Sample records for male female current

  1. Bringing men in: an analysis of male and female fertility

    E-Print Network [OSTI]

    Zhang, Li 1976-

    2009-05-15T23:59:59.000Z

    Prior research has focused on studying female fertility, but male fertility remains overlooked. Using data from the 2001 Demographic Yearbook, the 1964 to 2002 Taiwan-Fukien Demographic Yearbooks, the 2004 National Statistics Reports and the 2002...

  2. Male-female interaction among different geographic strains of the Gulf Coast tick Amblyomma maculatum Koch

    E-Print Network [OSTI]

    Sleeba, Sarah Beth

    2006-08-16T23:59:59.000Z

    dish experiments were used to understand male-female interaction in the field, and to determine if the aggregation attachment pheromone (AAP) produced by fed males of varying strains is attractive to geographic specific strains of unfed female ticks...

  3. Interventional Radiology of Male Varicocele: Current Status

    SciTech Connect (OSTI)

    Iaccarino, Vittorio, E-mail: vittorio.iaccarino@unina.it; Venetucci, Pietro [University of Naples 'Federico II', Diagnostic Imaging Department-Cardiovascular and Interventional Radiology, School of Medicine (Italy)

    2012-12-15T23:59:59.000Z

    Varicocele is a fairly common condition in male individuals. Although a minor disease, it may cause infertility and testicular pain. Consequently, it has high health and social impact. Here we review the current status of interventional radiology of male varicocele. We describe the radiological anatomy of gonadal veins and the clinical aspects of male varicocele, particularly the physical examination, which includes a new clinical and ultrasound Doppler maneuver. The surgical and radiological treatment options are also described with the focus on retrograde and antegrade sclerotherapy, together with our long experience with these procedures. Last, we compare the outcomes, recurrence and persistence rates, complications, procedure time and cost-effectiveness of each method. It clearly emerges from this analysis that there is a need for randomized multicentre trials designed to compare the various surgical and percutaneous techniques, all of which are aimed at occlusion of the anterior pampiniform plexus.

  4. Situating Male Fertility: A Demographic Analysis of Male and Female Fertility in the United States

    E-Print Network [OSTI]

    Cherry, Robert Christopher

    2012-02-14T23:59:59.000Z

    are not significantly different from those reported by females (Ratcliffe, Hill, Harrington, and Walraven 2002b). Rendall et al. (1999) explored the qualities of male reported data, and found that while retrospective recollection of fertility events underreport... listing of these articles indicated that the bulk of them (over 2/3rds) dealt with either 1) family planning (Guest 2003; Mesfin 2002; Pearson 2003), fertility control (Colvard, Habenicht, and Harper 2008; Darroch 2008), 14 contraception and condom...

  5. For Immediate Release --Wednesday, March 20, 2013 Treating male and female cancer patients with radiation

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    ? · gender differences in cancer treatment rarely explored · consequences of radiation with radiation treatment of cancer cells and the difference between female and male or female-specific treatments that improve the quality of life for all cancer

  6. The effects of adult male mouse urine odor on evoked potentials in adult female mice

    E-Print Network [OSTI]

    Brown, Troy Edwin

    1985-01-01T23:59:59.000Z

    THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE MAY 1985 Major Subject: Bioengineering THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Approved as to style and content by: Jon F. Hunter (Co ? C airman of Committee...

  7. The functional role and female perception of male song in Zebra Finches

    E-Print Network [OSTI]

    Woolley, Sarah M. N.

