OSTI]

    Ellis, Lisa Lynn

    2011-10-21T23:59:59.000Z

    interactions ..................................................................................... 1 Drosophila melanogaster as a tool for understanding behavior .... 3 Reproductive behaviors of Drosophila males ................................ 4... melanogaster courtship ritual .................................................. 6 3 The Drosophila somatic sex-determination hierarchy regulates somatic tissue development and courtship behavior ............................................... 7 4...

  17. The neuromolecular mechanisms that coordinate food availability with C. elegans male sexual behavior

    E-Print Network [OSTI]

    Gruninger, Todd Ryan

    2009-05-15T23:59:59.000Z

    -103, results in spontaneous seizures of the male sex muscles.Interestingly, I found that food deprivation can suppress unc-103(lf)-induced seizures,suggesting that pathways activated under this environmental condition can suppress theexcitability...

  18. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  19. The Leadership Perspectives of African American Males after Participation in a Leadership Development Program

    E-Print Network [OSTI]

    Preston, Tammie M

    2014-10-14T23:59:59.000Z

    This study investigated the perceptions of African American undergraduate males who attend a predominately White institution in the southwest as they concern leadership after participation in a leadership development program and the influence...

  20. Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US

    E-Print Network [OSTI]

    Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US in Eastern US showed that when the acetates were omitted from a 7-component blend in rubber septa, fewer

  1. The postnatal development of the sex organs in prenatally and early postnatally irradiated male albino rats

    E-Print Network [OSTI]

    Ricks, Robert Clinton

    1964-01-01T23:59:59.000Z

    THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Submitted to the Graduate College of the Texas ARM University in partial fulfillment of the requirements... for the degree of MASTER OF SCIENCE August, 1964 Major Subject: Zoology THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Approved as to style and content by...

  2. An Old Married Couple...and Other Short Stories

    E-Print Network [OSTI]

    Mailander, Jane

    2001-01-01T23:59:59.000Z

    to finish his dissertation; as the big gruff cop says, "It's about friendship," ... February 10 2000 There's a website that determines the type of dog your personality embodies. (I myself am a Basset.) I ran Jim and Blair through the test. and produced... more?" "That's right. Because he was murdered." Shaquana listened to the clock ticking -- focusing on that, rather than on his face. Anything but focus on his face. And he continued, with that same precise delivery. "My friend had some very...

  3. Marry for What? Caste and Mate Selection in Modern India

    E-Print Network [OSTI]

    Banerjee, Abhijit

    This paper analyzes how preferences for a noneconomic characteristic (e.g., caste) can affect equilibrium patterns of matching, and empirically evaluates this in the context of middle-class Indian arranged marriages. We ...

  4. Space use by female Greater Prairie-Chickens in response to wind energy development

    E-Print Network [OSTI]

    Sandercock, Brett K.

    Space use by female Greater Prairie-Chickens in response to wind energy development V. L. WINDER,1-Chickens in response to wind energy development. Ecosphere 5(1):3. http://dx.doi.org/10.1890/ ES13-00206.1 Abstract. Wind energy development is targeted to meet 20% of U.S. energy demand by 2030. In Kansas, optimal sites

  5. Daily movements of female white-tailed deer relative to parturition and breeding.

    SciTech Connect (OSTI)

    Gino J. D'Angelo; Christopher E. Comer; John C. Kilgo; Cory D. Drennan; David A. Osborn; Karl V. Miller

    2005-10-01T23:59:59.000Z

    Abstract: To assess how white-tailed deer (Odocoileus virginianus) herd demographics influence reproductive behaviors, we examined 24-h diel movements of female whitetailed deer relative to parturition and breeding in a low-density population with a near even sex ratio at the Savannah River Site (SRS), South Carolina. We conducted a series of intensive, 24-h radio-tracking periods of 13 females during spring and fall 2002. We compared daily range (ha), rate of travel (m/h), and distance between extreme daily locations (m), among the periods of pre-parturition and post-parturition and pre-, peak-, and post-rut. From pre-parturition to post-parturition, we observed decreases in diel range size (�¢����38.2%), distance between extreme diel locations (�¢����17.0%), and diel rate of travel (�¢����18.2%). Diel range size, distance between extreme diel locations, and diel rate of travel during the pre-rut and rut exceeded those observed during post-rut. We further identified substantial increases in mobility during 12 24-h diel periods for eight females during our fall monitoring. Our data suggest that female white-tailed deer reduce mobility post-fawning following exaggerated movements during pre-parturition. Furthermore, despite a near equal sex ratio, estrous does may be required to actively seek potential mates due to low population density.

  6. Patterns of coalition formation by adult female baboons in Amboseli, Kenya

    E-Print Network [OSTI]

    Alberts, Susan C

    Patterns of coalition formation by adult female baboons in Amboseli, Kenya JOAN B. SILK*, SUSAN CDepartment of Biology, Duke University zInstitute for Primate Research, National Museums of Kenya, Nairobi, Kenya x, in Amboseli, Kenya. There is a broad consensus that, when ecological conditions favour collective defence

  7. Original Article The effect of ecological harshness on perceptions of the ideal female body size

    E-Print Network [OSTI]

    Cooper, Brenton G.

    Original Article The effect of ecological harshness on perceptions of the ideal female body size Why do researchers regularly observe a relationship between ecological conditions and the heaviness life history strategies typically adopted by individuals living in harsh versus benign ecologies

  8. Effects of wind energy development on survival of female greater prairie-chickens

    E-Print Network [OSTI]

    Sandercock, Brett K.

    community, grouse, hazard function, mortality, preda- tion, wind turbine *Correspondence author. EEffects of wind energy development on survival of female greater prairie-chickens Virginia L of Florida, Gainesville, FL 32611, USA Summary 1. The potential effects of wind energy development

  9. Research Report Effects of ethanol consumption by adult female rats on subsequent

    E-Print Network [OSTI]

    Galef Jr., Bennett G.

    Research Report Effects of ethanol consumption by adult female rats on subsequent consumption January 2004 Abstract We used a two-bottle choice test to measure voluntary ethanol consumption by adolescent rats that had lived with ethanol-consuming or water-consuming adult conspecifics. We found

  10. Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley

    E-Print Network [OSTI]

    California at Berkeley, University of

    Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley Rats Asians. However, studies from our laboratory suggest that the anti-estrogenic effects of dietary kelp modulation related to kelp ingestion in a pilot study of premenopausal women, we investigated the endocrine

  11. What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs

    E-Print Network [OSTI]

    Virginia Tech

    What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs may become inflamed, irritated, swollen and possibly scarred. The most common causes of PID. PID is one of the leading causes of infertility in women. How does someone get PID? PID is caused

  12. Lee Smith's Fair and Tender Ladies: the female espistolary novel and the construction of knowledge

    E-Print Network [OSTI]

    Grubbs, Amy Marie

    1994-01-01T23:59:59.000Z

    This thesis focuses on how Lee Smith, a North Carolina writer, uses the traditional female epistolary form in a revolutionary way in her 1988 novel Fair and Tender Ladies. Smith's use of the form is revolutionary because, as many critics have...

  13. PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS

    E-Print Network [OSTI]

    PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS (ENHYDRA LUTRIS phenotypic plasticity. When populations are near carrying capacity (K) or when they are declining due) populations in Alaska provides an opportunity to examine phenotypic plasticity. Using premolar teeth

  14. MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE

    E-Print Network [OSTI]

    1099 MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE in intensively (>80%) cultivated areas. From January 2001 to August 2002, we monitored movements of 77 (61 adult of seasonal migration, whereas crop emergence and harvest had minimal effects. Four deer (8%) dispersed a mean

  15. Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice

    E-Print Network [OSTI]

    Frick, Karyn M.

    Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice Lauren to determine how different elements of enrichment, for example, cognitive stimu- lation and voluntary exercise), running wheels alone (exercise), or both toys and running wheels (complex enrichment) for 4 weeks prior

  16. Family Structure, Marital Fertility and Premarital Sex among Married and Never-Married Women in Contemporary China

    E-Print Network [OSTI]

    He, Lei 1984-

    2012-11-20T23:59:59.000Z

    -residential parents rather than other non-lineal relatives. Because patrilineality and filial piety are so highly valued, the essential features of the traditional Chinese family are two: dominant parental control over children, and patrilocal residence (Zang 1993...

  17. Costs of mating competition limit male lifetime breeding success in polygynous mammals

    E-Print Network [OSTI]

    Lukas, Dieter; Clutton-Brock, Tim

    2014-05-14T23:59:59.000Z

    . Nature 462(7274), 786-789. 42. Young, A. J. & Bennett, N. C. 2013 Intra-sexual selection in cooperative mammals and birds: why are females not bigger and better armed? Phil. Trans. R. Soc. B 368(1631), 20130075. Supplementary references S43. Glander, K. E...

  18. Comparative distribution of misonidazole and its amine metabolite in female Swiss Webster mice

    SciTech Connect (OSTI)

    Born, J.L.; Hadley, W.M.

    1985-06-01T23:59:59.000Z

    The distribution of misonidazole and its terminal reduction product 1-(2-amino-1-imidazolyl)-3-methoxy-2-propanol (misoamine) were compared in female Swiss Webster mice to determine if either misonidazole or misoamine is distributed to peripheral nerves. Female Swiss Webster mice received a 100 mg/kg (5 ..mu..Ci/..mu..mole) i.p. dose of either /sup 3/H-misonidazole or /sup 3/H-miso-amine and the distribution of radioactivity was determined in various tissues including sciatic nerves and other myelinated nerves. Misonidazole produced higher initial tissue concentrations of radioactivity than did miso-amine. The relative tissue concentrations of radioactivity produced by misonidazole or miso-amine were similar, although not identical, 48 hours after administration of the drugs. Both sciatic and other myelinated nerves were found to retain radioactivity following the administration of either misonidazole or miso-amine.

  19. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  20. Mutation analysis of BRCA1 and BRCA2 in a male breast cancer population

    SciTech Connect (OSTI)

    Friedman, L.S.; Gayther, S.A.; Ponder, B.A.J. [Univ. of Cambridge (United Kingdom)] [and others

    1997-02-01T23:59:59.000Z

    A population-based series of 54 male breast cancer cases from Southern California were analyzed for germ-line mutations in the inherited breast/ovarian cancer genes, BRCA1 and BRCA2. Nine (17%) of the patients had a family history of breast and/or ovarian cancer in at least one first-degree relative. A further seven (13%) of the patients reported breast/ovarian cancer in at least one second-degree relative and in no first-degree relatives. No germ-line BRCA1 mutations were found. Two male breast cancer patients (4% of the total) were found to carry novel truncating mutations in the BRCA2 gene. Only one of the two male breast cancer patients carrying a BRCA2 mutation had a family history of cancer, with one case of ovarian cancer in a first-degree relative. The remaining eight cases (89%) of male breast cancer with a family history of breast/ovarian cancer in first-degree relatives remain unaccounted for by mutations in either the BRCA1 gene or the BRCA2 gene. 23 refs., 1 fig., 5 tabs.

  1. FOREST ENTOMOLOGY A Male-Produced Aggregation Pheromone of Monochamus alternatus

    E-Print Network [OSTI]

    Hanks, Lawrence M.

    )- ethanol, the male-produced pheromone of the congeneric M. galloprovincialis Dejean, in Ã?eld ex- periments consisting of 2-(undecyloxy)-ethanol combined with the host plant volatiles -pinene and ethanol. A follow-up experiment showed that 2-(undecyloxy)-ethanol was synergized by both ethanol and -pinene. Coupled gas

  2. Site fidelity, home range behaviour and habitat utilization of male harlequin toads (Amphibia:Atelopus hoogmoedi)

    E-Print Network [OSTI]

    Hödl, Walter

    :Atelopus hoogmoedi) from Suriname:relevant aspects for conservation breeding SALAMANDRA 1 45 Abstract. Recently, neotropical harlequin toads (Atelopus spp.) have undergone drastic population de- clines. Captive breeding has rainy season (April to August) at Brownsberg Nature Park, Suriname. Dur- ing this period, males

  3. An exploration of the stages of change model in a group treatment program for male batterers

    E-Print Network [OSTI]

    Wells, Robert Davis

    2005-02-17T23:59:59.000Z

    in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2004 Major Subject: Counseling Psychology AN EXPLORATION OF THE STAGES OF CHANGE MODEL IN A GROUP TREATMENT PROGRAM...) __________________________ Michael R. Benz (Head of Department) December 2004 Major Subject: Counseling Psychology iii ABSTRACT An Exploration of the Stages of Change Model in a Group Treatment Program for Male Batterers. (December 2004...

  4. Clinical overlap between Posttraumatic Stress Disorder and Borderline Personality Disorder in male veterans

    E-Print Network [OSTI]

    Boggs, Christina Danielle

    2006-10-30T23:59:59.000Z

    previous literature by providing an investigation of clinical features across two groups: PTSD only and comorbid PTSD and BPD in a sample of male veterans (n=178). Results suggest that the two groups were distinct, with the comorbid group displaying higher...

  5. Ape Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive

    E-Print Network [OSTI]

    [1] have shown that chimpanzees trade mating opportunities for support in power contests. OddlyApe Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive rare among animals, exchange of one currency for another -- in this case sex for power -- may

  6. A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the

    E-Print Network [OSTI]

    Gruber, Jonathan

    A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the Drosophila- ship behavior, genes acting downstream of fru have not yet been identified. Here we demonstrate that the yellow (y) gene is genetically downstream of fru in the 3rd -instar larval brain. Yellow protein

  7. Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White-

    E-Print Network [OSTI]

    Nelson, Randy J.

    Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White to long day lengths (LD) and short day lengths (SD) for 10 to 15 weeks and then examined olfactory bulb cell proliferation and survival using the thymidine analog BrdU, olfactory bulb granule cell morphology

  8. Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae: Salticidae)

    E-Print Network [OSTI]

    Hoy, Ronald R.

    Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae of multicomponent seismic courtship signals in addition to and produced in concert with its multiple visual ornaments and movement displays. Here, we demonstrate the importance of these seismic signals

  9. Mechanisms of Individual Variation in Reproductive Behavior in Female Xiphophorous birchmanni

    E-Print Network [OSTI]

    Smith, Victoria Lee

    2014-06-06T23:59:59.000Z

    for the Cayman Cortisol EIA kit ......... 12 2.5 Individual female cortisol levels over repeated sampling ....................................... 12 3.1 Validation of the cayman cortisol EIA kit with Xiphophorus birchmanni pooled water samples... of steroids from the column. This technique should collect only free (and not glucuronidated or sulfated) steroids (Vermeirssen and Scott, 1996). Eluates were dried under nitrogen and re-suspended in   9 600 microliters EIA buffer. Additional details...

  10. The effectiveness of visual evaluation scores as predictors of growth and fertility in Brangus females

    E-Print Network [OSTI]

    Harkey, Gary Don

    1990-01-01T23:59:59.000Z

    ). However, other studies indicated that higher postweaning growth delayed puberty in beef heifers (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Seemingly, the interrelationships which exist between growth and reproductive performance may vary... growth and age at puberty (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Managerial practices designed to maximize postweaning gain of replacement females are not only economically unfeasible in most instances, but have also been shown to reduce...

  11. (Per)Forming Female Politics: The Making of the `Modern Woman'

    E-Print Network [OSTI]

    Anderson, Christine Aliisa

    2008-01-01T23:59:59.000Z

    (Per)Forming Female Politics: The Making of the ?Modern Woman? in London, 1890-1914 By Copyright 2008 Christine A. Anderson Submited to the graduate degre program in History and the Graduate Faculty of the University of Kansas..., history, and the performing arts, and nurtured my pasion for and talents in these subjects. It is to both of them, therefore, that I dedicate this disertation. v v List of Abreviations AFL Actreses? Franchise League ILP Independent...

  12. The Social Mobility-Fertility Hypothesis: a racial and class comparison among southern females.

    E-Print Network [OSTI]

    White, Carolyn Delores

    1974-01-01T23:59:59.000Z

    and Level of Occupational Aspiration for Mate (LOAM) Summary of Phase I Test of the SMF Hypothesis. Social Mobility Tables Comparing Mean Fertility by the Educational Level of Mother (ELM) and the Level of Educational Aspiration (LEA) . Social Mobility... . Number and Percentage of Adjusted (}uota of Females Recontacted at Wave III by State and Race. Outline of Analytical Phases Bivariate Relationship Between Parity and Level of Educational Aspirations (LEA) Bivariate Relationship Between Parity...

  13. Difference as a means of defiance: a study of female subjectivity in six Jacobean plays

    E-Print Network [OSTI]

    Rodriguez, Mary Grace

    1995-01-01T23:59:59.000Z

    of the requirements for the degree of MASTER OF ARTS Approved as to style and content by: Katherine E. Kelly (Chair of Committee ffrey Cox (Member) Moocha 1 R. Han (Member) J. Lawrence Mitchell (Head of Department) August 1995 Major Subject: English... ABSTRACT Difference as a Means of Defiance: A Study of Female Subjectivity in Six Jacobean Plays. (August 1995) Mary Grace Rodriguez, B. A. , Texas A&M University Chair of Advisory Committee: Dr. Katherine E. Kelly The Hegelian dialectic clearly...

  14. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does exist between certain...

  15. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools 

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, ...

  16. Head black woman in charge: An investigation of how black female athletic directors negotiate their race, gender, and class identities

    E-Print Network [OSTI]

    McDowell, Jacqueline

    2009-05-15T23:59:59.000Z

    Framed as an instrumental case study, the purpose of this investigation was to understand how a select group of women, Black female athletic directors, define and negotiate their race, gender, and class identities. Data was collected via a...

  17. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States 

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does ...

  18. The Role Mentoring Plays in a White Female Novice Teacher's Perceptions of Her Enculturation into a Culturally Diverse Campus

    E-Print Network [OSTI]

    Noble, Erica Michelle

    2012-07-16T23:59:59.000Z

    played in a White female novice teacher's perceptions of her enculturation into a culturally diverse campus. Several methods of data collection were used, including 9 semi-structured interviews with the novice teacher, email dialogues, 3 days...

  19. A Cholinergic Sensory-Motor Circuit Controls the Male Copulation Behavior in C. elegans

    E-Print Network [OSTI]

    Liu, Yishi

    2012-07-16T23:59:59.000Z

    for the degree of DOCTOR OF PHILOSOPHY Approved by: Chair of Committee, L. Rene Garcia Committee Members, James Grau Brian Perkins Michael Smotherman Head of Department, Jack McMahan May 2011 Major Subject: Biology iii ABSTRACT A... Cholinergic Sensory-motor Circuit Controls the Male Copulation Behavior In C. elegans. (May 2011) Yishi Liu, B.S., Huazhong Agricultural University Chair of Advisory Committee: Dr. L. Rene Garcia The nervous system coordinates a sequence of muscle...

  20. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE TEACHERS IN DIVERSE SCHOOLS A Dissertation by KATHY ANN ATTAWAY Submitted to the Office of Graduate Studies of Texas A&M University... in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2007 Major Subject: Educational Administration INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE...

  1. Acculturation and Transformation among Female Immigrant Military Spouses in an ESL Learning Program at a Community College

    E-Print Network [OSTI]

    Darnell, Patricia

    2012-07-16T23:59:59.000Z

    ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A&M University in partial... Copyright 2012 Patricia Darnell ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A...