    The functional role and female perception of male song in Zebra Finches Mark E. HauberA,C , Dana L and perception of Zebra Finch song has driven theoretical, empirical and technological advances in behavioural ecology, endocrinology and neuroethology, and led to a greater understanding of the evolution of animal

  8. ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility

    E-Print Network [OSTI]

    ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility Stuart P. Bliss. Several studies suggest that ERK1 and -2 are essential modulators of hypothalamic GnRH-mediated regulation-specific depletion of ERK1 and 2 and examined a range of physiological parameters including fertility. We find

  9. Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain

    E-Print Network [OSTI]

    Schluter, Dolph

    Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain Devaleena S increases song behavior and the size of a brain region controlling song (HVC; Reiner et al. 2004), and also the brain (Soma 2006; Demas et al. 2007; Schlinger et al. 2007). Dehydroepiandrosterone can be converted

  10. Male Female

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA Approved:Administration SandiaAdministration NewsAdministrator6

  11. Exploring the Behavioral and Psychological Differences between Male and Female Youth with a History of Fire Involvement

    E-Print Network [OSTI]

    Morris, Ed M.

    2014-08-31T23:59:59.000Z

    . While it is supported that fire-involved youth tend to be males, recent statistics published by the National Fire Protection Association (NFPA) indicated sex differences in the type of fires set. Specifically, the NFPA report found that female youth... expression and found it surprising that females were associated with covert emotional expression through firesetting behavior because they are typically socialized to express emotions overtly. If the female-dominated structure fires documented by NFPA...

  12. Organ doses for reference adult male and female undergoing computed tomography estimated by Monte Carlo simulations

    SciTech Connect (OSTI)

    Lee, Choonsik; Kim, Kwang Pyo; Long, Daniel; Fisher, Ryan; Tien, Chris; Simon, Steven L.; Bouville, Andre; Bolch, Wesley E. [Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear Engineering, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States); Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States)

    2011-03-15T23:59:59.000Z

    Purpose: To develop a computed tomography (CT) organ dose estimation method designed to readily provide organ doses in a reference adult male and female for different scan ranges to investigate the degree to which existing commercial programs can reasonably match organ doses defined in these more anatomically realistic adult hybrid phantomsMethods: The x-ray fan beam in the SOMATOM Sensation 16 multidetector CT scanner was simulated within the Monte Carlo radiation transport code MCNPX2.6. The simulated CT scanner model was validated through comparison with experimentally measured lateral free-in-air dose profiles and computed tomography dose index (CTDI) values. The reference adult male and female hybrid phantoms were coupled with the established CT scanner model following arm removal to simulate clinical head and other body region scans. A set of organ dose matrices were calculated for a series of consecutive axial scans ranging from the top of the head to the bottom of the phantoms with a beam thickness of 10 mm and the tube potentials of 80, 100, and 120 kVp. The organ doses for head, chest, and abdomen/pelvis examinations were calculated based on the organ dose matrices and compared to those obtained from two commercial programs, CT-EXPO and CTDOSIMETRY. Organ dose calculations were repeated for an adult stylized phantom by using the same simulation method used for the adult hybrid phantom. Results: Comparisons of both lateral free-in-air dose profiles and CTDI values through experimental measurement with the Monte Carlo simulations showed good agreement to within 9%. Organ doses for head, chest, and abdomen/pelvis scans reported in the commercial programs exceeded those from the Monte Carlo calculations in both the hybrid and stylized phantoms in this study, sometimes by orders of magnitude. Conclusions: The organ dose estimation method and dose matrices established in this study readily provides organ doses for a reference adult male and female for different CT scan ranges and technical parameters. Organ doses from existing commercial programs do not reasonably match organ doses calculated for the hybrid phantoms due to differences in phantom anatomy, as well as differences in organ dose scaling parameters. The organ dose matrices developed in this study will be extended to cover different technical parameters, CT scanner models, and various age groups.

  13. Male mating behavior and costs of sexual harassment for females in cavernicolous and extremophile

    E-Print Network [OSTI]

    Schlupp, Ingo

    by physicochemical stressors, such as toxic hydrogen sulfide (H2S), or the fish occur in lightless subterranean (cave) habitats. Using five different populations from surface habitats with or without H2S, and from a sulfidic with at least one physicochemical stressor present (H2S or absence of light), a reduction in male sexual

  14. Evaluation of overall setup accuracy and adequate setup margins in pelvic image-guided radiotherapy: Comparison of the male and female patients

    SciTech Connect (OSTI)

    Laaksomaa, Marko, E-mail: marko.laaksomaa@pshp.fi [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Kapanen, Mika [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Tulijoki, Tapio [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Peltola, Seppo; Hyödynmaa, Simo [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Kellokumpu-Lehtinen, Pirkko-Liisa [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland)

    2014-04-01T23:59:59.000Z

    We evaluated adequate setup margins for the radiotherapy (RT) of pelvic tumors based on overall position errors of bony landmarks. We also estimated the difference in setup accuracy between the male and female patients. Finally, we compared the patient rotation for 2 immobilization devices. The study cohort included consecutive 64 male and 64 female patients. Altogether, 1794 orthogonal setup images were analyzed. Observer-related deviation in image matching and the effect of patient rotation were explicitly determined. Overall systematic and random errors were calculated in 3 orthogonal directions. Anisotropic setup margins were evaluated based on residual errors after weekly image guidance. The van Herk formula was used to calculate the margins. Overall, 100 patients were immobilized with a house-made device. The patient rotation was compared against 28 patients immobilized with CIVCO's Kneefix and Feetfix. We found that the usually applied isotropic setup margin of 8 mm covered all the uncertainties related to patient setup for most RT treatments of the pelvis. However, margins of even 10.3 mm were needed for the female patients with very large pelvic target volumes centered either in the symphysis or in the sacrum containing both of these structures. This was because the effect of rotation (p ? 0.02) and the observer variation in image matching (p ? 0.04) were significantly larger for the female patients than for the male patients. Even with daily image guidance, the required margins remained larger for the women. Patient rotations were largest about the lateral axes. The difference between the required margins was only 1 mm for the 2 immobilization devices. The largest component of overall systematic position error came from patient rotation. This emphasizes the need for rotation correction. Overall, larger position errors and setup margins were observed for the female patients with pelvic cancer than for the male patients.

  15. The Role of Androgens in Male Pregnancy and Female Competitive Behavior in a Sex Role Reversed Pipefish

    E-Print Network [OSTI]

    Scobell, Sunny Kay

    2012-02-14T23:59:59.000Z

    of the male reproductive cycle in seahorses. I predicted that androgens would be low during the early stages of pregnancy and increase during the end of pregnancy as males go through another cycle of spermatogenesis in preparation for the next mating event. My...

  16. Male body image: critical measurement issues

    E-Print Network [OSTI]

    Brown, Joshua Daniel

    2002-01-01T23:59:59.000Z

    12 16 RESULTS. . . 18 Companng the SM and the BIA m the Assessment of Body Image. How Accurate Were Males and Females m Gauging Their Musculanty and Body Fatness' ?. . . How Accurate Were Males and Females m Gauging What the Opposite Sex Found...-wise Compansons for Quesuon Main Effects wtth BF%. Male and Female. 49 9 Comparmg Effect Sizes (Current vs. Ideal) Body Image Assessment (BIA) vs Somatomorphic Matnx (SM) 50 10 Factor Structure of the Affective Body Satisfaction (ABS). 51 11 Comparing Explamed...

  17. Chat up lines: effect of the menstrual cycle and sociosexuality on female response to male sexual displays 

    E-Print Network [OSTI]

    Kubicki, Natalie E

    2008-06-27T23:59:59.000Z

    al., who asked participants to judge how a typical woman would respond to particular chat up lines, this study investigated fertility as having a possible effect on responses and asked female-only participants (N=85) how they themselves would respond...