  2. 04/16/2007 11:56 AMMore Females Because Sisters Kill Their Brothers -Not such an altruistic behavior in parasitoid wasps -Softpedia Page 1 of 2http://news.softpedia.com/news/More-Females-Because-They-Kill-Male-Offspring-51802.shtml

    E-Print Network [OSTI]

    Gardner, Andy

    Insect Brain Changed as They Evolved to More Social Parasitoid Wasps Could Be Future's Weapon AgainstDefender Antivirus Guaranteed detection and removal of all viruses. PC World Best Buy! visit site > SIPfoundry A Free

  3. Protection of the female reproductive system from natural and artificial insults

    DOE Patents [OSTI]

    Tilly, Jonathan L. (Windham, NH); Kolesnick, Richard N. (New York, NY)

    2010-12-14T23:59:59.000Z

    Described are methods for protecting the female reproductive system against natural and artificial insults by administering to women a composition comprising an agent that antagonizes one or more acid sphingomyelinase (ASMase) gene products. Specifically, methods disclosed herein serve to protect women's germline from damage resulting from cancer therapy regimens including chemotherapy or radiotherapy. In one aspect, the method preserves, enhances, or revives ovarian function in women, by administering to women a composition containing sphingosine-1-phosphate, or an analog thereof. Also disclosed are methods to prevent or ameliorate menopausal syndromes and to improve in vitro fertilization techniques.

  4. A review of "Rembrandt and the Female Nude" by Eric Jan Sluijter

    E-Print Network [OSTI]

    Silver, Larry

    2007-01-01T23:59:59.000Z

    arguments. The center of the book, nearly 200 pages long, is aptly titled ?Doctrine.? Eric Jan Sluijter. Rembrandt and the Female Nude. Amsterdam University Press, 2006. 448pp. + 100 color, 250 b/w illus. $74.50/59.50 Euros. Review by LARRY SILVER... materials. Eric Jan Sluijter, professor of Dutch and Renaissance art history at the University of Leiden, wrote his earlier studies exploring the Dutch visual- ization of Greco-Roman myths as well as interpretive issues concerning the 186 SEVENTEENTH...

  5. Semen parameters of Callithrix jacchus: ejaculates from selected males of proven fertility

    E-Print Network [OSTI]

    Busch, Leo Joseph

    1981-01-01T23:59:59.000Z

    . Presently, however, both of these species are only available in extremely limited numbers from a small number of domestic breeding facilities. Although researchers here in the United States have only just begun utilizing the small Brazilian common... laboratory primate. Its small size, approximately 25 cm in height and 300 g in weight at maturity, makes it relatively easy to handle and inexpens1ve to house and feed. It becomes sexually mature at 14 to 18 months, with the female hav1ng an ovar1an cycle...

  6. The Effect of Cues of Parental Investment on Attractiveness Ratings of Males: The Impact of Child Presence and Age 

    E-Print Network [OSTI]

    Went, Hannah

    2007-01-01T23:59:59.000Z

    According to evolutionary theories of mate choice, male parental investment is a desired characteristic of long term mates. Brase (2006) found that cues of a positive disposition towards parental investment increased ...

  7. The Effect of Music Therapy on Executive Function Skills in Male, Incarcerated Adults in a Correctional Facility

    E-Print Network [OSTI]

    Ellis, Elisha

    2014-05-31T23:59:59.000Z

    The purpose of the present study was to examine the effect of participation in a music therapy group on the executive function skills of male, incarcerated adults in a county correctional facility. Participants (N=16) were ...

  8. The Relationship Between Teachers' Preparation and Perceived Level of Technology Use in Mathematics With Middle School African American Males

    E-Print Network [OSTI]

    Mason, Sherrie Dee

    2012-10-19T23:59:59.000Z

    that the level of teachers' preparedness had an influence on the use and implementation of technology use in the classroom. Teachers' preparedness in the use of instructional technology was related to their African American male students' mathematical achievement...

  9. Factors affecting alcohol treatment in males: an estimation of gender-role issues, self-concept, and psychiatric symptomatology

    E-Print Network [OSTI]

    Clark, Betty Lynn

    1993-01-01T23:59:59.000Z

    FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER ROLE ISSUES ~ SELF CONCEPT AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY LYNN CLARK Submitted to the Office of Graduate Studies of Texas A&M University in partial... fulfillment of the requirements for the degree MASTER OF SCIENCE August 1993 Major Subject: Psychology FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER-ROLE ISSUES, SELF-CONCEPT, AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY...

  10. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp 

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MANE MIGURA Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE August 1996 Major Subject: Horticulture EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MARIE MIGURA Submitted to Texas A...

  11. A review of "Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal" by Bryan Givens

    E-Print Network [OSTI]

    Hegstrom, Valerie

    2012-01-01T23:59:59.000Z

    reviews 65 Bryan Givens. Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal. Baton Rouge: Louisiana State University Press, 2011. viii + 255 pp. $48.00. Review by #17;#25; #30;#31;#18;#30; #23...;#30;#8;#26;#19;#31;#20;#21;, #28;#31;#18;#8;#23;#25;#21; #16;#20;#29;#27;#8; #29;#27;#18;#17;#30;#31;#26;#18;#19;#16;. In his preface to Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal, Bryan Givens tells us he did not set out to write a...

  12. The declining use of the Mixtec language : the persistence of memory, discrimination, and social hierarchies of power

    E-Print Network [OSTI]

    Perry, Elizabeth

    2009-01-01T23:59:59.000Z

    Mixteco Spanish Female SMT Spanish None Male SMT SpanishNone Male SMT SpanishNone Male SMT Mixteco Spanish Male SMT Mixteco Spanish

  13. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2009-05-15T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, little research has been done...

  14. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    Population. Subjects, . . . Instrumentation. . Data Collection. . . Data Analysis. IV FINDINGS AND DISCUSSION. . . . . . . . . 22 . . . . . . . 22 . . . . . . . 23 . . . . . . 26 27 . . . . . . . 29 Pilot Study Results... (Beck and Gilliard, 1995a). The National Center for Research in Vocational Education suggested female inmates need substantial support in acquiring skills to secure and maintain employment upon release from prison (Norton, Ciccone and Littlefield, 1987...

  15. Effects of obesity and metabolic syndrome on steroidogenesis and folliculogenesis in the female Ossabaw mini-pig

    E-Print Network [OSTI]

    Newell-Fugate, Annie; Taibl, Jessica; Alloosh, Mouhamad; Sturek, Michael; Bahr, Janice; Nowak, Romana; Krisher, Rebecca

    mini-pigs. Nineteen nulliparous, sexually mature female Ossabaw pigs were fed a high fat/cholesterol/fructose diet (n=10) or a control diet (n=9) for eight months. After a three-month diet-induction period, pigs remained on their respective diets...

  16. Treatment with 8-OH-DPAT attenuates the weight loss associated with activity-based anorexia in female rats

    E-Print Network [OSTI]

    Hull, Elaine

    ) plays an important role in controlling food intake and regulating body weight. In addition, clinical). This animal model allows researchers to directly manipulate neuronal and endocrine systems that may the effects of pharmacological manipulation of the 5-HT system in female rats exposed to conditions

  17. The effect of alcohol on the bone growth spurt of rats at a time equivalent to adolescent females 

    E-Print Network [OSTI]

    Chaffin, Catherine Lee

    1997-01-01T23:59:59.000Z

    The objective of this study is to determine the effect of long-term alcohol consumption on the growth spurt in adolescent rats. Female Sprague-Dawley rats were fed one of three diets (alcohol, pair-fed or chow) for 3 months. ...

  18. Significant Expression Levels of Transgenic PPP1CC2 in Testis and Sperm Are Required to Overcome the Male

    E-Print Network [OSTI]

    Significant Expression Levels of Transgenic PPP1CC2 in Testis and Sperm Are Required to Overcome the Male Infertility Phenotype of Ppp1cc Null Mice Nilam Sinha1 *¤ , Stephen Pilder2 , Srinivasan, Pennsylvania, United States of America Abstract PPP1CC2, one of four isoforms of the ser/thr protein

  19. 2-(Undecyloxy)-ethanol is a major component of the male-produced aggregation pheromone of Monochamus

    E-Print Network [OSTI]

    Hanks, Lawrence M.

    -INIA, Palencia 34071, Spain, 2 Natural Resources Institute, University of Greenwich, Chatham Maritime, Kent ME4 4 of Ecology, Swedish University of Agricultural Sciences, PO Box 7044, Uppsala S-750 07, Sweden, 5 College using gas chromatography (GC) coupled to mass spectrometry, a single male-specific compound was detected

  20. Toxic hydrogen sulphide and dark caves: pronounced male life-history divergence among locally adapted Poecilia mexicana

    E-Print Network [OSTI]

    Schlupp, Ingo

    Toxic hydrogen sulphide and dark caves: pronounced male life-history divergence among locally are characterized by exceptionally high concentrations of hydrogen sulphide (H2S): deep-sea hydrothermal vents, hydrocarbon seeps, as well as intertidal zones, salt marshes, mudflats and sewage outfalls, where hydrogen

  1. The Role of Interventional Radiology in the Diagnosis and Management of Male Impotence

    SciTech Connect (OSTI)

    Spiliopoulos, Stavros [Patras University Hospital, Department of Radiology (Greece)] [Patras University Hospital, Department of Radiology (Greece); Shaida, Nadeem [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)] [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom); Katsanos, Konstantinos [Guy's and St Thomas' NHS Trust, Department of Radiology (United Kingdom)] [Guy's and St Thomas' NHS Trust, Department of Radiology (United Kingdom); Krokidis, Miltiadis, E-mail: mkrokidis@hotmail.com [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)] [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)

    2013-10-15T23:59:59.000Z

    Erectile dysfunction (ED) is defined as the persistent inability to reach or maintain penile rigidity enough for sexual satisfaction. Nearly 30% of the men between ages 40 and 70 years are affected by ED. A variety of pathologies, including neurological, psychological, or endocrine disorders and drug side effects, may incite ED. A commonly identified cause of ED is vascular disease. Initial diagnostic workup includes a detailed physical examination and laboratory tests. Whilst duplex ultrasound is considered the first-line diagnostic modality, intra-arterial digital subtraction angiography is still considered the 'gold standard' for the diagnosis of arteriogenic impotence. Percutaneous endovascular treatment may be offered in patients with vasculogenic ED that has failed to respond to oral medical therapy as an alternative to penile prosthesis or open surgical repair. In arteriogenic ED balloon angioplasty of the aorto-iliac axis, and in veno-occlusive ED, percutaneous venous ablation using various embolization materials has been reported to be safe and to improve sexual performance. Recently, the ZEN study investigated the safety and feasibility of drug-eluting stents for the treatment of arteriogenic ED attributed to internal pudendal artery stenosis with promising preliminary results. This manuscript highlights the role of interventional radiology in the diagnosis and minimally invasive treatment of male impotence.

  2. 372 PRACTICE EXAM 2

    E-Print Network [OSTI]

    372 PRACTICE EXAM 2. 13. In a survey of males over the age of 30, it is found 50% are married, 40% smoke, 30% own a home and 60% own a car. It is also ...

  3. Prenatal ethanol exposure programs an increased susceptibility of non-alcoholic fatty liver disease in female adult offspring rats

    SciTech Connect (OSTI)

    Shen, Lang; Liu, Zhongfen; Gong, Jun; Zhang, Li [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Wang, Linlong [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Magdalou, Jacques [UMR 7561 CNRS-Nancy Université, Faculté de Médicine, Vandoeuvre-lès-Nancy (France); Chen, Liaobin [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Wang, Hui, E-mail: wanghui19@whu.edu.cn [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Research Center of Food and Drug Evaluation, Wuhan University, Wuhan 430071 (China)

    2014-01-15T23:59:59.000Z

    Prenatal ethanol exposure (PEE) induces dyslipidemia and hyperglycemia in fetus and adult offspring. However, whether PEE increases the susceptibility to non-alcoholic fatty liver disease (NAFLD) in offspring and its underlying mechanism remain unknown. This study aimed to demonstrate an increased susceptibility to high-fat diet (HFD)-induced NAFLD and its intrauterine programming mechanisms in female rat offspring with PEE. Rat model of intrauterine growth retardation (IUGR) was established by PEE, the female fetus and adult offspring that fed normal diet (ND) or HFD were sacrificed. The results showed that, in PEE + ND group, serum corticosterone (CORT) slightly decreased and insulin-like growth factor-1 (IGF-1) and glucose increased with partial catch-up growth; In PEE + HFD group, serum CORT decreased, while serum IGF-1, glucose and triglyceride (TG) increased, with notable catch-up growth, higher metabolic status and NAFLD formation. Enhanced liver expression of the IGF-1 pathway, gluconeogenesis, and lipid synthesis as well as reduced expression of lipid output were accompanied in PEE + HFD group. In PEE fetus, serum CORT increased while IGF-1 decreased, with low body weight, hyperglycemia, and hepatocyte ultrastructural changes. Hepatic IGF-1 expression as well as lipid output was down-regulated, while lipid synthesis significantly increased. Based on these findings, we propose a “two-programming” hypothesis for an increased susceptibility to HFD-induced NAFLD in female offspring of PEE. That is, the intrauterine programming of liver glucose and lipid metabolic function is “the first programming”, and postnatal adaptive catch-up growth triggered by intrauterine programming of GC-IGF1 axis acts as “the second programming”. - Highlights: • Prenatal ethanol exposure increase the susceptibility of NAFLD in female offspring. • Prenatal ethanol exposure reprograms fetal liver’s glucose and lipid metabolism . • Prenatal ethanol exposure cause the adaptive change of glucocorticoid-IGF1 axis.

  4. Housing sexuality: domestic space and the development of female sexuality in the fiction of Angela Carter and Jeanette Winterson 

    E-Print Network [OSTI]

    Cantrell, Samantha E.

    2005-08-29T23:59:59.000Z

    Whirter (Member) ___________________________ Melanie Hawthorne (Member) ___________________________ Paul A. Parrish (Head of Department) May 2004 Major Subject: English iii ABSTRACT Housing Sexuality Domestic Space and the Development of Female Sexuality... committee: Marian Eide, Melanie Hawthorne, Pam Matthews, and David McWhirter. Their confidence in me and patience with me helped me to face the daunting task of writing. Paulette Bomnskie in the English Graduate Studies Office offered vital support as I...

  5. Short term effects of commercial polychlorinated biphenyl (PCB) mixtures and individual PCB congeners in female Sprague-Dawley rats

    E-Print Network [OSTI]

    Chen, Yu-Chyu

    1992-01-01T23:59:59.000Z

    fulfillment of the requirements for the degree of MASTER OF SCIENCE December 1992 Major subject: Toxicology SHORT TERM EFFECTS OF COMMERCIAL POLYCHLORINATED BIPHENYL (PCB) MIXTURES AND INDIVIDUAL PCB CONGENERS IN FEMALE SPRAGUE-DAWLEY RATS A Thesis... of isomers 3 12 24 42 46 42 24 12 3 1 209 This thesis followed the format and style of Toxicology and Applied Pharmacology. isomers and congeners in which there are differences with respect to the number of halogen atoms and their substitution...

  6. Cellulose and psyllium supplementation in 10 females: the effect on food intake and in vitro fermentation variables

    E-Print Network [OSTI]

    Haynes, Susan Renee

    1988-01-01T23:59:59.000Z

    CELLULOSE AND PSYLLIUM SUPPLEMENTATION IN 10 FEMALES: THE EFFECT ON FOOD INTAKE AND IN VITRO FERMENTATION VARIABLES A Thesis by SUSAN RENEE HAYNES Submitted to the Graduate College of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER QF SCIENCE August 1988 Major Subject: Nutrition CELLULOSE AND PSYLLIUM SUPPLEMENTATION IN 10 FEMAI ES: THE EFFECT ON FOOD INTAKE AND IN VITRO FERMENTATION VARIABLES A Thesis by SUSAN RENEE HAYNES Approved...

  7. The effects of three different frequencies of low intensity walking on exercise adherence in a sedentary female workforce

    E-Print Network [OSTI]

    Schiller, Deborah Anne

    1991-01-01T23:59:59.000Z

    of three different frequencies of low intensity walking on exercise adherence and selected physiological and psychological indices of health and fitness. Thirty-four sedentary female volunteers from the Westinghouse Electronic Assembly Plant were... appreciated. Sincere appreciation is extended to the Westinghouse Electronic Assembly Plant for providing an environment that was conducive to learning and supportive of research. Special thanks to the women who volunteered their time and effort to serve...

  8. Effects of Nicotine Exposure on In Vitro Metabolism of Chlorpyrifos in Male Sprague-Dawley Rats

    SciTech Connect (OSTI)

    Lee, Sookwang; Busby, Andrea L.; Timchalk, Charles; Poet, Torka S.

    2009-01-30T23:59:59.000Z

    Chlorpyrifos (CPF) is a common organophosphate (OP) insecticide which is metabolized by CYP450s to the neurotoxic metabolite, chlorpyrifos-oxon (CPF-oxon) and a non-toxic metabolite, 3,5,6-trichloro-2-pyridinol (TCP). The objective of this study was to quantify the effect of repeated in vivo nicotine exposures on CPF in vitro metabolism and marker substrate activities in rats. Male Sprague-Dawley rats were dosed subcutaneously with 1 mg nicotine/kg/, for up to 10 days. Animals showed signs of cholinergic crisis after the initial nicotine doses, but exhibited adaptation after a couple days of treatment. Rats were sacrificed on selected days 4 or 24 hr after the last nicotine-treatment. While CYP450 reduced CO spectra were not different across the treatments, the single nicotine dose group showed a 2-fold increase in CYP2E1 marker substrate (p-nitrophenol) activity 24 hr after a single nicotine treatment compared to saline controls. Conversely, repeated nicotine treatments resulted in decreased EROD marker substrate activity 4 hr after the 7th day of treatment. CPF-oxon Vmax and Km did not show significant changes across the different nicotine treatment groups. The Vmax describing the metabolism of CPF to TCP was increased on all groups (days 1, 7, and 10) 24 hr after nicotine treatment but were unchanged 4 hr after nicotine treatment. Results of this in vitro study suggest that repeated nicotine exposure (i.e., from smoking) may result in altered metabolism of CPF. Future in vivo experiments based on these results will be conducted to ascertain the impact of in vivo nicotine exposures on CPF metabolism in rats.

  9. Endocrine disruption mechanism of o,p'-DDT in mature male tilapia (Oreochromis niloticus)

    SciTech Connect (OSTI)

    Leanos-Castaneda, Olga [Department of Integrative Biology, University of Guelph, Ontario, N1G 2W1 (Canada)]. E-mail: olgalidia09@yahoo.com; Kraak, Glen van der [Department of Integrative Biology, University of Guelph, Ontario, N1G 2W1 (Canada); Rodriguez-Canul, Rossanna [Departamento de Recursos del Mar, CINVESTAV Unidad Merida, Carretera Antigua a Progreso km. 6, Ap. Postal 73 'Cordemex', Merida, Yucatan 97310 (Mexico); Gold, G. [Departamento de Recursos del Mar, CINVESTAV Unidad Merida, Carretera Antigua a Progreso km. 6, Ap. Postal 73 'Cordemex', Merida, Yucatan 97310 (Mexico)

    2007-06-01T23:59:59.000Z

    The aim of the present study was to evaluate, in vivo, the potential of o,p'-DDT to disrupt the endocrine system of mature male tilapia. In particular, the possibility that o,p'-DDT effects were mediated directly via the estrogen receptor (ER). Compounds with known ability to bind to the ER were employed: estradiol to induce and tamoxifen to inhibit the estrogenic effects result of the activation of the ER. In addition, an aromatase inhibitor, 4-hydrxyandrostenedione (4-OHA), was used to assess the ability of o,p'-DDT to induce estrogenic effects in a surrounding of low estradiol concentration. The effects of estradiol and o,p'-DDT were studied alone or in the presence of tamoxifen or 4-OHA at the end of a 12-day period of exposure. The main endpoints measured were plasma alkaline-labile phosphorous (ALP; an indirect indicator of vitellogenin), estradiol, testosterone and o,p'-DDT. It was found that o,p'-DDT was able to induce the vitellogenesis (measured as plasma ALP increase) and decrease the circulating levels of estradiol and testosterone. Interestingly, o,p'-DDT kept this ability in whole fish with low concentrations of estradiol which would exclude endogenous estradiol as indirect mediator of the estrogenic effects induced by o,p'-DDT. In addition, the plasma concentration of o,p'-DDT, instead of that of estradiol, was closely related to the plasma ALP increase induced by o,p'-DDT. This indicates that o,p'-DDT could have directly activated the vitellogenesis. The antiestrogenic action of tamoxifen to inhibit the vitellogenesis and the decrease on plasma estradiol induced by o,p'-DDT indicates that o,p'-DDT can bind directly to the ER. In conclusion, this in vivo study shows that o,p'-DDT has the potential to disrupt the endocrine system and strongly supports that the estrogenic actions of o,p'-DDT involve binding to the ER.