  18. Biotransformation of 2,3,3,3-tetrafluoropropene (HFO-1234yf) in male, pregnant and non-pregnant female rabbits after single high dose inhalation exposure

    SciTech Connect (OSTI)

    Schmidt, Tobias [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany); Bertermann, Rüdiger [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany)] [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany); Rusch, George M. [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States)] [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States); Hoffman, Gary M. [Huntingdon Life Sciences., East Millstone, NJ (United States)] [Huntingdon Life Sciences., East Millstone, NJ (United States); Dekant, Wolfgang, E-mail: dekant@toxi.uni-wuerzburg.de [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)

    2012-08-15T23:59:59.000Z

    2,3,3,3-Tetrafluoropropene (HFO-1234yf) is a novel refrigerant intended for use in mobile air conditioning. It showed a low potential for toxicity in rodents studies with most NOAELs well above 10,000 ppm in guideline compliant toxicity studies. However, a developmental toxicity study in rabbits showed mortality at exposure levels of 5,500 ppm and above. No lethality was observed at exposure levels of 2,500 and 4,000 ppm. Nevertheless, increased subacute inflammatory heart lesions were observed in rabbits at all exposure levels. Since the lethality in pregnant animals may be due to altered biotransformation of HFO-1234yf and to evaluate the potential risk to pregnant women facing a car crash, this study compared the acute toxicity and biotransformation of HFO-1234yf in male, female and pregnant female rabbits. Animals were exposed to 50,000 ppm and 100,000 ppm for 1 h. For metabolite identification by {sup 19}F NMR and LC/MS-MS, urine was collected for 48 h after inhalation exposure. In all samples, the predominant metabolites were S-(3,3,3-trifluoro-2-hydroxypropanyl)-mercaptolactic acid and N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine. Since no major differences in urinary metabolite pattern were observed between the groups, only N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine excretion was quantified. No significant differences in recovery between non-pregnant (43.10 ± 22.35 ?mol) and pregnant female (50.47 ± 19.72 ?mol) rabbits were observed, male rabbits exposed to 100,000 ppm for one hour excreted 86.40 ± 38.87 ?mol. Lethality and clinical signs of toxicity were not observed in any group. The results suggest that the lethality of HFO-1234yf in pregnant rabbits unlikely is due to changes in biotransformation patterns or capacity in pregnant rabbits. -- Highlights: ? No lethality and clinical signs were observed. ? No differences in metabolic pattern between pregnant and non-pregnant rabbits. ? Rapid and similar metabolite excretion in all groups. ? Very low amount of biotransformation in all groups (< 0.1%).

  19. The effects of waist-to-hip ratio and body weight on male judgements of female physical attractiveness, wife desirability, and health, both within and between cultures. 

    E-Print Network [OSTI]

    McLean, Julia

    2007-01-01T23:59:59.000Z

    Evolutionary theories maintain that female physical attractiveness has evolved to honestly signal health and reproductive potential. Both a low waist-to-hip ratio (WHR) and a critical range of body weight have received ...

  20. PRE-MATING COMMUNICATION AND HYBRIDIZATION BETWEEN TWO MEADOW KATYDIDS, ORCHELIMUM NIGRIPES AND O. PULCHELLUM (ORTHOPTERA: TETTIGONIIDAE): MALE CALLING SONG AND ASYMMETRIC FEMALE PREFERENCE

    E-Print Network [OSTI]

    Miller, Ginger

    2010-12-06T23:59:59.000Z

    , males of both parental species and the hybrids would sing from lower grassy vegetation as well as high in kudzu and trees. They were also observed feeding on seeds and insect prey (which were ubiquitous), so this hybrid zone is not likely an ecotonal...

  1. Guidance on the Use of Hand-Held Survey Meters for radiological Triage: Time-Dependent Detector Count Rates Corresponding to 50, 250, and 500 mSv Effective Dose for Adult Males and Adult Females

    SciTech Connect (OSTI)

    Bolch, W.E. [University of Florida; Hurtado, J.L. [University of Florida; Lee, C. [University of Florida; Manger, Ryan P [ORNL; Hertel, Nolan [Georgia Institute of Technology; Burgett, E. [Georgia Institute of Technology; Dickerson, W. [Armed Force Radiobiological Research Institute

    2012-01-01T23:59:59.000Z

    In June 2006, the Radiation Studies Branch of the Centers for Disease Control and Prevention held a workshop to explore rapid methods of facilitating radiological triage of large numbers of potentially contaminated individuals following detonation of a radiological dispersal device. Two options were discussed. The first was the use of traditional gamma cameras in nuclear medicine departments operated as makeshift wholebody counters. Guidance on this approach is currently available from the CDC. This approach would be feasible if a manageable number of individuals were involved, transportation to the relevant hospitals was quickly provided, and the medical staff at each facility had been previously trained in this non-traditional use of their radiopharmaceutical imaging devices. If, however, substantially larger numbers of individuals (100 s to 1,000 s) needed radiological screening, other options must be given to first responders, first receivers, and health physicists providing medical management. In this study, the second option of the workshop was investigated by the use of commercially available portable survey meters (either NaI or GM based) for assessing potential ranges of effective dose (G50, 50Y250, 250Y500, and 9500 mSv). Two hybrid computational phantoms were used to model an adult male and an adult female subject internally contaminated with 241Am, 60Cs, 137Cs, 131I, or 192Ir following an acute inhalation or ingestion intake. As a function of time following the exposure, the net count rates corresponding to committed effective doses of 50, 250, and 500 mSv were estimated via Monte Carlo radiation transport simulation for each of four different detector types, positions, and screening distances. Measured net count rates can be compared to these values, and an assignment of one of four possible effective dose ranges could be made. The method implicitly assumes that all external contamination has been removed prior to screening and that the measurements be conducted in a low background, and possibly mobile, facility positioned at the triage location. Net count rate data are provided in both tabular and graphical format within a series of eight handbooks available at the CDC website (http://www.bt.cdc.gov/radiation/clinicians/evaluation).

  2. ORIGINAL PAPER The effect of perceived female parasite

    E-Print Network [OSTI]

    Jones, Adam

    in behavioral ecology have resulted in a deeper appreciation of post-mating processes and sexual conflict and that a male's perception of female parasite load can be altered by tattooing females. We manipulated-copulatory sexual selection is dependent on a male's perception of female parasite load in pipefish. Our results

  3. Current:

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling Corp -KWatertowni5W 95.5x-L* d!Qwner contacted n

  4. Current:

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling Corp -KWatertowni5W 95.5x-L* d!Qwner contacted

  5. Female Biology Professor: Jennifer Dever

    E-Print Network [OSTI]

    Dever, Jennifer A.

    grandmother did not & vice versa? n What are the most pressing issues for women today? (locally & globally's philosophy on women Hysteria - - - hysterectomy #12;8/15/12 3 n Females and males ARE different... more than to keep in mind for the Health field NOW - Re-defining women's roles, the feminist perspective science

  6. Costs influence male mate choice in a freshwater fish

    E-Print Network [OSTI]

    Keogh, Scott

    Costs influence male mate choice in a freshwater fish Bob B. M. Wong* and Michael D. Jennions that female mate choice decisions depend on the direct costs of choosing (either because of search costs or male-imposed costs). Far less is known about how direct fitness costs affect male mate choice. We

  7. Female preference for complex male displays in hybridizing swordtails

    E-Print Network [OSTI]

    Cress, Zachary Pierce

    2009-05-15T23:59:59.000Z

    five traits (standard body length, body depth, dorsal fin width, sword length and vertical bar number) correlate to one another within natural variation of populations of X. birchmanni, X. malinche and three hybrid populations and created synthetic 3...