  10. An Investigation of the Perceptions of Latino High School Males Who Were in Danger of Dropping Out but Persevered

    E-Print Network [OSTI]

    Nell, Jan Elizabeth

    2012-02-14T23:59:59.000Z

    Chambers Fred Bonner Anita McCormick Head of Department, Fredrick Nafukho December 2010 Major Subject: Educational Administration iii ABSTRACT An Investigation of the Perceptions of Latino High School Males Who Were in Danger of Dropping.... Fred Bonner, Dr. Tara Venzant Chambers, and Dr. Anita McCormick, was insightful and invaluable. I never felt discouraged or criticized when they offered constructive comments to improve the study. For that, I am truly grateful. Dr. Jim Scheurich, my...

  11. Predicting and understanding male weight training athletes' intentions to use anabolic-androgenic steroids: implications for prevention

    E-Print Network [OSTI]

    Riem, Kurt Erich

    1992-01-01T23:59:59.000Z

    , & Payne, 1984; Taylor & Black, 1987). Among males using AASs in an attempt to increase body size and perhaps self-esteem are a growing number of adolescents (Buckley et al. , 1988; Johnson, Jay, Shoup, & Rickert, 1989). Specifically, Buckley et al... intentions to be good indicators of their actual behavior for both alcohol use (Schlegel, Crawford, & Sanborn, 1977) and marijuana use (Schlegel & DiTecco, 1978). More importantly, adolescents' expressed intentions to smoke cigarettes have been reported...

  12. Sheet1

    E-Print Network [OSTI]

    Cai, Qianqi

    48, Pitman, Lisa A. 79, Female. 49, Prachyl, Conner A. 42, Female. 50, Rotter, Thomas E. 71, Female. 51, Toweson, John B. 71, Male. 52, Zheng, Wenchu, 64 ...

  13. 17(lowercase beta)-estradiol and Tamoxifen prevent gastric cancer by modulating leukocyte recruitment and oncogenic pathways in Helicobacter pylori-infected INS-GAS male mice

    E-Print Network [OSTI]

    Sheh, Alexander

    Helicobacter pylori infection promotes male predominant gastric adenocarcinoma in humans. Estrogens reduce gastric cancer risk and previous studies showed that prophylactic 17?-estradiol (E2) in INS-GAS mice decreases H. ...

  14. Effects of feeding stimulant and insecticide mixtures on feeding response and morality of adult male corn earworm, Helicoverpa zea (Boddie)(Lepidoptera:Noctuidae)

    E-Print Network [OSTI]

    Clemens, Christopher Glen

    1996-01-01T23:59:59.000Z

    stimulants on feeding behavior and mortality of pheromone trap captured adult male corn earworms, Helicoverpa zea (Boddie), to screen and evaluate toxicants for use in an attracticide formulation. Commercially-available formulations of acephate, boric acid...

  15. Effects of feeding stimulant and insecticide mixtures on feeding response and morality of adult male corn earworm, Helicoverpa zea (Boddie)(Lepidoptera:Noctuidae) 

    E-Print Network [OSTI]

    Clemens, Christopher Glen

    1996-01-01T23:59:59.000Z

    stimulants on feeding behavior and mortality of pheromone trap captured adult male corn earworms, Helicoverpa zea (Boddie), to screen and evaluate toxicants for use in an attracticide formulation. Commercially-available formulations of acephate, boric acid...

  16. Spring Chinook Salmon Interactions Indices and Residual/Precocious Male Monitoring in the Upper Yakima Basin; Yakima/Klickitat Fisheries Project Monitoring and Evaluation, 2004-2005 Annual Report.

    SciTech Connect (OSTI)

    Pearsons, Todd N.; Johnson, Christopher L. (Washington Department of Fish and Wildlife, Olympia, WA); James, Brenda B. (Cascade Aquatics, Ellensburg, WA)

    2005-05-01T23:59:59.000Z

    This report examines some of the factors that can influence the success of supplementation, which is currently being tested in the Yakima Basin using upper Yakima stock of spring chinook salmon. Supplementation success in the Yakima Basin is defined relative to four topic areas: natural production, genetics, ecological interactions, and harvest (Busack et al. 1997). The success of spring chinook salmon supplementation in the Yakima Basin is dependent, in part, upon fish culture practices and favorable physical and biological conditions in the natural environment (Busack et al. 1997; James et al. 1999; Pearsons et al., 2003; Pearsons et al. 2004). Shortfalls in either of these two topics (i.e., failure in culturing many fish that have high long-term fitness or environmental conditions that constrain spring chinook salmon production) will cause supplementation success to be limited. For example, inadvertent selection or propagation of spring chinook that residualize or precocially mature may hinder supplementation success. Spring chinook salmon that residualize (do not migrate during the normal migration period) may have lower survival rates than migrants and, additionally, may interact with wild fish and cause unacceptable impacts to non-target taxa. Large numbers of precocials (nonanadromous spawners) may increase competition for females and significantly skew ratios of offspring sired by nonanadromous males, which could result in more nonanadromous spring chinook in future generations. Conditions in the natural environment may also limit the success of spring chinook supplementation. For example, intra or interspecific competition may constrain spring chinook salmon production. Spring chinook salmon juveniles may compete with each other for food or space or compete with other species that have similar ecological requirements. Monitoring of spring chinook salmon residuals, precocials, prey abundance, carrying capacity, and competition will help researchers interpret why supplementation is working or not working (Busack et al. 1997). Monitoring ecological interactions will be accomplished using interactions indices. Interactions indices will be used to index the availability of prey and competition for food and space. The tasks described below represent various subject areas of juvenile spring chinook salmon monitoring but are treated together because they can be accomplished using similar methods and are therefore more cost efficient than if treated separately. Topics of investigation we pursued in this work were: (1) strong interactor monitoring (competition index and prey index), (2) carrying capacity monitoring (microhabitat monitoring); (3) residual and precocious male salmon monitoring (abundance); (4) performance of growth modulation in reducing precocious males during spawning; (5) incidence of predation by residualized chinook salmon; and (6) benefits of salmon carcasses to juvenile salmonids. This report is organized into six chapters to represent these topics of investigation. Data were collected during the summer and fall, 2004 in index sections of the upper Yakima Basin (Figure 1). Previous results on the topics in this report were reported in James et al. (1999), and Pearsons et al. (2003; 2004). Hatchery-reared spring chinook salmon were first released during the spring of 1999. The monitoring plan for the Yakima/Klickitat Fisheries Project calls for the continued monitoring of the variables covered in this report. All findings in this report should be considered preliminary and subject to further revision as more data and analytical results become available.

  17. Abstract The fiddler crab Uca tangeri communicates using a visual waving display and a vibratory drumming

    E-Print Network [OSTI]

    of an empty mudflat, a waving male, a threatening male, and a wandering fe- male were presented to male-intensity waves were elicited by the female and threatening male stimuli than the mudflat stimulus or the waving

  18. The use of labeled leucine in establishing the time of allanto-chorionic fusion in the female albino rat with reference to implantation

    E-Print Network [OSTI]

    Rutledge, James Edward

    1966-01-01T23:59:59.000Z

    THE USE OF LABELED LEUCINE IN ESTABLISHING THE TIME OF ALLANTO-CHORIONIC FUSION IN THE FEMALE ALBINO RA T WIT H RE FERE NC E T 0 IM PLANTA T I ON A Thesis By JAMES EDWARD RUTLEDGE Submitted to the Graduate College of the Texas ASSAM... University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE January 1966 Major Subject: Physiology of Reproduction THE USE OF LABELED LEUCINE IN ESTABLISHING THE TIME OF ALLANTO- CHORIONIC FUSION IN THE FEMALE ALBINO RAT...

  19. Tracheal resonance database.

    E-Print Network [OSTI]

    Speech Communication Group (Massachusetts Institute of Technology); Sonderegger, Morgan A.; Chi, Xuemin, 1979-

    2006-02-08T23:59:59.000Z

    Syllables recorded from seven male and seven female speakers. Includes simultaneously recorded microphone and accelerometer signals.

  20. Analyses of the number of times married: U.S. women 1995-1996

    E-Print Network [OSTI]

    Melick, Emily A

    2003-01-01T23:59:59.000Z

    and their influence from and impact on history. The two sources that will be used are Cycle V of the National Survey of Family Growth (1995) and the Survey of Income and Program Participation (1996). The methods used are descriptive statistics, two logistic...

  1. 1. When Gay People Get Married: What Happens When Societies Legalize Same-Sex Marriage

    E-Print Network [OSTI]

    Nagurney, Anna

    , Labor Studies 9. Wind Energy Explained: Theory, Design and Application, 2nd edition (Wiley). James Manwell and John McGowan, Mechanical and Industrial Engineering, with A.L. Rogers. 10. Native Americans W. Martin, Humanities and Fine Arts, Editor. 11. Transforming Learning with New Technologies (Allyn

  2. Marrying microfluidics and microwells for parallel, high-throughput single-cell genomics

    E-Print Network [OSTI]

    Hughes, Travis K.

    An innovative, microwell-based platform for single-cell RNA sequencing (RNA-seq) combines cost efficiency, scalability and parallelizability, and will enable many new avenues of biological inquiry.

  3. Mr and Mrs: How 'I Do' Impacts Physical Activity in Married Individuals

    E-Print Network [OSTI]

    Michel, Kacy L.

    2012-07-16T23:59:59.000Z

    the mechanisms, determinants, and influences of spousal physical activity. Findings indicate verbal persuasion by husbands encouraged wives, yet verbal persuasion by wives was perceived as nagging by men. While verbal persuasion by husbands increased a small...

  4. Divorce Property Division Laws and the Decision to Marry or Cohabitate

    E-Print Network [OSTI]

    Fisher, Hayley

    2011-01-01T23:59:59.000Z

    This paper presents a model of the choice between marriage and cohabitation for a couple who have decided to form a relationship. The model is used to analyse the implications of changing from a title based division of property on divorce...

  5. Marrying by the Numbers: Marriage Patterns of Aristocratic British Women, 1485-2000

    E-Print Network [OSTI]

    Schutte, Kimberly

    2011-05-31T23:59:59.000Z

    This project is a study of the marriage patterns of aristocratic British women over the more than five-century period between 1485 and 2000. It employs a two-fold evidentiary base, combining a demographic analysis with a ...

  6. BRIEF REPORT Mate preferences of married persons in the newlywed year and

    E-Print Network [OSTI]

    Pillow, Jonathan

    David M. Buss The University of Texas at Austin, TX, USA Mate preferences are cognitions about for ``mutual attractionÐlove,'' ``emotional stability & maturity'', and ``pleasing disposition'' (see Buss women more than men value good financial prospects in a long-term mate (Buss, 1989; Buss, Shackelford

  7. Dosimetry considerations in the enhanced sensitivity of male Wistar rats to chronic ethylene glycol-induced nephrotoxicity

    SciTech Connect (OSTI)

    Corley, R.A. [Battelle Pacific Northwest Division, Richland, WA 99352 (United States)], E-mail: rick.corley@pnl.gov; Wilson, D.M. [Dow Chemical Company, Midland, MI 48674 (United States); Hard, G.C. [Tairua, 2853 (New Zealand); Stebbins, K.E.; Bartels, M.J. [Dow Chemical Company, Midland, MI 48674 (United States); Soelberg, J.J. [Battelle Pacific Northwest Division, Richland, WA 99352 (United States); Dryzga, M.D. [Dow Chemical Company, Midland, MI 48674 (United States); Gingell, R. [Shell Oil Company, Houston, TX 77002 (United States); McMartin, K.E. [Louisiana State University Health Sciences Center, Shreveport, LA 71130 (United States); Snellings, W.M. [Dow Chemical Company, Midland, MI 48674 (United States)

    2008-04-15T23:59:59.000Z

    Male Wistar rats have been shown to be the most sensitive sex, strain and species to ethylene glycol-induced nephrotoxicity in subchronic studies. A chronic toxicity and dosimetry study was therefore conducted in male Wistar rats administered ethylene glycol via the diet at 0, 50, 150, 300, or 400 mg/kg/day for up to twelve months. Subgroups of animals were included for metabolite analysis and renal clearance studies to provide a quantitative basis for extrapolating dose-response relationships from this sensitive animal model in human health risk assessments. Mortality occurred in 5 of 20 rats at 300 mg/kg/day (days 111-221) and 4 of 20 rats at 400 mg/kg/day (days 43-193), with remaining rats at this dose euthanized early (day 203) due to excessive weight loss. Increased water consumption and urine volume with decreased specific gravity occurred at 300 mg/kg/day presumably due to osmotic diuresis. Calculi (calcium oxalate crystals) occurred in the bladder or renal pelvis at {>=} 300 mg/kg/day. Rats dying early at {>=} 300 mg/kg/day had transitional cell hyperplasia with inflammation and hemorrhage of the bladder wall. Crystal nephropathy (basophilic foci, tubule or pelvic dilatation, birefringent crystals in the pelvic fornix, or transitional cell hyperplasia) affected most rats at 300 mg/kg/day, all at 400 mg/kg/day, but none at {<=} 150 mg/kg/day. No significant differences in kidney oxalate levels, the metabolite responsible for renal toxicity, were observed among control, 50 and 150 mg/kg/day groups. At 300 and 400 mg/kg/day, oxalate levels increased proportionally with the nephrotoxicity score supporting the oxalate crystal-induced nephrotoxicity mode of action. No treatment-related effects on the renal clearance of intravenously infused {sup 3}H-inulin, a marker for glomerular filtration, and {sup 14}C-oxalic acid were observed in rats surviving 12 months of exposure to ethylene glycol up to 300 mg/kg/day. In studies with naive male Wistar and F344 rats (a less sensitive strain), a significant difference was observed in oxalate clearances between young rats (i.e. Wistar clearance < F344) but not in age-matched old rats. Regardless, the ratios of oxalate:inulin clearances in these two strains of rats, including those exposed to ethylene glycol, were all < 1, suggesting that a fraction of the filtered oxalate is reabsorbed. Other species, including humans, typically have clearance ratios > 1 and are more effective at clearing oxalic acid by both glomerular filtration and active secretion. Thus, the lower renal clearance and kidney accumulation of oxalates in male Wistar rats enhances their sensitivity, which will be a factor in human risk assessments. The benchmark dose values (BMD05, BMDL05) were 170 mg/kg/day and 150 mg/kg/day for nephropathy, and 170 mg/kg/day and 160 mg/kg/day for birefringent crystals, using incidence times severity data in each case. The NOAEL of 150 mg/kg/day is the same as that reported after 16-week exposure and appears to be a threshold dose below which no renal toxicity occurs, regardless of exposure duration.

  8. Seasonal Patterns of Melatonin, Cortisol, and Progesterone Secretion in Female Lambs Raised Beneath a 500-kV Transmission Line.

    SciTech Connect (OSTI)

    Lee, Jack M.

    1992-06-01T23:59:59.000Z

    Although several kinds of biological effects of electric and magnetic fields have been reported from laboratory studies, few have been independently replicated. When this study was being planned, the suppression of nighttime melatonin in rodents was thought to represent one of the strongest known effects of these fields. The effect had been replicated by a single laboratory for 60-Hz electric fields, and by multiple laboratories for d-c magnetic fields. The primary objective of this study was to determine whether the effect of electric and magnetic fields on melatonin would also occur in sheep exposed to a high voltage transmission line. The specific hypothesis tested by this experiment was as follows: The electrical environment produced by a 60-Hz, 500-kV transmission line causes a depression in nocturnal melatonin in chronically exposed female lambs. This may mimic effects of pinealectomy or constant long-day photoperiods, thus delaying the onset of reproductive cycles. Results of the study do not provide evidence to support the hypothesis. Melatonin concentrations in the sheep exposed to the transmission line showed the normal pattern of low daytime and high nighttime serum levels. As compared to the control group, there were no statistically significant group differences in the mean amplitude, phase, or duration of the nighttime melatonin elevation.

  9. Polychlorinated biphenyl 77 augments angiotensin II-induced atherosclerosis and abdominal aortic aneurysms in male apolipoprotein E deficient mice

    SciTech Connect (OSTI)

    Arsenescu, Violeta [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Arsenescu, Razvan [Digestive Diseases and Nutrition, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Digestive Diseases and Nutrition, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Parulkar, Madhura; Karounos, Michael [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Zhang, Xuan [Graduate Center for Toxicology, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Toxicology, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Baker, Nicki [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Cassis, Lisa A., E-mail: lcassis@uky.edu [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)

    2011-11-15T23:59:59.000Z

    Infusion of angiotensin II (AngII) to hyperlipidemic mice augments atherosclerosis and causes formation of abdominal aortic aneurysms (AAAs). Each of these AngII-induced vascular pathologies exhibit pronounced inflammation. Previous studies demonstrated that coplanar polychlorinated biphenyls (PCBs) promote inflammation in endothelial cells and adipocytes, two cell types implicated in AngII-induced vascular pathologies. The purpose of this study was to test the hypothesis that administration of PCB77 to male apolipoprotein E (ApoE) -/- mice promotes AngII-induced atherosclerosis and AAA formation. Male ApoE-/- mice were administered vehicle or PCB77 (49 mg/kg, i.p.) during week 1 and 4 (2 divided doses/week) of AngII infusion. Body weights and total serum cholesterol concentrations were not influenced by administration of PCB77. Systolic blood pressure was increased in AngII-infused mice administered PCB77 compared to vehicle (156 {+-} 6 vs 137 {+-} 5 mmHg, respectively). The percentage of aortic arch covered by atherosclerotic lesions was increased in AngII-infused mice administered PCB77 compared to vehicle (2.0 {+-} 0.4 vs 0.9 {+-} 0.1%, respectively). Lumen diameters of abdominal aortas determined by in vivo ultrasound and external diameters of excised suprarenal aortas were increased in AngII-infused mice administered PCB77 compared to vehicle. In addition, AAA incidence increased from 47 to 85% in AngII-infused mice administered PCB77. Adipose tissue in close proximity to AAAs from mice administered PCB77 exhibited increased mRNA abundance of proinflammatory cytokines and elevated expression of components of the renin-angiotensin system (angiotensinogen, angiotensin type 1a receptor (AT1aR)). These results demonstrate that PCB77 augments AngII-induced atherosclerosis and AAA formation. -- Highlights: Black-Right-Pointing-Pointer Polychlorinated biphenyl 77 (PCB77) promotes AngII-induced hypertension. Black-Right-Pointing-Pointer PCB77 augments AngII-induced atherosclerosis. Black-Right-Pointing-Pointer PCB77 promotes AngII-induced AAA formation and rupture. Black-Right-Pointing-Pointer PCB77 promotes inflammation in periaorticadipose tissue surrounding AAAs.

  10. A social demographic study of the likelihood of sustaining an occupational fatality resulting in death

    E-Print Network [OSTI]

    Traut, Rachel Lynn

    2009-05-15T23:59:59.000Z

    or not differences exist. The thesis involves two analyses, one with the sample comprised of only males between the ages of 25 and 55 and one including only married males between the ages of 25 and 55. Logistic regression is employed as the method of analysis...

  11. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:

  12. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0 6

  13. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0 6

  14. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0

  15. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0

  16. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 09

  17. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 097

  18. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0

  19. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01 3

  20. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01 35

  1. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01

  2. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 013

  3. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0139

  4. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6

  5. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 60

  6. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 604

  7. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6043

  8. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 604376

  9. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6043763

  10. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4

  11. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 42 4 1 0

  12. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 42 4 1 00

  13. Patterns of variation in leucocyte counts of female tree swallows, Tachycineta bicolor: Repeatability over time and relationships with condition and costs of reproduction

    E-Print Network [OSTI]

    Dawson, Russell D.

    University Way, Prince George, BC, Canada V2N 4Z9 A B S T R A C TA R T I C L E I N F O Article history is increasingly being recognized as a reliable indicator of stress in birds. In this study we examined whether HL time, date, age, climate conditions or with measures of maternal investment in female tree swallows

  14. Use of genomic data in risk assessment case study: I. Evaluation of the dibutyl phthalate male reproductive development toxicity data set

    SciTech Connect (OSTI)

    Makris, Susan L., E-mail: makris.susan@epa.gov [U.S. Environmental Protection Agency, National Center for Environmental Assessment, Office of Research and Development, (Mail code 8623P), 1200 Pennsylvania Ave., NW, Washington, DC 20460 (United States); Euling, Susan Y. [U.S. Environmental Protection Agency, National Center for Environmental Assessment, Office of Research and Development, (Mail code 8623P), 1200 Pennsylvania Ave., NW, Washington, DC 20460 (United States); Gray, L. Earl [U.S. Environmental Protection Agency, National Health and Environmental Effects Research Laboratory, Office of Research and Development, (MD-72), Highway 54, Research Triangle Park, NC 27711 (United States); Benson, Robert [U.S. Environmental Protection Agency, Region 8, (Mail code 8P-W), 1595 Wynkoop Street, Denver, CO 80202 (United States); Foster, Paul M.D. [National Toxicology Program, National Institute of Environmental Health Sciences, P.O. Box 12233 (MD K2-12), Research Triangle Park, NC 27709 (United States)

    2013-09-15T23:59:59.000Z

    A case study was conducted, using dibutyl phthalate (DBP), to explore an approach to using toxicogenomic data in risk assessment. The toxicity and toxicogenomic data sets relative to DBP-related male reproductive developmental outcomes were considered conjointly to derive information about mode and mechanism of action. In this manuscript, we describe the case study evaluation of the toxicological database for DBP, focusing on identifying the full spectrum of male reproductive developmental effects. The data were assessed to 1) evaluate low dose and low incidence findings and 2) identify male reproductive toxicity endpoints without well-established modes of action (MOAs). These efforts led to the characterization of data gaps and research needs for the toxicity and toxicogenomic studies in a risk assessment context. Further, the identification of endpoints with unexplained MOAs in the toxicity data set was useful in the subsequent evaluation of the mechanistic information that the toxicogenomic data set evaluation could provide. The extensive analysis of the toxicology data set within the MOA context provided a resource of information for DBP in attempts to hypothesize MOAs (for endpoints without a well-established MOA) and to phenotypically anchor toxicogenomic and other mechanistic data both to toxicity endpoints and to available toxicogenomic data. This case study serves as an example of the steps that can be taken to develop a toxicological data source for a risk assessment, both in general and especially for risk assessments that include toxicogenomic data.

  15. 3rd Survey on the Situation of PhD Students in the Max Planck Society Open from the 25th of May until the 21th of June

    E-Print Network [OSTI]

    insurance I don't have such an insurance other insurance G8 Are you male or female? Variables: G8 1 Female 2

  16. attraction influences mate-choice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Influences Social Influences on the Mate Choices of Male and Female Japanese Quail Bennett. The results of those studies are summarized here. Females prefer to affiliate with...

  17. Possible modulation of N-methyl-D,L-aspartic acid induced prolactin release by testicular steroids in the adult male rhesus monkey

    SciTech Connect (OSTI)

    Arslan, M.; Rizvi, S.S.R.; Jahan, S.; Zaidi, P.; Shahab, M. (Quaid-i-Azam Univ., Islamabad (Pakistan))

    1991-01-01T23:59:59.000Z

    N-methyl-D,L-aspartic acid (NMA), an agonist of the neurotransmitter glutamate has been shown to acutely stimulate the release of prolactin (PRL) in intact rats and monkeys. To further investigate the role of neuroexcitatory amino acids in PRL secretion, the effects of NMA administration were examined on PRL release in long term orchidectomized adult rhesus monkeys, in both the absence and presence of testosterone. Intact and long term castrated adult male monkeys weighing between 8-13 kg, were implanted with a catheter via the saphenous vein for blood withdrawal and drug infusion. Blood samples were collected at 10 min intervals for 50 min before and 70 min after administration of the drug or vehicle. Plasma PRL concentrations were estimated using radioimmunoassay. Whereas a single iv injection of NMA induced a prompt discharge of PRL in intact monkeys, an identical dose had surprisingly no effect on PRL secretion in orchidectomized animals. On the other hand, plasma PRL increases in response to a challenge dose of thyrotropin releasing hormone were similar in magnitude in the two groups of monkeys. Testosterone replacement in orchidectomized animals by parenteral administration of testosterone enanthate reinitiated the PRL responsiveness to acute NMA stimulation. These results indicate that N-methyl-D-aspartic acid (NMDA) dependent drive to PRL release in the adult male rhesus monkey may be overtly influenced by the sex steroid milieu.

  18. Dosimetric Comparison of Involved-Field Three-Dimensional Conformal Photon Radiotherapy and Breast-Sparing Proton Therapy for the Treatment of Hodgkin's Lymphoma in Female Pediatric Patients

    SciTech Connect (OSTI)

    Andolino, David L., E-mail: dandolin@iupui.edu [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Hoene, Ted [Midwest Proton Radiotherapy Institute, Bloomington, IN (United States); Xiao, Lu [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Buchsbaum, Jeffrey; Chang, Andrew L. [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Midwest Proton Radiotherapy Institute, Bloomington, IN (United States)

    2011-11-15T23:59:59.000Z

    Purpose: To assess the potential reduction in breast dose for young girls with Hodgkin's lymphoma (HL) treated with breast-sparing proton therapy (BS-PT) as compared with three-dimensional conformal involved-field photon radiotherapy (3D-CRT). Methods and Materials: The Clarian Health Cancer Registry was queried for female pediatric patients with the diagnosis of HL who received radiotherapy at the Indiana University Simon Cancer Center during 2006-2009. The original CT simulation images were obtained, and 3D-CRT and BS-PT plans delivering 21 Gy or cobalt gray equivalent (CGE) in 14 fractions were created for each patient. Dose-volume histogram data were collected for both 3D-CRT and BS-PT plans and compared by paired t test for correlated samples. Results: The cancer registry provided 10 female patients with Ann Arbor Stage II HL, aged 10-18 years at the time of treatment. Both mean and maximum breast dose were significantly less with BS-PT compared with 3D-CRT: 0.95 CGE vs. 4.70 Gy (p < 0.001) and 21.07 CGE vs. 23.11 Gy (p < 0.001), respectively. The volume of breast receiving 1.0 Gy/CGE and 5.0 Gy/CGE was also significantly less with BS-PT, 194 cm{sup 3} and 93 cm{sup 3}, respectively, compared with 790 cm{sup 3} and 360 cm{sup 3} with 3D-CRT (p = 0.009, 0.013). Conclusion: Breast-sparing proton therapy has the potential to reduce unnecessary breast dose in young girls with HL by as much as 80% relative to involved-field 3D-CRT.

  19. Sheet1

    E-Print Network [OSTI]

    Cai, Qianqi

    8, Engermann, Elijah N. 61, Female. 9, Hansen, Sandra M. 61, Female. 10, Kinney, Grant H. 42, Male. 11, Kinney, Matthew J. 59, Male. 12, LaFrancois, Sarah N.

  20. Roster(4)

    E-Print Network [OSTI]

    ahn

    48, Pitman, Lisa A. 9.2, 40, Male. 49, Prachyl, Conner A. 9.15, 32, Female. 50, Rotter, Thomas E. 9.1, 50, Male. 51, Toweson, John B. 9.05, 53, Female.

  1. Individualized Data for Lab 4

    E-Print Network [OSTI]

    46, Onaghise, Oluwatumininu E. 9.70, 49, Female. 47, Peng, Xihan, 9.75, 69, Female. 48, Pitman, Lisa A. 9.80, 65, Male. 49, Prachyl, Conner A. 9.85, 67, Male.

  2. Sequence of the chicken sex chromosomes

    E-Print Network [OSTI]

    Bellott, Daniel Winston

    2010-01-01T23:59:59.000Z

    In birds, as in mammals, the chromosome complement determines sex. Male birds are designated ZZ, female ZW. Mammals have the opposite system; males are XY and females XX. Both the avian ZW and mammalian XY pair are believed ...

  3. Non-invasive Multidisciplinary Approach to the Study of Reproduction and Calf Development in Bottlenose Dolphin (Tursiops truncatus): The Rimini Delfinario Experience

    E-Print Network [OSTI]

    Tizzi, Raffaella; Accorsi, Pier Attilio; Azzali, Massimo

    2010-01-01T23:59:59.000Z

    presumed) Gulf of Mexico (Campeche) Beta* Female 1981 (presumed) Gulf of Mexico (Campeche) Sole Male 03 May 1993

  4. Mating behaviour, epibiotic growth, and the effect of salinity on grooming activity in the hermaphroditic shrimp Lysmata wurdemanni 

    E-Print Network [OSTI]

    Giri, Tuhin

    2004-09-30T23:59:59.000Z

    species of decapod crustaceans observed to exhibit protandry, 31 belong to the Infraorder Caridea (reviewed in Bauer (2000)). Protandric hermaphroditism found in these shrimp is believed to have evolved from a gonochoristic ancestor, but the mechanism... females, as well as individuals that experience a very short male phase; (D) Protandry with primary males; (E) Protandric simultaneous hermaphroditism. (After Bauer (2000)) Juvenile Male Female A Juvenile Male Female Primary Female B Juvenile...

  5. Urban African-American Single Mothers Using Resiliency And Racial Socialization To Influence Academic Success In Their Young Sons

    E-Print Network [OSTI]

    Henderson-Hubbard, Lisa Doris

    2012-02-14T23:59:59.000Z

    ?????????????????????.. 63 India?s Story?????????????????????. 65 Patricia?s Story...???????????????????... 68 Shaun?s Story???????????????????....... 70...,809,000 African-American children were being raised by African-American single mothers due to absent husbands, the mother being widowed, divorced or simply having never married (U.S. Census, 2000). In 2000, there were 3,814,000 African- American female headed...

  6. SUCCES: satisfying unions through couples communication and enhancement skills: a secondary prevention and enhancement program for married couples

    E-Print Network [OSTI]

    Oxford, Mary Cunningham

    2004-09-30T23:59:59.000Z

    factors in order to disrupt processes that contribute to human dysfunction,? (Coie, Watt, West, Hawkins, Asarnow, Markman, Ramey, Shure & Long, 1993, p. 1013). Because destructive intimate relationships are related to a variety of negative health...

  7. The prevalence of off-farm employment among married farm women residing in Texas: a human ecological approach

    E-Print Network [OSTI]

    Schiflett, Kathy Lynn

    1988-01-01T23:59:59.000Z

    women in a California county, Sharp et al. (1986) found that farm women had higher involvement in production decisions, gaining management information and task participation on livestock production farms than on crop production farms... of days employed off the farm, reside on farms with low gross farm incomes and percents of farmland owned, and who reside in counties with the greatest nonfarm sustenance diversity. Similar findings are also found from multiple regression analysis...

  8. An Introduction to Prolog A.1 A Short Background

    E-Print Network [OSTI]

    Nugues, Pierre

    into Prolog facts ended with a period: character(priam, iliad). character(hecuba, iliad). character characters male(priam). female(hecuba). male(achilles). female(andromache). male(agamemnon). female characters such as parentage: % Fathers % Mothers father(priam, hector). mother(hecuba, hector). father

  9. Individualized Data for Lab 5

    E-Print Network [OSTI]

    ahn

    9, Hansen, Sandra M. 11.15, 43, Female. 10, Kinney, Grant H. 11.1, 39, Female. 11, Kinney, Matthew J. 11.05, 40, Female. 12, LaFrancois, Sarah N. 11, 35, Male.

  10. Modulation of benzo[a]pyrene induced neurotoxicity in female mice actively immunized with a B[a]P–diphtheria toxoid conjugate

    SciTech Connect (OSTI)

    Schellenberger, Mario T.; Grova, Nathalie; Farinelle, Sophie; Willième, Stéphanie [Institute of Immunology, Centre de Recherche Public de la Santé/Laboratoire National de Santé, 20A rue Auguste Lumière, L-1950 Luxembourg, Grand-Duchy of Luxembourg (Luxembourg); Schroeder, Henri [University of Nancy, URAFPA, INRA UC340, F-54500 Vandoeuvre-lès-Nancy (France); Muller, Claude P., E-mail: claude.muller@crp-sante.lu [Institute of Immunology, Centre de Recherche Public de la Santé/Laboratoire National de Santé, 20A rue Auguste Lumière, L-1950 Luxembourg, Grand-Duchy of Luxembourg (Luxembourg)

    2013-09-01T23:59:59.000Z

    Benzo[a]pyrene (B[a]P) is a small molecular weight carcinogen and the prototype of polycyclic aromatic hydrocarbons (PAHs). While these compounds are primarily known for their carcinogenicity, B[a]P and its metabolites are also neurotoxic for mammalian species. To develop a prophylactic immune strategy against detrimental effects of B[a]P, female Balb/c mice immunized with a B[a]P–diphtheria toxoid (B[a]P–DT) conjugate vaccine were sub-acutely exposed to 2 mg/kg B[a]P and behavioral performances were monitored in tests related to learning and memory, anxiety and motor coordination. mRNA expression of the NMDA receptor (NR1, 2A and 2B subunits) involved in the above behavioral functions was measured in 5 brain regions. B[a]P induced NMDA1 expression in three (hippocampus, amygdala and cerebellum) of five brain regions investigated, and modulated NMDA2 in two of the five brain regions (frontal cortex and cerebellum). Each one of these B[a]P-effects was reversed in mice that were immunized against this PAH, with measurable consequences on behavior such as anxiety, short term learning and memory. Thus active immunization against B[a]P with a B[a]P–DT conjugate vaccine had a protective effect and attenuated the pharmacological and neurotoxic effects even of high concentrations of B[a]P. - Highlights: • B[a]P-antibodies attenuated B[a]P induced NMDA expression in several brain regions. • B[a]P had measurable consequences on anxiety, short term learning and memory. • B[a]P immunization attenuated the pharmacological and neurotoxic effects of B[a]P. • Vaccination may also provide some protection against chemical carcinogenesis.

  11. MAPK-ERK activation in kidney of male rats chronically fed ochratoxin A at a dose causing a significant incidence of renal carcinoma

    SciTech Connect (OSTI)

    Marin-Kuan, M. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland)], E-mail: maricel.marin-kuan@rdls.nestle.com; Nestler, S. [Nephro-Urology Unit, Institute of Child Health, University College London, 30 Guilford Street, London WC1E 1EH (United Kingdom); Department of Environmental Science and Technology, Imperial College London, London SW7 2AZ (United Kingdom); Verguet, C.; Bezencon, C.; Piguet, D.; Delatour, T. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland); Mantle, P. [Department of Environmental Science and Technology, Imperial College London, London SW7 2AZ (United Kingdom); Cavin, C.; Schilter, B. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland)

    2007-10-15T23:59:59.000Z

    Kidney samples of male Fischer 344 (F-344) rats fed a carcinogenic dose of OTA over 7 days, 21 days and 12 months were analysed for various cell signalling proteins known to be potentially involved in chemical carcinogenicity. OTA was found to increase the phosphorylation of atypical-PKC. This was correlated with a selective downstream activation of the MAP-kinase extracellular regulated kinases isoforms 1 and 2 (ERK1/2) and of their substrates ELK1/2 and p90RSK. Moreover, analysis of effectors acting upstream of PKC indicated a possible mobilisation of the insulin-like growth factor-1 receptor (lGFr) and phosphoinositide-dependent kinase-1 (PDK1) system. An increased histone deacetylase (HDAC) enzymatic activity associated with enhanced HDAC3 protein expression was also observed. These findings are potentially relevant with respect to the understanding of OTA nephrocarcinogenicity. HDAC-induced gene silencing has previously been shown to play a role in tumour development. Furthermore, PKC and the MEK-ERK MAP-kinase pathways are known to play important roles in cell proliferation, cell survival, anti-apoptotic activity and renal cancer development.

  12. MALE RIO GRANDE WILD TURKEY

    E-Print Network [OSTI]

    . Jernigan5 Texas Parks and Wildlife Department, Matador Wildlife Management Area, 3036 FM 3256, Paducah, TX

  13. Jonathan Male | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels Data CenterEnergyGlossary ofHomeJC3 Bulletin Archive JC3Lushetsky

  14. Table 1. Description of the 74 deaths caused by malignant neoplasms in Down syndrome population, California, January 1, 1988 December 31, 2002

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    .9) 3 Female 56.2 1989 Acute leukemia NOS (208.0) 4 Female 2.3 1990 Megakaryocytic leukemia (207.2) 5 Female 2.7 1990 Unspecified leukemia (208.9) 6 Female 3.0 1990 Acute leukemia NOS (208.0) 7 Male 36.3 1991 Acute lymphoid leukemia (204.0) 10 Male 63.2 1991 Bladder, part unspecified (188.9) 11 Female 2

  15. Sound production during courtship and spawning of Oreochromis mossambicus: malefemale and

    E-Print Network [OSTI]

    ­male interactions M. C. P. AMORIM*, P. J. FONSECA AND V. C. ALMADA* *Unidade de Investigac¸a~o em Eco-etologia. I. Only territorial males produced sounds, during male­female and male­male court- ship interactions

  16. High power connection system

    DOE Patents [OSTI]

    Schaefer, Christopher E. (Warren, OH); Beer, Robert C. (Noblesville, IN); McCall, Mark D. (Youngstown, OH)

    2000-01-01T23:59:59.000Z

    A high power connection system adapted for automotive environments which provides environmental and EMI shielding includes a female connector, a male connector, and a panel mount. The female connector includes a female connector base and a snap fitted female connector cover. The male connector includes a male connector base and a snap fitted male connector cover. The female connector base has at least one female power terminal cavity for seatably receiving a respective female power terminal. The male connector base has at least one male power terminal cavity for seatably receiving a respective male power terminal. The female connector is covered by a cover seal and a conductive shroud. A pair of lock arms protrude outward from the front end of the male connector base, pass through the panel mount and interface with a lever of a lever rotatably connected to the shroud to thereby mechanically assist mating of the male and female connectors. Safety terminals in the male and female connectors provide a last-to-connect-first-to-break connection with an HVIL circuit.

  17. SelfingSelfing andand OutcrossingOutcrossing The ESS andThe ESS and HermaphroditismHermaphroditism

    E-Print Network [OSTI]

    Cruzan, Mitchell B.

    SelfingSelfing andand OutcrossingOutcrossing The ESS andThe ESS and Hermaphroditism.females. If pollen is a reward forIf pollen is a reward for pollinators.pollinators. #12;ESS ModelsESS Models Shapes by different resources.by different resources. Male Success » FemaleSuccess» Male Success » FemaleSuccess» ESS

  18. Patterns of Testosterone and Prolactin Concentrations and Reproductive Behavior of

    E-Print Network [OSTI]

    Walters, Jeffrey R.