  8. Female Figurines (Pharaonic Period)

    E-Print Network [OSTI]

    Waraksa, Elizabeth

    2008-01-01T23:59:59.000Z

    be translated “clay figure (of Isis). ” A spell to relieve arpyt Ast or “female figure of Isis. ” The term rpyt may ben sDt , a “female figure of Isis in firewood” (BM EA 9997 +

  9. Journal of Insect Behavior, Vol. 15, No. 2, March 2002 ( C 2002) Breeding Strategies in Females of the Parasitoid

    E-Print Network [OSTI]

    King, Bethia H.

    , females are generally larger than males (Napoleon and King, 1999). It is possible that some S. endius, appears to be affected by host size (Napoleon and King, 1999). Thus, large hosts may benefit mated females

  10. Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Orthoptera: Tettigoniidae)

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Anabrus simplex, a katydid in which there can be intense sexual selection on females in nature (Gwynne B I O L O G Y Keywords: Anabrus simplex; female competition; male choice; Orthoptera; selection

  11. The Female Grotesque Amid the Carnival of Renaissance Drama

    E-Print Network [OSTI]

    Guy, Corinee Wooten

    2009-04-24T23:59:59.000Z

    ’s experience.” 41 Additionally, Jacobean writers often dramatized unlicensed celebration to express concern over “their increasingly unfamiliar and unruly city” and reflected authority’s anxiety about “the symbols of its coherence, the devices of its... version of the hot, dry, well-regulated man’s, 108 so that quiet and submissive seemed a natural assignment for the female. Some Renaissance authorities suggested that overlaps between male and female humoral balances occur due to life style, climate...

  12. 0 Springer-Verlag 1989 Female turtles from hot nests

    E-Print Network [OSTI]

    Canberra, University of

    or proportion of development at high temperatures that matters? Arthur Georges Applied Ecology Research Group nests of fresh- water turtles with temperature-dependent sex determination is known to be a poor species, females are produced at high temperatures and males at low temperatures. A very narrow range

  13. Poverty and Productivity in Female-Headed Households in Zimbabwe

    E-Print Network [OSTI]

    Horrell, Sara; Krishnan, Pramila

    A household survey conducted in rural Zimbabwe in 2001 is used to compare the position of de facto and de jure female-headed households to those with a male head. These households are characterised by different forms of poverty that impinge...

  14. FEMALE SINGERS on CD IN THE MUSIC LIBRARY

    E-Print Network [OSTI]

    Lennard, William N.

    FEMALE SINGERS on CD IN THE MUSIC LIBRARY Choose the CATALOGUE, and perform a KEYWORD search, using *GRAHAM, Sandra *GREEN, Patricia # HAMARI, Julia HELLING, Hilke HODGSON, Alfreda HORNE, Marilyn *KRAUSE Librarian Music Library - Western Libraries Western University 2012/04/07 #12;MALE SINGERS ON CD

  15. Science faculty's subtle gender biases favor male students

    E-Print Network [OSTI]

    Handelsman, Jo

    of the faculty participants did not affect responses, such that female and male faculty were equally likely demands over the next decade (1). To help close this formidable gap, the report calls for the increased training and retention of women, who are starkly underrepresented within many fields of science, especially

  16. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    S. Towers

    2008-04-19T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females. The author has a PhD in particle physics and worked for six years as a postdoctoral research scientist, five of which were spent collaborating at Fermilab. She is currently completing a graduate degree in statistics.

  17. Electric Currents Electric Current

    E-Print Network [OSTI]

    Yu, Jaehoon

    ;Problem 3: At $0.095/kWh, what does it cost to leave a 25W porch light on day and night for a year = 219000 Watt- hour = 219kWh. So, total cost = 219 x$0.095 = $20.8 #12;Problem 4: A 100 W light bulb has of charge per unit time: = . Unit of current: Ampere (A). The purpose of a battery is to produce

  18. Reduced Metabolsim in Brain 'Control Networks' Following Cocaine-Cues Exposure in Female Cocaine Abusers

    SciTech Connect (OSTI)

    Volkow, N.D.; Wang, G.; Volkow, N.D.; Tomasi, D.; Wang, G.-J.; Fowler, J.S.; Telang, F.; Goldstein, R.Z.; Alia-Klein, N.; Wong, C.T.