    - centrations of testosterone (T) and prolactin (PRL) in female breeders, male breeders, and male helpers dur breeder, and male helper PRL levels did not differ and increased from the prebreeding stage through PRL declined, while female PRL continued to increase. Based on these results, we conclude

  19. Multi-institutional Quantitative Evaluation and Clinical Validation of Smart Probabilistic Image Contouring Engine (SPICE) Autosegmentation of Target Structures and Normal Tissues on Computer Tomography Images in the Head and Neck, Thorax, Liver, and Male Pelvis Areas

    SciTech Connect (OSTI)

    Zhu, Mingyao [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States); Bzdusek, Karl [Philips Healthcare, Fitchburg, Wisconsin (United States); Brink, Carsten [Institute of Clinical Research, University of Southern Denmark, Odense (Denmark); Laboratory of Radiation Physics, Odense University Hospital, Odense (Denmark); Eriksen, Jesper Grau [Department of Oncology, Odense University Hospital, Odense (Denmark); Hansen, Olfred [Institute of Clinical Research, University of Southern Denmark, Odense (Denmark); Department of Oncology, Odense University Hospital, Odense (Denmark); Jensen, Helle Anita [Department of Oncology, Odense University Hospital, Odense (Denmark); Gay, Hiram A.; Thorstad, Wade [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States); Widder, Joachim; Brouwer, Charlotte L.; Steenbakkers, Roel J.H.M.; Vanhauten, Hubertus A.M. [Department of Radiation Oncology, University Medical Center Groningen, University of Groningen, Groningen (Netherlands); Cao, Jeffrey Q.; McBrayne, Gail [London Regional Cancer Centre, Ontario (Canada); Patel, Salil H. [Department of Radiation Oncology, Rhode Island Hospital, Providence, Rhode Island (United States); Cannon, Donald M. [Department of Human Oncology, University of Wisconsin—Madison (United States); Hardcastle, Nicholas [Department of Physical Science, Peter MacCallum Cancer Centre, Melbourne (Australia); Tomé, Wolfgang A. [Montefiore Medical Center and Institute of Onco-Physics, Albert Einstein College of Medicine, Bronx, New York (United States); Guckenberg, Matthias [University of Würzburg, Department of Radiation Oncology, Würzburg (Germany); Parikh, Parag J., E-mail: pparikh@radonc.wustl.edu [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States)

    2013-11-15T23:59:59.000Z

    Purpose: Clinical validation and quantitative evaluation of computed tomography (CT) image autosegmentation using Smart Probabilistic Image Contouring Engine (SPICE). Methods and Materials: CT images of 125 treated patients (32 head and neck [HN], 40 thorax, 23 liver, and 30 prostate) in 7 independent institutions were autosegmented using SPICE and computational times were recorded. The number of structures autocontoured were 25 for the HN, 7 for the thorax, 3 for the liver, and 6 for the male pelvis regions. Using the clinical contours as reference, autocontours of 22 selected structures were quantitatively evaluated using Dice Similarity Coefficient (DSC) and Mean Slice-wise Hausdorff Distance (MSHD). All 40 autocontours were evaluated by a radiation oncologist from the institution that treated the patients. Results: The mean computational times to autosegment all the structures using SPICE were 3.1 to 11.1 minutes per patient. For the HN region, the mean DSC was >0.70 for all evaluated structures, and the MSHD ranged from 3.2 to 10.0 mm. For the thorax region, the mean DSC was 0.95 for the lungs and 0.90 for the heart, and the MSHD ranged from 2.8 to 12.8 mm. For the liver region, the mean DSC was >0.92 for all structures, and the MSHD ranged from 5.2 to 15.9 mm. For the male pelvis region, the mean DSC was >0.76 for all structures, and the MSHD ranged from 4.8 to 10.5 mm. Out of the 40 autocontoured structures reviews by experts, 25 were scored useful as autocontoured or with minor edits for at least 90% of the patients and 33 were scored useful autocontoured or with minor edits for at least 80% of the patients. Conclusions: Compared with manual contouring, autosegmentation using SPICE for the HN, thorax, liver, and male pelvis regions is efficient and shows significant promise for clinical utility.

  20. Hybrid Zones: Representations of Race in Late Nineteenth-Century French Visual Culture

    E-Print Network [OSTI]

    Stringer, Rozanne McGrew

    2011-04-26T23:59:59.000Z

    In this study, I examine images of the black female and black male body and the female Spanish Gypsy by four artists ??_?? Edgar Degas, ?_??douard Manet, Fr?_??d?_??ric Bazille, and Henri de Toulouse??_???Lautrec ??_?? ...

  1. Caribbean Journal of Science, Vol. 31, No. 1-2, 65-72, 1995 Copyright 1995 College of Arts and Sciences

    E-Print Network [OSTI]

    Hedges, Blair

    collecting data as holotype; MCZ R178768 (male) and CARE 60721 (female), between Cayo Fortuna and Riito, female, Cayo Fortuna, Yateras, Guantanamo Prov., 16 March 1987, collected by Antonio Perez- Asso; CARE

  2. Journal of Chemical Ecology, Vol. 30, No. 9, September 2004 (C 2004) BEHAVIORAL ACTIVITY OF STEREOISOMERS

    E-Print Network [OSTI]

    component of the courtship stimulating, contact sex pheromone of the female German cock- roach. Although INTRODUCTION Upon contact with a mature female, sexually mature males of the German cock- roach, Blattella

  3. YEAR

    National Nuclear Security Administration (NNSA)

    8 YEAR 2013 Males 27 Females 11 YEAR 2013 SES 1 EN 05 1 EN 04 11 NN (Engineering) 8 NQ (ProfTechAdmin) 15 NU (TechAdmin Support) 2 YEAR 2013 American Indian Alaska Native Male...

  4. YEAR

    National Nuclear Security Administration (NNSA)

    96 YEAR 2013 Males 69 Females 27 YEAR 2013 SES 1 EJEK 9 EN 04 27 NN (Engineering) 26 NQ (ProfTechAdmin) 30 NU (TechAdmin Support) 3 YEAR 2013 American Indian Alaska Native Male...

  5. YEAR

    National Nuclear Security Administration (NNSA)

    31 YEAR 2013 Males 20 Females 11 YEAR 2013 SES 2 EN 04 4 NN (Engineering) 12 NQ (ProfTechAdmin) 12 NU (TechAdmin Support) 1 YEAR 2013 American Indian Alaska Native Male (AIAN,...

  6. Biosystematics of Encarsia pergandiella and Encarsia tabacivora: two cryptic species of whitefly parasitoids (Hymenoptera: Aphelinidae)

    E-Print Network [OSTI]

    Johnson, Roishene Collette

    1996-01-01T23:59:59.000Z

    and 31 male antennae did not reveal any consistent size or shape differences among the three populations. Canonical discriminant analyses of these data indicated that males are more readily differentiated morphologically than females. The light and dark...

  7. Changing her tune : how a transsexual woman claims a new identity through voice

    E-Print Network [OSTI]

    Gammon, Katharine Stoel

    2007-01-01T23:59:59.000Z

    The human voice is an important indicator of a person's gender. For male-to-female transgender individuals (or transsexuals) the voice is one of the most difficult parts of the gender transition. Males have larger and ...

  8. Electrical connector | OSTI, US Dept of Energy, Office of Scientific...

    Office of Scientific and Technical Information (OSTI)

    connector includes a female component having one or more receptacles, a first test receptacle, and a second test receptacle. The electrical connector also includes a male...

  9. age-related lh surge: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RELEASE FOLLOWING STEROID MANIPULATIONS Physics Websites Summary: ) and prolactin (PRL) levels have been studied in groups of immature normal male and female Wistar rats and...

  10. Forgiving Overconfidence in Tort Law

    E-Print Network [OSTI]

    Luppi, Barbara; Parisi, Francesco

    2009-01-01T23:59:59.000Z

    Driving Ability” 18 Accident Analysis and Prevention 299–Males and Females” 23 Accident Analysis and Prevention 45–Seatbelt Usage” 17 Accident Analysis and Prevention, 119–33.

  11. Distribution and Variation of Pocket Gophers (Genus Geomys) in the Southwestern United States.

    E-Print Network [OSTI]

    Davis, William B.

    1940-01-01T23:59:59.000Z

    , constricted near middle. 5. Hind foot of females usually 34 mm., or more. in length ; premaxillary tongues terminating anterior to lacrimal proc- esses ........................................................ G. bursarius* 5l. Hind foot of females usually.... mm. or more (males 16,000 cu. mm., or more). 2. Zygomatic arches widely divergent anteriorly; hind foot of females averaging 27 mm. or more (29 mm. or more in males). 3. "Volume" of skull in females near 14,000 cu. mm.; body length averaging 231...

  12. Health Care Interventions for Gender-based Violence: Formative Research with Primary Care Physicians and Young Married Women in Southern India to Explore Feasibility and Specific Needs

    E-Print Network [OSTI]

    Chibber, Karuna

    2009-01-01T23:59:59.000Z

    splitting: the health policy agenda in India. Health Policysplitting: the health policy agenda in India. Health Policysplitting: the health policy agenda in India. Health Policy

  13. Contract on My Life Mr. Polsen, a 42-year-old married African American postal worker and father of two is brought to

    E-Print Network [OSTI]

    Squire, Larry R.

    , he would panic and run home. After one such incident, his wife finally insisted that he accompany her speech, behavior and demeanor were in no way odd or strange. His predominant mood was anxious. He denied been no change in his appetite, sex drive, energy level or concentration. #12;Discussion of "Contract

  14. Health Care Interventions for Gender-based Violence: Formative Research with Primary Care Physicians and Young Married Women in Southern India to Explore Feasibility and Specific Needs

    E-Print Network [OSTI]

    Chibber, Karuna

    2009-01-01T23:59:59.000Z

    Family Health Survey. (2005-06). NFHS-3 Fact Sheets. Mumbai,Family Health Survey. (2005-06). NFHS-3 Fact Sheets. Mumbai,Family Health Survey. (2005-06). NFHS-3 Fact Sheets. Mumbai,

  15. Health Care Interventions for Gender-based Violence: Formative Research with Primary Care Physicians and Young Married Women in Southern India to Explore Feasibility and Specific Needs

    E-Print Network [OSTI]

    Chibber, Karuna

    2009-01-01T23:59:59.000Z

    468-474. Roelens, K. , Verstraelen, H. , Van Egmond, K. , &1999; Roelens, Verstraelen, Van Egmond, & Temmerman, 2006),

  16. How women organize social networks different from men

    E-Print Network [OSTI]

    Szell, Michael

    2013-01-01T23:59:59.000Z

    Superpositions of social networks, such as communication, friendship, or trade networks, are called multiplex networks, forming the structural backbone of human societies. Novel datasets now allow quantification and exploration of multiplex networks. Here we study gender-specific differences of a multiplex network from a complete behavioral dataset of an online game society of about 300,000 players. On the individual level females perform better economically and are less risk-taking than males. Males reciprocate friendship requests from females faster than vice versa and hesitate to reciprocate hostile actions of females. On the network level females have more communication partners, who themselves are less connected than partners of males. We find a strong homophily effect for females and higher clustering coefficients of females in trade and attack networks. Cooperative links between males are under-represented, reflecting competition for resources among males. These results confirm quantitatively that fema...

  17. Project 2012: Increasing Female Representation in Government

    E-Print Network [OSTI]

    McLean, Lindsey

    2011-01-01T23:59:59.000Z

    Slovenia Ukraine Hungary Croatia Bosnia and Herzegovina Rep.HG) Chile (HS/HG) Croatia (HG) Finland (HS) Germany (HG)

  18. WHAT'S AHEAD IN 2014 Female Uniforms

    E-Print Network [OSTI]

    . Lightweight Navy Working Uniforms Also this spring, the Navy Uniform Matters office and the Navy Clothing uniforms made of different fabrics. If the evaluations are successful, Navy leadership will determine which served as CMC. I have 22 years of continuous Navy service that includes nine ships of various platforms

  19. -PERSPECTIVES Sexual selection by cryptic female choice

    E-Print Network [OSTI]

    Bermingham, Eldredge

    de Mexico, Apartado Postal70-275,UNAM,04510Mexico,D.F.,Mexico. Events occurring within's reproductive tract, providing lubrication, sperm nutrition, pH buffering, osmotic buffering and defenses

  20. Gender Equality and Female Empowerment Policy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently20,000 RussianBy: Thomas P. D'Agostino, Undersecretary11-161-LNGGary M.Gena E. Cadieux

  1. Maling af enzymatiske effekter med spektral billedanalyse

    E-Print Network [OSTI]

    metoden p°a glastal- lerkner. Projektet er udført i samarbejde med Novozymes. #12;ii #12;Forord Dette. Lyngby, 1. juli 2013 Kristian Ryder Thomsen #12;iv #12;Tak Tak til Novozymes, Technical Service

  2. Postnatal Testosterone Concentrations and Male Social Development

    E-Print Network [OSTI]

    Alexander, Gerianne M.

    2014-01-13T23:59:59.000Z

    :134–9. doi:10.1177/ 0963721412473755 5. Forest MG, Sizonenko PC, Cathiard AM, Bertrand J. Hypophysogonadal func- tion in humans during the first year of life: 1. Evidence for testicular activity in early infancy. J Clin Invest (1974) 53:819–28. doi:10....1172/JCI107621 6. Forest MG, Deperetii E, Bertrand J. Hypothalamic-pituitary-gonadal rela- tionships in man from birth to puberty. Clin Endocrinol (1976) 5:551–69. doi:10.1111/j.1365-2265.1976.tb01985.x 7. Andersson AM, Toppari J, Haavisto AM, Petersen JH...

  3. Molecular Mechanisms in Male Sex Determination

    E-Print Network [OSTI]

    Arboleda, Valerie Anne

    2012-01-01T23:59:59.000Z

    MLH1, MSH2, MECP2, and tyrosinase (TYR). Hum Mutat 28, 683-1 Mb upstream of SOX9 of a tyrosinase transgene resulted in

  4. Convergent evolution of chicken Z and human X chromosomes by expansion and gene acquisition

    E-Print Network [OSTI]

    Bellott, Daniel W.

    In birds, as in mammals, one pair of chromosomes differs between the sexes. In birds, males are ZZ and females ZW. In mammals, males are XY and females XX. Like the mammalian XY pair, the avian ZW pair is believed to have ...

  5. Herpetologica,56(1), 2000, 81-104 ?) 2000 by The Herpetologists' League, Inc.

    E-Print Network [OSTI]

    McGuire, Jimmy A.

    , College, Laguna 4031, Republic of the Philippines ABSTRACT: We describe a new species of wide, a translucent tympa- num in females and most males, an iridescent green dorsum with black spots or faint reticulum in males and an iridescent green to golden dorsum with distinctive brown reticulum in females

  6. Sex-based differences in gene expression in hippocampus following postnatal lead exposure

    SciTech Connect (OSTI)

    Schneider, J.S., E-mail: jay.schneider@jefferson.edu; Anderson, D.W.; Sonnenahalli, H.; Vadigepalli, R.

    2011-10-15T23:59:59.000Z

    The influence of sex as an effect modifier of childhood lead poisoning has received little systematic attention. Considering the paucity of information available concerning the interactive effects of lead and sex on the brain, the current study examined the interactive effects of lead and sex on gene expression patterns in the hippocampus, a structure involved in learning and memory. Male or female rats were fed either 1500 ppm lead-containing chow or control chow for 30 days beginning at weaning.Blood lead levels were 26.7 {+-} 2.1 {mu}g/dl and 27.1 {+-} 1.7 {mu}g/dl for females and males, respectively. The expression of 175 unique genes was differentially regulated between control male and female rats. A total of 167 unique genes were differentially expressed in response to lead in either males or females. Lead exposure had a significant effect without a significant difference between male and female responses in 77 of these genes. In another set of 71 genes, there were significant differences in male vs. female response. A third set of 30 genes was differentially expressed in opposite directions in males vs. females, with the majority of genes expressed at a lower level in females than in males. Highly differentially expressed genes in males and females following lead exposure were associated with diverse biological pathways and functions. These results show that a brief exposure to lead produced significant changes in expression of a variety of genes in the hippocampus and that the response of the brain to a given lead exposure may vary depending on sex. - Highlights: > Postnatal lead exposure has a significant effect on hippocampal gene expression patterns. > At least one set of genes was affected in opposite directions in males and females. > Differentially expressed genes were associated with diverse biological pathways.

  7. Factors influencing food selection by students in a university foodservice

    E-Print Network [OSTI]

    Clement, Camille Therese

    1989-01-01T23:59:59.000Z

    In food seleotlon considered most Important by males and females. 17 60 40 20 CV CO CO ~ MAlES Q FEMAlE SENSORy OCNVENENCE NUTRIENT KCALORIE FOOD SELECTION FACTORS RG. 3. Comparison of factors In food selection considered least Important... that I could achieve it, and the opportunity to do so. I loveyou. TABLE OF CONTENTS vl Page ABSTRACT s . o o ~ o o ~ ~ ~ o o o ~ s o e o ~ ACKNOWLEDGMENTS ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ v TABLE OF CONTENTS . . . . . . . . . . . ~ ~ ~ ~ . . vi...

  8. Seeing Stars: Female Film Stars and Female Audiences in Post-Colonial Korea

    E-Print Network [OSTI]

    Park, JaeYoon

    2008-07-29T23:59:59.000Z

    , particularly in relation to such gendered processes as decolonization (and re-colonization), modernization, democratization, and globalization....

  9. Does the gender of the professor affect the structuring of the design studio?

    E-Print Network [OSTI]

    Howard, Carolee L

    2013-02-22T23:59:59.000Z

    A large gender difference exists in the percentage of male and female students enrolled in architecture schools. Roughly one-third of architecture students are females while about half of the student population at large is female. There is also a...

  10. ORIGINAL PAPER Peacocks orient their courtship displays towards the sun

    E-Print Network [OSTI]

    Montgomerie, Bob

    ORIGINAL PAPER Peacocks orient their courtship displays towards the sun Roslyn Dakin & Robert on male orientation relative to the position of the sun. During the "wing-shaking" display, females were generally behind the displaying male, and male orientation with respect to the position of the sun

  11. Dyadic, Partner, and Social Network Influences on Intimate Partner Violence among Male-Male Couples

    E-Print Network [OSTI]

    Stephenson, Rob; Sato, Kimi Noe; Finneran, Cathrine

    2013-01-01T23:59:59.000Z

    Dyadic, Partner, and Social Network Influences on Intimateage differences, and social network characteristics ofviolence. Having social networks that contained more gay

  12. DISCRIMINATION OF CONSPECIFIC MALE MOLT ODOR SIGNALS BY MALE CRAYFISH, ORCONECTES RUSTICUS

    E-Print Network [OSTI]

    Moore, Paul A.

    for Sensory Ecology, and Department of Biological Sciences, Bowling Green State University, Bowling Green Green State University, Bowling Green, Ohio 43402, U.S.A. (e-mail: pmoore@bgnet.bgsu.edu) A B S T R A C for Neuroscience, Mind and Behavior, Laboratory for Sensory Ecology, and Department of Biological Sciences, Bowling

  13. Essays of Educational Attainment

    E-Print Network [OSTI]

    Wang, Yingning

    2010-10-12T23:59:59.000Z

    , the women who marry for money have a higher probability of finding a highly educated husband than those marrying for romance. Therefore, the reversal educational gap could be the result of more marry-for-romance women....

  14. From Domestic Farce to Abolitionist Satire: Reinhold Solger's Reframing of the Union (1860)

    E-Print Network [OSTI]

    Vanchena, Lorie A.

    2005-01-01T23:59:59.000Z

    , and to marry only with her uncle's consent. (Sterling's name, which suggests a person o f excellent character, already signals Solger's unequivocal choice o f husband for Emily.) W h e n Sterling secretly visits Emily that evening, Humdrum also arrives; like... not by Sterl ing but by S a m b o , the coachman, who climbs through a window to fetch Sally, a female slave in Olivebranch's household, and escape with her to the N o r t h ; H u m d r u m flees, only to be captured by members o f the Vig­ ilance C o m m i...

  15. Demographic analysis of the captive Asian and African elephants in North America

    E-Print Network [OSTI]

    Fraser, Susan Overman

    1983-01-01T23:59:59.000Z

    in Portland, Oregon. In wild populations of African elephants the mean calving interval ranges from 2. 9 to 9. 1 years and breeding ceases after the female reaches about 55 years of age (Laws et al. 1975). Female Asian elephants mature as early as 6 years... years for females and 11. 2 years for males with an overall average of 20. 7 years. Ages range from a 10 month old captive-born male at Portland, Oregon to a 60 year old female at Lafayette, Virginia. The modal age is 12 years and the oldest living...