    2011-03-01T23:59:59.000Z

    Gender differences in vulnerability for cocaine addiction have been reported. Though the mechanisms are not understood, here we hypothesize that gender differences in reactivity to conditioned-cues, which contributes to relapse, are involved. To test this we compared brain metabolism (using PET and {sup 18}FDG) between female (n = 10) and male (n = 16) active cocaine abusers when they watched a neutral video (nature scenes) versus a cocaine-cues video. Self-reports of craving increased with the cocaine-cue video but responses did not differ between genders. In contrast, changes in whole brain metabolism with cocaine-cues differed by gender (p<0.05); females significantly decreased metabolism (-8.6% {+-} 10) whereas males tended to increase it (+5.5% {+-} 18). SPM analysis (Cocaine-cues vs Neutral) in females revealed decreases in frontal, cingulate and parietal cortices, thalamus and midbrain (p<0.001) whereas males showed increases in right inferior frontal gyrus (BA 44/45) (only at p<0.005). The gender-cue interaction showed greater decrements with Cocaine-cues in females than males (p<0.001) in frontal (BA 8, 9, 10), anterior cingulate (BA 24, 32), posterior cingulate (BA 23, 31), inferior parietal (BA 40) and thalamus (dorsomedial nucleus). Females showed greater brain reactivity to cocaine-cues than males but no differences in craving, suggesting that there may be gender differences in response to cues that are not linked with craving but could affect subsequent drug use. Specifically deactivation of brain regions from 'control networks' (prefrontal, cingulate, inferior parietal, thalamus) in females could increase their vulnerability to relapse since it would interfere with executive function (cognitive inhibition). This highlights the importance of gender tailored interventions for cocaine addiction.

  19. Available online at www.sciencedirect.com Female mate choice copying affects sexual selection in wild

    E-Print Network [OSTI]

    Indiana University

    in wild populations of the ocellated wrasse SUZANNE H. ALONZO Department of Ecology and Evolutionary and importance of nonindependent female choice in wild popula- tions. In a species with male territoriality under natural conditions in the wild. I further show that a short- term experimental increase

  20. The Female of the Species is More Deadly than the Male

    E-Print Network [OSTI]

    Wright, Meg

    1982-01-01T23:59:59.000Z

    here eyes off tho delicate: HlrlnG for a moment and eyed him.ruefully. "It'd be a lot oasior if I could lift tho Hho18 suction (Jut, but those old Ac4ll models aren r t dos ignod to come a,part." He tried. to nod, found it impossibln. "Easters has.... In my u~1iv(:rsc, Or climol1S:L0n, or whcrovcr,'l .').Iil the Captain of the Ento:cprise." uIn you:-c imaGination, maybo. In your H ishcs, I \\.iarosay. In realit.y,? never. 11 HHoY! aTC you Going to link with Urock?" She stood ,:tncl facod hiii1p...

  1. MALE QUALITY INFLUENCES INTERSEXUAL DYNAMICS, BUT NOT FEMALE INTRASEXUAL COMPETITION, IN A MONOGAMOUS, BIPARENTAL FISH

    E-Print Network [OSTI]

    Robart, Ashley Rogers

    2015-01-01T23:59:59.000Z

    carotenoids and clutch quality in the two- spotted goby (relationship between signal quality and physical condition:investment when mate quality varies: Differential allocation

  2. The Autoimmune Regulator (AIRE) preserves fertility in male and female Balb/c mice.

    E-Print Network [OSTI]

    Warren, Bryce

    2014-12-31T23:59:59.000Z

    of GnRH or gonadotropin release, or third, the infringement of the hypothalamic-pituitary portal circulatory system. Examples resulting in functional 22 destruction include hypothalamic/pituitary tumors or cysts (Citron et al., 1996) as well..., & Chipps, 1986) and artificially elevated gonadal steroids (Turek, Williams, Gilbaugh, & Lipshultz, 1995). Finally, a disruption of the pituitary portal circulatory system, which prevents GnRH from reaching the pituitary or gonadotropins from entering...