  16. Scholars at the UMN Social Sciences I've been doing research

    E-Print Network [OSTI]

    Amin, S. Massoud

    Finding high-skilled, quality researchers Top Reported Outcomes Quality research, publications, growing Feedback" Survey 1498 total international scholars 85 countries represented 63.9% male, 36.1% female Top

  17. Biological Journal of the Linnean Society (2001), 73: 5163. With 8 figures doi:10.1006/bijl.2001.0523, available online at http://www.idealibrary.com on

    E-Print Network [OSTI]

    Reimchen, Thomas E.

    stickleback T. E. REIMCHEN Department of Biology, University of Victoria, PO Box 3020, Victoria, B.C., Canada Received 30 August 2000; accepted for publication 8 January 2001 Males and females can differ in levels

  18. Muteness in Organizational Computer-Mediated Communication: A Critical Study 

    E-Print Network [OSTI]

    Kissack, Heather

    2012-07-16T23:59:59.000Z

    participants were categorized for using male-preferential (MP), female-preferential (FP), or neutral (N) language. MP and FP interactions were then analyzed for themes of muting and muteness. Seven major findings within three analytic categories emerged from...

  19. J. Parasitol., 82(3), 1996, p. 409-413 ? American Society of Parasitologists 1996

    E-Print Network [OSTI]

    Schall, Joseph J.

    ,butprevalencevaried among sites. Lowest prevalenceoccurredat dry, windy sites or cool, wet mountainpeaks(0-20%);the of infections in males vs. females and in different size (=age) classes, and to search for evidence of any

  20. anaerobic ethanol producer: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    attractive to both male and female M. sutor beetles Hanks, Lawrence M. 4 Fuel-Cycle Fossil Energy Use and Greenhouse Gas Emissions of Fuel Ethanol Produced from U.S. Midwest...

  1. Gender differences in office occupant perception of indoor environmental quality (IEQ)

    E-Print Network [OSTI]

    Kim, Jungsoo; de Dear, Richard; Candido, Christhina; Zhang, Hui; Arens, Edward

    2013-01-01T23:59:59.000Z

    and potential improvements. Ergonomics. 2005;48:25-37. [8]and sensations. Applied Ergonomics. 1981;12:29-33. [21]males and females at rest. Ergonomics. 1991;34:365-78. [28

  2. Biology of Aprostocetus Hagenowii (Ratzeburg), a parasitoid of cockroaches, and insect community composition in an interiorscape

    E-Print Network [OSTI]

    Johnson, Elizabrth N.M

    1999-01-01T23:59:59.000Z

    of females and males within the petri dish. Parasitization did not occur in any oothecae placed in the rainforest pyramid during a searching study. When this experiment was run in the laboratory, one ootheca was parasitized....

  3. An experimental replica of the vocal folds to study normal and pathological voice

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    % of female teachers and 26% of male teachers reported " often or always " voice troubles [2]. Economical of a compressor connected to a large pressure reservoir filled with acoustical foam, in order to damp acoustical

  4. YEAR

    National Nuclear Security Administration (NNSA)

    1 YEAR 2014 Males 48 Females 33 PAY PLAN YEAR 2014 SES 1 EJEK 8 EN 04 10 EN 03 1 NN (Engineering) 27 NQ (ProfTechAdmin) 29 NU (TechAdmin Support) 5 YEAR 2014 American Indian...

  5. Mosquito Control Around the Home 

    E-Print Network [OSTI]

    Jackman, John A.; Olson, Jimmy K.

    2003-03-17T23:59:59.000Z

    mos- quitoes live on land and are winged. The males feed only on nectar, plant juices and other sources of liquid carbohydrates. Female mosquitoes also feed periodically on nectar, plant sap and other sources of plant carbohy- drates for energy...

  6. Research Article Signaling Threat

    E-Print Network [OSTI]

    Gross, James J.

    Research Article Signaling Threat How Situational Cues Affect Women in Math, Science and organization,canmake potentialtargetsvulnerabletosocial identity threat.Objective and subjective measuresofidentity threat were collected from male and female math, science, and engineering (MSE) majors who watched

  7. ANIMAL BEHAVIOUR, 2000, 60, 351357 doi:10.1006/anbe.2000.1459, available online at http://www.idealibrary.com on

    E-Print Network [OSTI]

    Schlupp, Ingo

    or effects of experience of the stimulus individuals; from an ethical standpoint, fewer manipulated animals can be used or predators can be simulated; and chimera stimuli can be created (e.g. a female with male

  8. The benefits of allocating sex 

    E-Print Network [OSTI]

    West, Stuart A; Herre, E Allen; Sheldon, Ben C

    2000-01-01T23:59:59.000Z

    Evolutionary biologists have developed an excellent understanding of the selective factors that shape the way that a given organism allocates resourses to male and female offspring- a process called sex allocation.

  9. YEAR

    National Nuclear Security Administration (NNSA)

    8 YEAR 2014 Males 18 Females 10 PAY PLAN YEAR 2014 SES 1 EN 05 1 EN 04 4 NN (Engineering) 12 NQ (ProfTechAdmin) 9 NU (TechAdmin Support) 1 YEAR 2014 American Indian Alaska...

  10. YEAR

    National Nuclear Security Administration (NNSA)

    5 YEAR 2014 Males 61 Females 24 PAY PLAN YEAR 2014 SES 1 EJEK 8 EN 04 22 NN (Engineering) 23 NQ (ProfTechAdmin) 28 NU (TechAdmin Support) 3 YEAR 2014 American Indian Alaska...

  11. YEAR

    National Nuclear Security Administration (NNSA)

    0 YEAR 2013 Males 48 Females 32 YEAR 2013 SES 2 EJEK 7 EN 04 11 EN 03 1 NN (Engineering) 23 NQ (ProfTechAdmin) 33 NU (TechAdmin Support) 3 YEAR 2013 American Indian Alaska...

  12. YEAR

    National Nuclear Security Administration (NNSA)

    2014 Males 81 Females 45 PAY PLAN YEAR 2014 SES 1 SL 1 EJEK 25 EN 04 26 EN 03 2 NN (Engineering) 23 NQ (ProfTechAdmin) 44 NU (TechAdmin Support) 4 YEAR 2014 American Indian...

  13. YEAR

    National Nuclear Security Administration (NNSA)

    25 Females 10 YEAR 2014 SES 1 EN 04 11 NN (Engineering) 8 NQ (ProfTechAdmin) 13 NU (TechAdmin Support) 2 YEAR 2014 American Indian Alaska Native Male (AIAN M) 0 American Indian...

  14. The effect of foot conditions on constrained standing

    E-Print Network [OSTI]

    Barlow, Jessica Marie

    1996-01-01T23:59:59.000Z

    This study was conducted to find any differences in physiological effects, subjective rankings, or discomfort with respect to foot conditions in constrained standing. Eight healthy subjects, four female and four male, stood using four different...

  15. The short-term effects of two chaining treatments on populations of Tabanus abactor Philip (Diptera: Tabanidae)

    E-Print Network [OSTI]

    Holmes, Steven Paul

    1998-01-01T23:59:59.000Z

    and white buckets in the air, both coated with Tanglefoot@ stickun-4 were used to capture adult flies and monitor their activity. Brown boards capture mostly male flies, and white buckets capture female flies almost exclusively. Chaining did...

  16. Elizabeth M. Peckham, Ph.D. Maiden Name: Lapoczka

    E-Print Network [OSTI]

    Lee, Theresa

    : "Comparison of mu-Opioid Antinociception in Male and Female Rats" Bachelor of Science, Biology 1999 Ashland University, Ashland, OH Magna Cum Laude Ashland University Presidential Scholarship Recipient APPLICABLE

  17. Evolution of gender wage gap in Peru, 1997-2000

    E-Print Network [OSTI]

    Montes, Jose L.

    2009-05-15T23:59:59.000Z

    . The wage differential due to gender, and not to differences in labor characteristics, is called discrimination. The goal of this project is to estimate the evolution of the wages differentials and wage discrimination between males and females in Peru within...

  18. Phylogenetic revision of desert fireflies (Coleoptera: Lampyridae: microphotus)

    E-Print Network [OSTI]

    Usener, Jessica LeAnn

    2006-04-12T23:59:59.000Z

    were collected at localities throughout the southwestern United States during the summer months in 2001-2003. Adult males were collected with ultraviolet light traps and pitfall traps ?baited? with light emitting diodes set up to mimic the females...

  19. Coalitions of relatives and reproductive skew in cooperatively breeding white-winged choughs

    E-Print Network [OSTI]

    Dunn, Peter O.

    . At most one member of each faction succeeded in breeding, such that skew was dependent on the number of unrelated factions, and not group size. In the new groups, dominant males and females with supporting

  20. Long-Tailed Wasps (Hymenoptera: Megalyridae) from Cretaceous and Paleogene European amber

    E-Print Network [OSTI]

    Perrichot, Vincent

    2009-08-31T23:59:59.000Z

    Fifty-two fossils of megalyrid wasps from various collections of European amber were examined. A male neotype for Prodinapsis succinalis Brues and a female neotype for P. minor Brues are designated. The two species are ...

  1. Causes and consequences of sexual selection in a wild population 

    E-Print Network [OSTI]

    Stopher, Katie Vivienne

    2011-11-24T23:59:59.000Z

    Although sexual selection in nature has been studied intensively, much is still unknown about the evolution of mating systems in wild populations: for example, how male competition and female choice interact, or the effect of environmental...

  2. Impacts of feral hogs on reclaimed surface-mined lands in eastern Texas: a management perspective

    E-Print Network [OSTI]

    Mersinger, Robert C.

    1999-01-01T23:59:59.000Z

    lignite mines. In addition to vegetative losses, erosion control problems and water quality impacts have been noted. Box and corral traps were evaluated for their effectiveness in capturing feral hogs. Six male and 10 female hogs were radiomonitored from...

  3. ORIGINAL PAPER Tests of the harassment-reduction function

    E-Print Network [OSTI]

    Fincke, Ola M.

    genetic variation in natural populations (reviewed by Allen 1988; Cook 2003; see also Gigord et al. 2001;protection from solar radiation (Cooper 2010), and male mate preference (reviewed by Kunte 2009). In female

  4. Volunteer Bias in Sex Research: The effect of recruitment material on demographics, personality, impression management, sociosexuality, sexual desire and preoccupation 

    E-Print Network [OSTI]

    Hope, David

    2008-11-10T23:59:59.000Z

    The study investigated volunteer bias in sex research across different measures in an online anonymous environment. 108 participants (79 female, 29 male) participated, completing one of two versions. Version A participants ...

  5. Method of installing subsurface barrier

    DOE Patents [OSTI]

    Nickelson, Reva A. (Shelley, ID); Richardson, John G. (Idaho Falls, ID); Kostelnik, Kevin M. (Idaho Falls, ID); Sloan, Paul A. (Rigby, ID)

    2007-10-09T23:59:59.000Z

    Systems, components, and methods relating to subterranean containment barriers. Laterally adjacent tubular casings having male interlock structures and multiple female interlock structures defining recesses for receiving a male interlock structure are used to create subterranean barriers for containing and treating buried waste and its effluents. The multiple female interlock structures enable the barriers to be varied around subsurface objects and to form barrier sidewalls. The barrier may be used for treating and monitoring a zone of interest.

  6. Method of sealing casings of subsurface materials management system

    DOE Patents [OSTI]

    Nickelson, Reva A.; Richardson, John G.; Kostelnik, Kevin M.; Sloan, Paul A.

    2007-02-06T23:59:59.000Z

    Systems, components, and methods relating to subterranean containment barriers. Laterally adjacent tubular casings having male interlock structures and multiple female interlock structures defining recesses for receiving a male interlock structure are used to create subterranean barriers for containing and treating buried waste and its effluents. The multiple female interlock structures enable the barriers to be varied around subsurface objects and to form barrier sidewalls. The barrier may be used for treating and monitoring a zone of interest.

  7. Subsurface materials management and containment system, components thereof and methods relating thereto

    DOE Patents [OSTI]

    Nickelson, Reva A.; Richardson, John G.; Kostelnik, Kevin M.; Sloan, Paul A.

    2006-04-18T23:59:59.000Z

    Systems, components, and methods relating to subterranean containment barriers. Laterally adjacent tubular casings having male interlock structures and multiple female interlock structures defining recesses for receiving a male interlock structure are used to create subterranean barriers for containing and treating buried waste and its effluents. The multiple female interlock structures enable the barriers to be varied around subsurface objects and to form barrier sidewalls. The barrier may be used for treating and monitoring a zone of interest.

  8. Subsurface materials management and containment system

    DOE Patents [OSTI]

    Nickelson, Reva A.; Richardson, John G.; Kostelnik, Kevin M.; Sloan, Paul A.

    2006-10-17T23:59:59.000Z

    Systems, components, and methods relating to subterranean containment barriers. Laterally adjacent tubular casings having male interlock structures and multiple female interlock structures defining recesses for receiving a male interlock structure are used to create subterranean barriers for containing and treating buried waste and its effluents. The multiple female interlock structures enable the barriers to be varied around subsurface objects and to form barrier sidewalls. The barrier may be used for treating and monitoring a zone of interest.

  9. The evolution of sex ratio distorter suppression impacts across a 25cM genomic region

    E-Print Network [OSTI]

    Hornett, E. A.; Moran, B.; Reynolds, L. A.; Charlat, S.; Tazzyman, S.; Wedell, N.; Jiggins, C. D.; Hurst, G. D. D.

    2014-01-01T23:59:59.000Z

    transcriptome sequencing (see Methods and 121 Materials, NCBI SRA accession: SRP045735). These markers were then tested for co-segregation 122 with suppression in order to identify the linkage groups associated with male host survival. Female 123 butterflies... assembler to create the first set of Expressed Sequence Tags (EST) for H. bolina. The 488 trimmed reads have been deposited as one male, and one female, partial transcriptome datasets in 489 the NCBI SRA database, accession SRP045735. 490 491...

  10. Subsurface materials management and containment system

    DOE Patents [OSTI]

    Nickelson, Reva A.; Richardson, John G.; Kosteinik, Kevin M.; Sloan, Paul A.

    2004-07-06T23:59:59.000Z

    Systems, components, and methods relating to subterranean containment barriers. Laterally adjacent tubular casings having male interlock structures and multiple female interlock structures defining recesses for receiving a male interlock structure are used to create subterranean barriers for containing and treating buried waste and its effluents. The multiple female interlock structures enable the barriers to be varied around subsurface objects and to form barrier sidewalls. The barrier may be used for treating and monitoring a zone of interest.

  11. Systems Engineering Perspective

    E-Print Network [OSTI]

    Graduate ---Technically Broad ---Business Sensitive Married ---With Children Three Year Tour ---First Year

  12. Sensational and Sensual: Monstrous Birth Broadsides and Female Readership

    E-Print Network [OSTI]

    Walker, Paige M.

    2013-01-01T23:59:59.000Z

    Monsters, to wyt, Of a Popish Asse which was found at RomeMonsters, to wyt, Of a Popish Asse which was found at Rome

  13. Female physicists lead the way on Jefferson Lab experiment |...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    is a career field full of opportunities for women. He describes the field as gender blind - one where women and men are equally recognized for their knowledge and their work....

  14. adult female mosquito: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Restoration Websites Summary: , dry ponds, and infiltration devices, such as sand filters. Mosqui- toes were nearly as likely number of mosquito species. Informal...

  15. adult female weddell: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Schller, Myriam 2007-01-01 34 Provenance and glacial history of very fine quartz sand from the Weddell Sea, Antarctica Texas A&M University - TxSpace Summary: December 1988...

  16. The Bars That Bound Me: A Study of Female Parolees

    E-Print Network [OSTI]

    D'Auria, Stephanie Chauntel

    2010-01-01T23:59:59.000Z

    W. Mullins. 2006. “Taking Stock: The Status of FeministPp. 217-249 in Taking Stock: The Status of Criminological

  17. aged female mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    adrenalectomy had no obvious effect on the Tzu-ping Lin; Raphael C. Guzman; Rebecca C. Osborn; Et Al; Cancer Res; Contact The Aacr Publications; Mammary Hyperplasia; Wnt-...

  18. adolescent female athletes: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mines Athletic Center 12; Site Creek Athletic Complex Marv Kay Stadium at Campbell Field Mines Athletic Center 12;Mines Master Plan Kay Stadium at Campbell Field Mines...

  19. arthropod exposed female: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Recovery of Salt Marsh Arthropod Communities following BP Deepwater Horizon Oil Spill Environmental Sciences and Ecology Websites Summary: .S. Gulf of Mexico is a hub...

  20. Mechanical properties of normotensive and hypertensive female rat carotid arteries

    E-Print Network [OSTI]

    Smith, Katherine Elizabeth

    2002-01-01T23:59:59.000Z

    drawing of the layers of the arterial wall (IM, an A denote iniima, media, and adventitia, respectively); B. Cross-sectional muscular artery histology (The Elebrew University of Jerusalem, 1997) Tortuous inner layer is the internal elastic lamina, which... divides the intima and the media. The darker middle layer with circumferentially oriented smooth muscle cells is the media, and lighter outer layer is the adventitia. d This thesis follows the style and format of Journal of Biomechanics. constantly...

  1. Adult Female English Language Learners: Investment, Identity and Benefits

    E-Print Network [OSTI]

    Wharton, Anna

    2013-07-31T23:59:59.000Z

    appreciated. Third, I thank everyone who helped me throughout my research: Dr. Bonny Norton and Dr. Ellen Skilton-Sylvester for their kind correspondences; the teams at iRIS and the IRB; Kerri Smith in the TLAC office; and the lovely people from... past surface motivation to investigating language investment and how a learner?s identity and learning experience interface, and the effect that each has on the other. Since the birth of Norton Peirce?s (1995) notion of investment, studies have...

  2. Reproduction of female spiny dogfish, Squalus acanthias, in the Oslofjord

    E-Print Network [OSTI]

    , acteristic spine in front of each dorsal 1972; Nammack et al., 1985). fin. Its dorsal side is grayish and has periods of any living is a relatively small shark with a char- vertebrate (up to 24 months) (Ketchen This shark, like other sharks, is very sporadic white spots. Although it may susceptible to overfishing

  3. TRIUMAH 2012 RESULTS FEMALES BY AGE * distance measured in miles

    E-Print Network [OSTI]

    Amin, S. Massoud

    .730 2.550 12.007 4049 Ridler Kris 1.273 7.360 3.340 11.973 4049 Jensen Rachel 0.258 7.630 3.630 11.606 6.920 1.960 9.486 4049 Reitz Melanie 0.424 6.520 2.250 9.194 4049 Johnson Lisa 0.652 6.220 2.030 8

  4. Unpacking Adaptation: The Female Inheritance Movement in Hong Kong

    E-Print Network [OSTI]

    Stern, Rachel E.

    2005-01-01T23:59:59.000Z

    with critiques of feudalism. During the rally outside theStandard, 14 Oct. 1993). Feudalism, a term asso- ciated withand patri- archy. 28 Anti-feudalism was the theme of the May

  5. Molecular Aspects of the Regulation of Female Sexual Behavior

    E-Print Network [OSTI]

    Christensen, Amy

    2012-01-01T23:59:59.000Z

    1999). When ?-END was infused into the ventricles around thesiRNA against CAV1 was infused into the ARH (Chapter 2).polymerization inhibitor, was infused into the medial basal

  6. affects female sexual: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    desire, arousal, orgasmic and sex pain disorders (dyspareunia and vaginismus). Primary care physicians must assume a proactive role in the diagnosis and treatment of these...

  7. active young females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Consumer Vulnerability in the Web Physics Websites Summary: Vulnerability in the Web 2.0 Society Abstract The young consumers constitute one of the fastest growing Internet:...

  8. Swift's beautiful nymphs: an attack on the pastoral female image

    E-Print Network [OSTI]

    McClain, Richard Daniel

    1974-01-01T23:59:59.000Z

    , Byzantine, and even Arabic influences have been susoect- ed Another theory is that courtly love evolved from a mixing of Cathar and troubadour religious philosophies. The first French trou'oadour of wl om there is record, states Perry, is William...

  9. Molecular Aspects of the Regulation of Female Sexual Behavior

    E-Print Network [OSTI]

    Christensen, Amy

    2012-01-01T23:59:59.000Z

    from Charles River (Portage, MI). Upon arrival, rats werepurchased (Charles River, Portage, MI). Upon arrival, rats

  10. Polarization signaling in swordtails alters female mate preference

    E-Print Network [OSTI]

    Cummings, Molly E.

    of Texas at Austin, Austin, TX 78712; and b Advanced Sensors Research Laboratory, Department of Computer aquatic and terrestrial environments. Documentation of inverte- brate use of polarized light is widespread behavior, and thus function as a signal, in the butterfl

  11. Choosy But Not Chaste: Multiple Mating in Human Females

    E-Print Network [OSTI]

    Scelza, BA

    2013-01-01T23:59:59.000Z

    York: Oxford University Press. 12 Buss DM, Schmitt DP. 1993.13 Schmitt DP, Shackelford TK, Buss DM. 2001. Are men really60:145–164. 74 Greiling H, Buss DM. 2000. Women’s sexual

  12. affecting female fertility: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    area is to apply 50 pounds per acre Edward J. Deibert 227 Switchgrass as an Energy Crop: Fertilization, Cultivar, and Cutting Management. Open Access Theses and Dissertations...

  13. Female Scientists, Engineers Open Students' Eyes to Career Options |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the YouTube|6721Energy 3_adv_battery.pdf MoreEnergyAugustof

  14. This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research

    E-Print Network [OSTI]

    Yosibash, Zohar

    observations on two fresh frozen femurs (harvested from a 30 year old male and 21 year old female). Herein, we femur of a 54 year old female was scanned under two different environments: in air and immersed in water's modulus was represented in the FE model using two different methods, directly extracted from the CT data

  15. Genetic models with reduced penetrance related to the Y

    E-Print Network [OSTI]

    Sekhon, Jasjeet S.

    disease and congestive heart failure when taken to high altitudes. Data on 966 calves at a ranch correlation (-0.01) between sire PAP and female calf PAP; the dam to male calf and dam to female calf Alexander and Will (1963)), pulmonary heart disease and congestive heart failure when taken to high

  16. BRIEF COMMUNICATIONS First record of Chromogobius britoi (Teleostei

    E-Print Network [OSTI]

    islands. Additional specimens from the Canary Islands are also included in this comparison. Four females in the area. One female, one male and one juvenile were captured in the Canary Islands, at Tenerife (Los, under the catalogue numbers MOPNA 597­599. Two of the specimens from the Canary Islands were collected

  17. AMPHETAMINE EFFECTS IN MICROTINE RODENTS: A COMPARATIVE STUDY USING MONOGAMOUS AND PROMISCUOUS VOLE SPECIES

    E-Print Network [OSTI]

    Wang, Zuoxin

    dopamine after am- phetamine treatment than did promiscuous voles. We then examined whether amphetamine: mating system, pair-bond, dopamine, nucleus accumbens, addiction, microdialysis. The genus Microtus promiscuous mating sys- tems and only females provide parental care. In these species, males and females

  18. Condition and brightness of structural blue-green: motmot tail-racket brightness is related to speed of

    E-Print Network [OSTI]

    Murphy, Troy G.

    to speed of feather growth in males, but not in females TROY G. MURPHY* and TIFFANY T. PHAM Trinity University, Department of Biology, One Trinity Place, San Antonio, TX 78212, USA Received 21 November 2011, whereas female traits are maintained by different selective*Corresponding author. E-mail: troy.murphy@trinity

  19. Discriminating between Cuvier's (Ziphius cavirostris) and Blainville's (Mesoplodon densirostris) beaked whales in Hawai`i

    E-Print Network [OSTI]

    Baird, Robin W.

    flat back when viewed from behind or in front, while Blainville's are more peaked. The dorsal fin/gray around the dorsal fin. Females have more uniform buff/brown colored bodies. The body of Blainville cookie-cutter sharks. Z. cavirostris adult male © G.S. Schorr 2004 M. densirostris adult male (top) © R

  20. MARINE ECOLOGY PROGRESS SERIES Mar Ecol Prog Ser

    E-Print Network [OSTI]

    Bortolotti, Gary R.

    of Patagonia in 2000 and 2001. Individuals from South Georgia showed lower 13 C and 15 N values than those in Patagonia, as expected from the more pelagic location and the short length of the Antarctic food web. Males and crustaceans. However, males from Patagonia showed significantly higher 15 N and 13 C values than females did

  1. Malignant melanoma...133 Chapter 12

    E-Print Network [OSTI]

    Paxton, Anthony T.

    NICR/NCRI Malignant melanoma...133 Chapter 12: Malignant melanoma (C43) KEY FINDINGS - INCIDENCE During 2000-2004 incidence rates for melanoma increased with increasing affluence. o Male incidence rates and 60 female deaths from malignant melanoma in Ireland. o Among males mortality rates increased

  2. Cornell University, Office of Sponsored Programs Awards Received in May 2010

    E-Print Network [OSTI]

    Danforth, Bryan Nicholas

    YAN-CHE MOLECULAR BIO-E DHHS (NIH) GENETIC ANALYSIS OF MALE X FEMALE INTERACTION IN MALE DROSOPHILA) CHEMISTRY OF LITHIUM ENOLATES $309,412 AJP 59731 CORDES, JAMES M CRSR JPL DRDF - DEVELOPING RADIO ARRAY MATERIALS WORLD NETWORK: QUANTUM ELECTRO- MECHANICAL PROPERTIES IN GRAPHENE $180,000 TJC 57849 CRANE, BRIAN

  3. 2013 Re-Entry Awards Omar Moreno & Andy Kuhl

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    2013 Re-Entry Awards Omar Moreno & Andy Kuhl Most Valuable Players #12;2013 Re-Entry Awards Carena Church Female Silver Slugger Award #12;2013 Re-Entry Awards Nicholas "Yahoo" Yaholkovsky Male Silver Slugger Award #12;2013 Re-Entry Awards Andy Kuhl Male Gold Glove Award #12;2013 Re-Entry Awards Laurie

  4. Male Humour Use and Its Effect on Desirability in Women 

    E-Print Network [OSTI]

    Brown, Alexa J

    2007-01-01T23:59:59.000Z

    It is quickly coming to be accepted in our society that a sense of humour is a desirable trait in men. While there are a relatively small number of studies in the area, those looking at humour have found strong correlations ...

  5. The value of ureterocolostomy in the male Felis domestica

    E-Print Network [OSTI]

    Beamer, Russell James

    1958-01-01T23:59:59.000Z

    to form a calculus. The presence of this mucoprotein has been shown in all types of calcific renal calculi except calcium oxalate. The data compi. led by chess investigators indicated that once a calculus had passed or was removed, recurrence usually... in the dog and cat are composed of uric acid or urates, encomium magnesium phosphate, calcium phosphate, calcium phosphate, calcium carbonate, calcium oxalate, or cystine. The triple phosphates, carbonates, and amorphous uraCes are precipitated...

  6. australian males induced: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sciences Websites Summary: AUSTRALIAN UNIVERSITIES QUALITY AGENCY Report of an Audit of Swinburne; AUQA Audit Report Number 61 ISBN 978 1 877090 90 5 Australian...

  7. adult male volunteers: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ecosystems; Home Horticulture; Forest Resources; Food Safety, Health, Nutrition; Sustainable Living; Money Matters; 4-H YouthVolunteers Giving (FY 2013) Recent donors...

  8. ORIGINAL PAPER Determinants of male reproductive success in American

    E-Print Network [OSTI]

    Creel, Scott

    & Scott R. Creel & Steven T. Kalinowski & Ninh V. Vu & Howard B. Quigley Received: 4 December 2008. Costello :H. B. Quigley Hornocker Wildlife Institute and Wildlife Conservation Society, 301 N Wilson@bresnan.net Present Address: H. B. Quigley Panthera, PO Box 11363, Bozeman, MT 59719, USA Behav Ecol Sociobiol DOI 10

  9. ORIGINAL PAPER Determinants of male reproductive success in American

    E-Print Network [OSTI]

    Kalinowski, Steven T

    & Scott R. Creel & Steven T. Kalinowski & Ninh V. Vu & Howard B. Quigley Received: 4 December 2008. 2002). Communicated by: M. Festa-Bianchet C. M. Costello :H. B. Quigley Hornocker Wildlife Institute, Manhattan, MT 59741, USA e-mail: ccostello@bresnan.net Present Address: H. B. Quigley Panthera, PO Box 11363

  10. The Russian Male Macho Register and Performances of Masculinity

    E-Print Network [OSTI]

    Garey, Amy

    2011-01-01T23:59:59.000Z

    Press. Dave, Bhavna 2007 Kazakhstan: Ethnicity, Language andAstana.kz” from Astana, Kazakhstan spoofed an interactions relationship with Kazakhstan and a reversal of ethnic

  11. adolescent males performing: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19 Cognitive skills and literacy performance of Chinese adolescents with and without dyslexia CiteSeer Summary: The Author(s) 2010. This article is published with open access...

  12. adult male spring: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: and Laplace transforms. Fundamentals of AC power, coupled inductors (transformers), and two-port networks Spring break Apr. 04 Spring breakApr. 04 Spring break...

  13. High prevalence of hypothyroidism in male patients with cutaneous melanoma

    E-Print Network [OSTI]

    Shah, Monica; Orengo, Ida F; Rosen, Ted

    2006-01-01T23:59:59.000Z

    releasing hormone by human melanoma and nevi. Clin Cancerpatients with cutaneous melanoma. Oncol Rep 2003 Sep-Oct;in patients with uveal melanoma. Melanoma Res 2001 Dec;11(

  14. The annual behavioral cycle of male white-tailed deer

    E-Print Network [OSTI]

    Brown, Bennett A

    1971-01-01T23:59:59.000Z

    to gather information on the behavior of free ranging h' - ll d d (Qd il ~Mi t L) d d the Rob and Bessie Welder Wildlife Refuge in San patricia County, Texas, from June 1, 1969 through August 22, 1970. The study yielded data on gross behavior patterns..., advice, and encourage- ment at the times when each was most needed. Dr. Earnest D. Ables and Dr, John J. Sperry both contributed to the project beyond their functions as members of my graduate comsd. ttee. The Rob and Bessie Welder Wildlife Foundation...

  15. A genetic study of partial male sterility in sorghum

    E-Print Network [OSTI]

    Holland, Richard Franklin

    1952-01-01T23:59:59.000Z

    fertiliestioa ia the pmr plant (undrape~a ~sor um, Brot. ) Iadia Dept. kgr ~ Nea. , Bot. Ser. 6 (201) 216. Jones, D. P. , 1950. The interrelation of plasmagsnes snd chrome" genes in pollen production ia maine Qen. 35: 507-512. and H. L. Everett, 1949...

  16. Exploitative male mating strategies: Personality, mating orientation, and relationship status

    E-Print Network [OSTI]

    Pillow, Jonathan

    M.G. Lewis a, , Judith A. Easton a , Cari D. Goetz a , David M. Buss a a The University of Texas, deceived, coerced, or forced into having sex (Buss & Duntley, 2008). Recent research indicates men can, and are sexually attracted to women exhibiting these cues (Goetz, Easton, Lewis, & Buss, 2011). Ancestrally

  17. The evolution of parental care in insects: a test of current hypotheses

    E-Print Network [OSTI]

    Gilbert, James D. J.; Manica, Andrea

    2015-04-30T23:59:59.000Z

    mating system of resource-defense polygyny, for exam- ple, in some thrips (e.g., Hoplothrips spp.; Crespi 1986, 1988), were treated as male care (see, e.g., Tallamy 2001; Costa 2006); however, guarding of ovipositing mates from other males, for ex- ample... 1997), or (2) species where costs to males of searching for additional females are prohibitive, such as Hemilepistus isopods (Shachak 1980). Many of these ecological conditions are met si- multaneously in species breeding on rare, defensible “bonanza...

  18. Population size and contaminant exposure of bats using caves on Fort Hood Military Base

    E-Print Network [OSTI]

    Land, Tarisha Ann

    2001-01-01T23:59:59.000Z

    Female Male Female Male Female Reproductive Data Lactatin 22 Each sample was placed in a chemically cleaned glass jar and sealed with paraffin tape and transported to GERG for analysis. RESULTS Residue values listed as I = &mdl, I... in the United States since 1986, prior to which it was used as a pesticide to control insects, rodents, and birds. Compared to other organochlorines, endrin has a relatively short half-life in tissues of mammals (Cole et aL 1970, Brooks 1974). Lethal endrin...

  19. Seasonal movement, home range, and habitat use of river otter in Southeastern Texas

    E-Print Network [OSTI]

    Foy, Michael Kerry

    1984-01-01T23:59:59.000Z

    Adult 208 54 a Season 6. 09 0. 0006 Winter 28 114 a Spring Summer 20 132 51 b 42 b Fall 122 60 b Diel Period Morning crepuscular 48 90 a 2. 62 0. 0503 Day 79 54 b Evening crepuscular 67 47 b Night 108 49 b 1 Means with the same letter... with decreasing temperature. Male home ranges averaged 400 ha while females averaged 295 ha. A significant difference between male and female home range size could be shown only when data for 1 old female was removed from the analysis. This animal was thought...

  20. Photovoltaic module kit including connector assembly for non-penetrating array installation

    DOE Patents [OSTI]

    Botkin, Jonathan (El Cerrito, CA); Graves, Simon (Berkeley, CA); Danning, Matt (Oakland, CA); Culligan, Matthew (Berkeley, CA)

    2011-11-22T23:59:59.000Z

    A PV module kit for non-penetrating rooftop installation, including a plurality of PV modules and a plurality of connectors. Each of the PV modules includes a PV laminate and a frame forming a mounting region assembled thereto. The connectors include a male connector having a male fastener extending from a head, and a female connector having a female fastener assembled within a head. The heads are entirely formed of plastic. The kit provides a mounted array state including a junction at which the mounting region of at least two of the PV modules are aligned and interconnected by engagement of the male connector with the female connector. The so-formed junction is substantially electrically insulated. The plurality of connectors can further include a spacer connector including a head forming a bore sized to slidably receive the male fastener, with all of the connector heads being identical.

  1. Photovoltaic module kit including connector assembly for non-penetrating array installation

    DOE Patents [OSTI]

    Botkin, Jonathan; Graves, Simon; Danning, Matt; Culligan, Matthew

    2012-10-23T23:59:59.000Z

    A PV module kit for non-penetrating rooftop installation, including a plurality of PV modules and a plurality of connectors. Each of the PV modules includes a PV laminate and a frame forming a mounting region assembled thereto. The connectors include a male connector having a male fastener extending from a head, and a female connector having a female fastener assembled within a head. The heads are entirely formed of plastic. The kit provides a mounted array state including a junction at which the mounting region of at least two of the PV modules are aligned and interconnected by engagement of the male connector with the female connector. The so-formed junction is substantially electrically insulated. The plurality of connectors can further include a spacer connector including a head forming a bore sized to slidably receive the male fastener, with all of the connector heads being identical.

  2. Photovoltaic module kit including connector assembly for non-penetrating array installation

    DOE Patents [OSTI]

    Botkin, Jonathan; Graves, Simon; Danning, Matt; Culligan, Matthew

    2013-12-31T23:59:59.000Z

    A PV module kit for non-penetrating rooftop installation, including a plurality of PV modules and a plurality of connectors. Each of the PV modules includes a PV laminate and a frame forming a mounting region assembled thereto. The connectors include a male connector having a male fastener extending from a head, and a female connector having a female fastener assempbled within a head. The heads are entirely formed of plastic. The kit provides a mounted array state including a junction at which the mounting regions of at least two of the PV modules are aligned and interconnected by engagement of the male connector with the female connector. The so-formed junction is substantially electrically insulated. The plurality of connectors can further include a spacer connector including a head forming a bore sized slidably receive the male fastener, with all of the connector heads being identical.

  3. Duct joining system

    DOE Patents [OSTI]

    Proctor, John P. (44 Glen Dr., Fairfax, CA 94930); deKieffer, Robert C. (Boulder, CO)

    2001-01-01T23:59:59.000Z

    A duct joining system for providing an air-tight seal and mechanical connection for ducts and fittings is disclosed. The duct joining system includes a flexible gasket affixed to a male end of a duct or fitting. The flexible gasket is affixed at an angle relative to normal of the male end of the duct. The female end of the other duct includes a raised bead in which the flexible gasket is seated when the ducts are properly joined. The angled flexible gasket seated in the raised bead forms an air-tight seal as well as fastens or locks the male end to the female end. Alternatively, when a flexible duct is used, a band clamp with a raised bead is clamped over the female end of the flexible duct and over the male end of a fitting to provide an air tight seal and fastened connection.

  4. Duct Joining System

    DOE Patents [OSTI]

    Proctor, John P. (Fairfax, CA)

    2001-02-27T23:59:59.000Z

    A duct joining system for providing an air-tight seal and mechanical connection for ducts and fittings is disclosed. The duct joining system includes a flexible gasket affixed to a male end of a duct or fitting. The flexible gasket is affixed at an angle relative to normal of the male end of the duct. The female end of the other duct includes a raised bead in which the flexible gasket is seated when the ducts are properly joined. The angled flexible gasket seated in the raised bead forms an air-tight seal as well as fastens or locks the male end to the female end. Alternatively, when a flexible duct is used, a band clamp with a raised bead is clamped over the female end of the flexible duct and over the male end of a fitting to provide an air tight seal and fastened connection.

  5. Sex-specific differences in hyperoxic lung injury in mice: Implications for acute and chronic lung disease in humans

    SciTech Connect (OSTI)

    Lingappan, Krithika, E-mail: lingappa@bcm.edu [Department of Pediatrics, Section of Neonatology, Texas Children's Hospital, Baylor College of Medicine, 1102 Bates Avenue, MC: FC530.01, Houston, TX 77030 (United States); Jiang, Weiwu; Wang, Lihua; Couroucli, Xanthi I. [Department of Pediatrics, Section of Neonatology, Texas Children's Hospital, Baylor College of Medicine, 1102 Bates Avenue, MC: FC530.01, Houston, TX 77030 (United States); Barrios, Roberto [Department of Pathology and Genomic Medicine, The Methodist Hospital Physician Organization, 6565 Fannin Street, Suite M227, Houston, TX 77030 (United States); Moorthy, Bhagavatula [Department of Pediatrics, Section of Neonatology, Texas Children's Hospital, Baylor College of Medicine, 1102 Bates Avenue, MC: FC530.01, Houston, TX 77030 (United States)

    2013-10-15T23:59:59.000Z

    Sex-specific differences in pulmonary morbidity in humans are well documented. Hyperoxia contributes to lung injury in experimental animals and humans. The mechanisms responsible for sex differences in the susceptibility towards hyperoxic lung injury remain largely unknown. In this investigation, we tested the hypothesis that mice will display sex-specific differences in hyperoxic lung injury. Eight week-old male and female mice (C57BL/6J) were exposed to 72 h of hyperoxia (FiO{sub 2} > 0.95). After exposure to hyperoxia, lung injury, levels of 8-iso-prostaglandin F{sub 2} alpha (8-iso-PGF 2?) (LC–MS/MS), apoptosis (TUNEL) and inflammatory markers (suspension bead array) were determined. Cytochrome P450 (CYP)1A expression in the lung was assessed using immunohistochemistry and western blotting. After exposure to hyperoxia, males showed greater lung injury, neutrophil infiltration and apoptosis, compared to air-breathing controls than females. Pulmonary 8-iso-PGF 2? levels were higher in males than females after hyperoxia exposure. Sexually dimorphic increases in levels of IL-6 (F > M) and VEGF (M > F) in the lungs were also observed. CYP1A1 expression in the lung was higher in female mice compared to males under hyperoxic conditions. Overall, our results support the hypothesis that male mice are more susceptible than females to hyperoxic lung injury and that differences in inflammatory and oxidative stress markers contribute to these sex-specific dimorphic effects. In conclusion, this paper describes the establishment of an animal model that shows sex differences in hyperoxic lung injury in a temporal manner and thus has important implications for lung diseases mediated by hyperoxia in humans. - Highlights: • Male mice were more susceptible to hyperoxic lung injury than females. • Sex differences in inflammatory markers were observed. • CYP1A expression was higher in females after hyperoxia exposure.

  6. Toxicology Studies on Lewisite and Sulfur Mustard Agents: Modified Dominant Lethal Study of Sulfur Mustard in Rats Final Report

    SciTech Connect (OSTI)

    Sasser, L. B.; Cushing, J. A.; Kalkwarf, D. R.; Buschbom, R. L.

    1989-05-01T23:59:59.000Z

    Occupational health standards have not been established for sulfur mustard (HD) [bis{2-chloroethyl)-sulfide) ' a strong alkylating agent with known mutagenic properties. Little, however, is known about the mutagenic activity of HD in mammalian species and data regarding the dominant lethal effects of HD are ambiguous. The purpose of this study was to determine the dominant lethal effect in male and female rats orally exposed to HD. The study was conducted in two phases; a female dominant lethal phase and a male dominant lethal phase. Sprague-Dawley rats of each sex were administered 0.08, 0.20, or 0.50 mg/kg HD in sesame oil 5 days/week for 10 weeks. For the female phase, treated or untreated males were mated with treated females and their fetuses were evaluated at approximately 14 days after copulation. For the male dominant lethal phase, treated males cohabited with untreated femal (during 5 days of each week for 10 weeks) and females were sacrificed for fetal evaluation 14 days after the midweek of cohabitation during each of the 10 weeks. The appearance and behavior of the rats were unremarkable throughout the experiment and there were no treatment-related deaths. Growth rates were reduced in both female and male rats treated with 0.50 mg/kg HD. Indicators of reproductive performance did not demonstrate significant female dominant lethal effects, although significant male dominant lethal effects were observed at 2 and 3 week post-exposure. These effects included increases of early fetal resorptions and preimplantation losses and decreases of total live embryo implants. These effects were most consistently observed at a dose of 0.50 mg/kg, but frequently occurred at the lower doses. Although no treatment-related effects on male reproductive organ weights or sperm motility were found, a significant increase in the percentage of abnormal sperm was detected in males exposed to 0. 50 mg/kg HD. The timing of these effects is consistent with an effect during the postmeiotic stages of spermatogenesis, possibly involving the generally sensitive spermatids.

  7. THE MATHEMATICAL ART OF TILING LunchMaths seminar

    E-Print Network [OSTI]

    Do, Norman

    to have enough women to marry. Answer If every group of men has enough women to marry and vice versa are men and white squares are women. #12;Dominoes on a checkerboard Question When can you tile a mutilated checkerboard with dominoes? × × × × × × Black squares are men and white squares are women. We want to marry

  8. Biol. Lett. (2008) 4, 7577 doi:10.1098/rsbl.2007.0538

    E-Print Network [OSTI]

    Helle, Samuli

    2008-01-01T23:59:59.000Z

    their fitness by marrying women approximately 15 years younger and vice versa. However, most couples failed Evolutionary biology Marrying women 15 years younger maximized men's evolutionary fitness in historical Sami for correspondence (sayrhe@utu.fi). Most men marry younger women. This has been attributed to men selecting young

  9. METHODOLOGY AND APPLICATIONS IN IMPUTATION, FOOD CONSUMPTION AND OBESITY RESEARCH

    E-Print Network [OSTI]

    Kyureghian, Gayaneh

    2010-07-14T23:59:59.000Z

    population of 15+ years of age Figure 2.2 The proportion of obese US male and female population of 15+ years of age 64 66 68 70 72 74 76 78 80 82 2002 2005 2010 Pe rce ntage Year Overweight Males OverweightFemales 0 10 20 30 40 50 2002 2005 2010 Pe... Aggregation Model 2 Level Aggregation Model 3 Level Aggregation Full Service Restaurant (FS) R = 0.0702 r = 0.3986 Quick Service Restaurant (QS) R = 0.1059 r = 0.6014 Foods Consumed Away From Home (FAFH) R = 0.1761 Total Number...

  10. Thyroid function in the desert tortoise, Gopherus agassizii 

    E-Print Network [OSTI]

    Kohel, Kathryn Anne

    1994-01-01T23:59:59.000Z

    of most intense feeding, nesting, and mating behaviors. Hibernation occurred from mid-October to mid-March. Male testosterone ranged from 18. 37 ng/ml to 243. 60 ng/ml. Female testosterone ranged from 0. 37 ng/ml to 6. 22 ng/ml (Rostal et al. , 1994... 1993. Points represent means + s. e. for each month. Numbers above error bars represent the number of animals sampled at each date, . . . . . 22 Comparison of female to male T4 annual cycles from August 1991 to August 1993. Points represent means i...

  11. Photovoltaic module and interlocked stack of photovoltaic modules

    SciTech Connect (OSTI)

    Wares, Brian S.

    2014-09-02T23:59:59.000Z

    One embodiment relates to an arrangement of photovoltaic modules configured for transportation. The arrangement includes a plurality of photovoltaic modules, each photovoltaic module including a frame. A plurality of individual male alignment features and a plurality of individual female alignment features are included on each frame. Adjacent photovoltaic modules are interlocked by multiple individual male alignment features on a first module of the adjacent photovoltaic modules fitting into and being surrounded by corresponding individual female alignment features on a second module of the adjacent photovoltaic modules. Other embodiments, features and aspects are also disclosed.

  12. A Decade of Population Change in Texas.

    E-Print Network [OSTI]

    Skrabanek, R. L.

    1963-01-01T23:59:59.000Z

    of community facilities. The political representation of rural dwellers is also likely to be reduced. 3. In 1960, for the first time in history, Texas had more females than males. The projected sex ratio is 96.7 males per 100 females in 1970. At the same... of the Panhandle and extending southward beyond Abilene. This area sustained a decline of one-third in rural population during the decade. Only 2 of the 29 counties (Cottle and Donley) in area 6 had an increase in rural population. Another section, state...

  13. INTRODUCTION Parkinson's disease (PD) is characterized pathologically by the

    E-Print Network [OSTI]

    Diggle, Peter J.

    females, with an average age of 61.45 years (youngest 42, oldest 75). Gender (male/female) 23/9 Hoehn & Yahr 1.0 5 Hoehn & Yahr 1.5 3 Hoehn & Yahr 2.0 24 Median PD onset age (years (interquartile range)) 61. Gender; 4.Current drug treatment for PD; 5. Hoehn & Yahr score; 6. Family history of PD; 7. Familial

  14. Coyote and bobcat use of a south Texas ranch: and the effects of brush management

    E-Print Network [OSTI]

    Edwards, Lisa Carole

    1987-01-01T23:59:59.000Z

    August 1986. Composite home range sizes, based on 95'Yo of the locations, of male 2 2 coyotes (x = 3. 07 km ) and i'emale coyotes (x = 3. 01 km ) were similar. Home range sizes of male bobcats (x = 3. 46 km ) and female bobcats (x = 1. 16 km... TABLE OF CONTENTS LIST OF TABLES LIST OF FIGURES INTRODUCTION STUDY AREA HETHODS Trapping Tracking Home Ranges Habitat Use Activity Patterns Brush Treatments RESULTS AND DISCUSSION Trapping Tracking Home Ranges Habitat Use Activity...

  15. Potential application of a Gulf Coast Tick, Amblyomma maculatum Koch, Aggregation-Attachment-Pheromone for surveillance of free-living adults

    E-Print Network [OSTI]

    Kim, Hee Jung

    2005-02-17T23:59:59.000Z

    between Oklahoma and Texas strains of Gulf Coast ticks. iv The activity of AAP from fed male Gulf Coast ticks was confirmed using two bioassay techniques. A petri dish bioassay revealed significantly higher numbers of female Gulf Coast... of Texas and Oklahoma fed Gulf Coast ticks, Amblyomma maculatum Koch, at three collection intervals???.?????????????. 13 4 Diagram of double screened petri dish for exposed unfed male ticks used for solid-phase microextraction headspace collection...

  16. A revision of the electric ray genus Diplobatis with notes on the interrelationships of Narcinidae (Chondrichtyes, Torpediniformes)

    E-Print Network [OSTI]

    Fechhelm, Janice Drukten

    1981-01-01T23:59:59.000Z

    lots. Dorsal color patterns found in Group A: a, morph gl, USNM 226775, female, 162 mm TL; b, morph 42, UF 29894, female, 138 mm 1L; c, morph g3, USNM 186422, male, 133 mm TL; d, morph g4, TCWC 1905. 1, female, 101 mm TL; e, morph 4'5, BMNH 1961. 8... of whom I have never met. For the loan of speci- mens, I thank P. Whitehead (BMNH), G. Burgess (UF), R, J. Lavenberg and T. A. Adamson (LACM), W. L. Fink and K. Hartell (MCZ), S. Weitz- man, S. Kaznella and G. Van Dyke (USNM) and M. Boeseman and M...

  17. 112 Experientia 39 (1983), Birkhauser Verlag, CH-4010 Basel/Switzerland Variations in male oriental fruit moth courtshippatterns due to male competition

    E-Print Network [OSTI]

    directly above the platform by a Sony RSC 1050 rotary shutter camera and analyzed frame-by- frame on a Sony

  18. Faits saillants / Just the Facts Volume 14, numro 1 / Volume 14, Number 1

    E-Print Network [OSTI]

    Dawson, Jeff W.

    predators. From the scans, plastic wing models are produced, using a rapid- prototyping machine (3D printer on the funding, Bob! 3D SCANS AID IN STUDYING INSECT FLIGHT This past fall, Paul Bloskie in the 3D Centre of both a female and male locust. The 3D data is helping Dr. Jeff Dawson, Assistant Professor of Biology

  19. Not to be cited without prior reference to the authors. ICES CM 2006 / H:12

    E-Print Network [OSTI]

    Heino, Mikko

    Not to be cited without prior reference to the authors. ICES CM 2006 / H:12 Theme session H the male phase and reproduce as females already in their first reproductive season) responds is parameterized for Epinephelus fuscoguttatus (common names: brown #12;marbled grouper or flowery cod

  20. Natural history of thorny devils Moloch horridus (Lacertilia: Agamidae) in the Great Victoria Desert

    E-Print Network [OSTI]

    Pianka, Eric R.

    183 Natural history of thorny devils Moloch horridus (Lacertilia: Agamidae) in the Great Victoria received August 1997; accepted February 1998 Abstract Daily movements and activity of three male and five female thorny devils (Moloch horridus) were monitored using biotelemetry in the Great Victoria Desert

  1. The Oedipodinae of Kansas

    E-Print Network [OSTI]

    Beamer, Raymond H.(Raymond Hill),1889-

    with the latter holding undisputed sway on the flat barren top. Female Male Measurements. Body Tegmina 50-46 mm 44.5-39 mm Post, femora 25.5-22.5 mm 34-29 mm 33.5-30.5 mm 18.5-18 mm Distribution. 74 Fig.96. y Hippiscus phoenicopterus G.&B. HIPPISCUS...

  2. SEASONAL SURVIVAL, REPRODUCTION, AND USE OF WILDFIRE AREAS BY LESSER PRAIRIE CHICKENS IN THE NORTHEASTERN TEXAS PANHANDLE

    E-Print Network [OSTI]

    Jones, Ryan S.

    2010-07-14T23:59:59.000Z

    and differences in nest success. I found breeding season survival of both males and females was lower compared to non-breeding season survival. Annual survival was 0.52 (95% CI: 0.32? 0.71). Model selection indicated higher nest success (70%) in the sand sagebrush...

  3. Browne, CB, Research Proposal, March 2009 Activation of the Inflammasome in Gout

    E-Print Network [OSTI]

    Gleeson, Joseph G.

    Browne, CB, Research Proposal, March 2009 1 Activation of the Inflammasome in Gout Background Gout. The overall prevalence of gout in the U.S. was determined to be 41 in 1000 (1). Men are at a higher risk than women for gout, and the risk increases with age for both males and females (1). The initiation

  4. MAMMALIAN SPECIES No. 740, pp. 16, 3 figs. Daubentonia madagascariensis. By Aleta Quinn and Don E. Wilson

    E-Print Network [OSTI]

    Hayssen, Virginia

    name´E for Daubentonia . Geoffroy Saint-Hilaire.´E Aye-aye Lace´pe`de, 1799:6. Unavailable name, non.1--Feistner and Sterling 1995). Despite reports that males are generally larger than females, a study of 20

  5. GYMNASTICS LESSONS Whether you want to learn how to tumble, get some exercise, or

    E-Print Network [OSTI]

    Beex, A. A. "Louis"

    GYMNASTICS LESSONS Whether you want to learn how to tumble, get some exercise, or just have fun will be practiced with females and all men's events will be practiced with males. PRIVATE LESSONS Designed lessons offer an excellent opportunity to explore your potential. These classes may be taken in addition

  6. Prokupek 2008 THE ANALYSIS OF GENES EXPRESSED IN THE SPERM STORAGE

    E-Print Network [OSTI]

    Moriyama, Etsuko

    Prokupek 2008 THE ANALYSIS OF GENES EXPRESSED IN THE SPERM STORAGE ORGANS OF DROSOPHILA and Learning Company. #12;Prokupek 2008 THE ANALYSIS OF GENES EXPRESSED IN THE SPERM STORAGE ORGANS reproductive system. Sperm storage organs are important to the reproductive success of both males and females

  7. The effects of lysine supplementation to all-plant protein broiler diets

    E-Print Network [OSTI]

    Zavala-Madero, Manuel Antonio

    1962-01-01T23:59:59.000Z

    was likewise investigated in this experiment. Thx'ee hundx'ed thirty-six Vantress X Michols 108 chicks were divided into 21 groups of 8 males and 8 females per group. The groups were distri- buted at random into electricaILly heated batteries with raised...

  8. Creating Standards for Winter Terrain Parks

    E-Print Network [OSTI]

    to engineering frame motivated creation of a 501c(3) non-profit, United States Terrain Park Council Dedicated fatalities (31 male, 6 female) mostly young J. Shealy (2000) Snowboard injury rate doubled during 1990-2000 from 3.37 to 6.97 per 1000 skier days Deaths: 50 (2007-2008) 39 (2008-2009) Compiled by California Ski

  9. Anesthesiology. Author manuscript Lack of impact of intravenous lidocaine on analgesia, functional recovery,

    E-Print Network [OSTI]

    Boyer, Edmond

    to evaluate whether a continuous intravenous (IV) low-dose lidocaine infusion reduced postoperative pain in 10 min followed by a 1.5 mg.kg .h IV infusion and other patients received saline (control group-Blind Method ; Female ; Humans ; Infusions, Intravenous ; Lidocaine ; administration & dosage ; Male ; Middle

  10. Digit Ratio Predicts Sense of Direction in Women

    E-Print Network [OSTI]

    Chai, Xiaoqian

    The relative length of the second-to-fourth digits (2D:4D) has been linked with prenatal androgen in humans. The 2D:4D is sexually dimorphic, with lower values in males than females, and appears to correlate with diverse ...

  11. YEAR

    National Nuclear Security Administration (NNSA)

    3 YEAR 2014 Males 59 Females 24 PAY PLAN YEAR 2014 SES 1 EJEK 4 EN 05 3 EN 04 22 EN 03 8 NN (Engineering) 15 NQ (ProfTechAdmin) 27 NU (TechAdmin Support) 3 YEAR 2014 American...

  12. YEAR

    National Nuclear Security Administration (NNSA)

    8 YEAR 2013 Males 62 Females 26 YEAR 2013 SES 1 EJEK 3 EN 05 1 EN 04 28 EN 03 1 NN (Engineering) 25 NQ (ProfTechAdmin) 27 NU (TechAdmin Support) 2 YEAR 2013 American Indian...

  13. YEAR

    National Nuclear Security Administration (NNSA)

    5 YEAR 2013 Males 58 Females 27 YEAR 2013 SES 1 EJEK 4 EN 05 3 EN 04 21 EN 03 8 NN (Engineering) 16 NQ (ProfTechAdmin) 28 NU (TechAdmin Support) 4 YEAR 2013 American Indian...

  14. Differential Computed Tomographic Attenuation of Metabolically Active and Inactive Adipose

    E-Print Network [OSTI]

    Southern California, University of

    active under stimulation.24 Third, PET/CT indications of 18 F-fluoro-2-deoxyglucose (FDG)-avid BAT foci), presumed to be BAT, with positron emission and computed to- mography (PET/CT) in humans have been reported.0) and the difference was observed in both males and females. Key Words: brown adipose tissue, white adipose tissue, PET/CT

  15. SPACE USE, CIRCADIAN ACTIVITY PATTERN, AND MATING SYSTEM OF THE NOCTURNAL TREE RAT

    E-Print Network [OSTI]

    Helsinki, University of

    , spatial behavior and home-range size depend on body mass, energy requirements, and habitat productivity. Home ranges included the nests of 8­10 females, 6 different daytime resting places, and 3­5 areas of high activity. Males were mobile within home ranges of 5­10 ha (90% minimal convex polygons

  16. APPLICATION REQUIREMENTS: Admission Applica on

    E-Print Network [OSTI]

    Rainforth, Emma C.

    basis. An interview may be required. MS Educa onal Technology Program: A state issued teaching cer: State issued teaching cer ficate. Three years of professional experience as a teacher:_____________ ­ __________ ­ ________________ Sex: Male Female Street Address Town or City County State Zip Code Home Telephone

  17. PERSONAL DATA (IT0002) Mr. Miss Dr.

    E-Print Network [OSTI]

    Tennessee, University of

    Update PERSONAL DATA (IT0002) Mr. Miss Dr. Gender Male Female State Complete Information No Address OF TENNESSEE PERSONAL DATA FORM Personnel # PERMANENT RESIDENCE (IT0006-Subtype 1) Form of Address: New Ms Code PDF Rev. 03/20/2008 Page 1 of 2 #12;ADDITIONAL PERSONAL DATA (IT0077) Yes Yes No Employee

  18. PHYSICS DIVISION ESH BULLETIN 2004-02 1/15/04 LEAD SHIELDING

    E-Print Network [OSTI]

    PHYSICS DIVISION ESH BULLETIN 2004-02 1/15/04 LEAD SHIELDING Lead bricks (also sheet, tape, shot) are commonly used in the Physics Division for radiation shielding. Lead is toxic by inhalation and ingestion. Lead is a carcinogen and a reproductive hazard for both males and females. In addition to being

  19. Perceptions Of Texas Agricultural Education Teachers Regarding Diversity Inclusion In Secondary Agricultural Education Programs

    E-Print Network [OSTI]

    Lavergne, Douglas D.

    2010-01-14T23:59:59.000Z

    of 170 males and 45 females. The ethnic distribution of the sample was 90.5% White/European American, 6.2% Hispanic/Latino American, 1.9% Native American, 0.9% African American, and 0.5% Asian American. Respondents agreed that secondary agricultural...

  20. American black bear habitat selection in northern lower peninsula, Michigan, USA, using discrete-choice modeling

    E-Print Network [OSTI]

    Brown, Daniel G.

    data better than others; both indicated that locations of bears were negatively associated with water bear harvests, sightings, and nuisance reports. Policy makers and wildlife managers can prepare 1991­2000 for 20 males and 35 females. We developed Bayesian random effects discrete-choice models