  3. FEMALE CONDITION AND DELAYED BENEFITS TO MALES THAT PROVIDE PARENTAL CARE: A REMOVAL STUDY

    E-Print Network [OSTI]

    (e.g.Da- vies 1989)hasled studentsof reproductivebe- havior to questionmore critically why malesin some

  4. A comparison of range of joint mobility in college females and males

    E-Print Network [OSTI]

    Staff, Kathy Rene

    1983-01-01T23:59:59.000Z

    the weighted end of the needle downward during the movement. This measuri ng techni que does not requi re extra equipment and the technique oi' administration was carefully described by Leighton ( 1966) so that comparative studies can be easily made. Roebuck..., et al. ( 1975) point out that the flexometer can be easily used to measure the human body in protective equipment as well as nude (except for some ankle measures). However, they also note that this method does not cons ider shi fti ng joint...

  5. Gender and stress as predictors of psychopathology in male- and female-dominated graduate disciplines

    E-Print Network [OSTI]

    Valentine, Eugenia Michelle

    1996-01-01T23:59:59.000Z

    and expectations defined by society as being culturally appropriate for each gender (O' Neil, 1982). Gender-role stereotypes, therefore, are rigid and exaggerated expectations of how each gender should behave (Basow, 1992). The stereotype that certain roles... to high occupational achievement may find that co-workers are socially unresponsive to them (Banziger a Hooker, 1979) They are often viewed as social oddities, and this may sabotage and restrict their opportunities for professional relationships...

  6. Induced Currents, Eddy Currents and

    E-Print Network [OSTI]

    Tobar, Michael

    Lecture 11 Induced Currents, Eddy Currents and Maxwell's Equations 1 Faraday Disk Dynamo F = q Eddy Currents We have learnt that changing magnetic fields can induce electric fields in conductors 108 ms-1 16 #12;In this lecture and the next Eddy Currents: We have covered Sect. 29

  7. Current Rusume

    E-Print Network [OSTI]

    2015-02-09T23:59:59.000Z

    Research Interest Rough paths theory, Stochastic differential equations, ... I am currently working on a problem about stochastic analysis on Riemannian folia-.

  8. The evolution of parental care in insects: a test of current hypotheses

    E-Print Network [OSTI]

    Gilbert, James D. J.; Manica, Andrea

    2015-04-30T23:59:59.000Z

    mating system of resource-defense polygyny, for exam- ple, in some thrips (e.g., Hoplothrips spp.; Crespi 1986, 1988), were treated as male care (see, e.g., Tallamy 2001; Costa 2006); however, guarding of ovipositing mates from other males, for ex- ample... 1997), or (2) species where costs to males of searching for additional females are prohibitive, such as Hemilepistus isopods (Shachak 1980). Many of these ecological conditions are met si- multaneously in species breeding on rare, defensible “bonanza...

  9. Courtship and Multi-Stage Transfer of Material to the Female's Wings During Copulation in Microsepsis armillata (Diptera: Sepsidae)

    E-Print Network [OSTI]

    Bermingham, Eldredge

    to brushes on his hind tibiae, from there to his middle tarsi, and finally to the bases of the female's wings during copulation. Males of many other sepsids also have brushes on their hind tibiae, indi cating, the osmeterium, on his hind tibia (Pont, 1979). The setae of the osme terium are said to be hollow, and to draw

  10. Current Titles

    SciTech Connect (OSTI)

    Various

    2006-06-01T23:59:59.000Z

    This booklet is published for those interested in current research being conducted at the National Center for Electron Microscopy. The NCEM is a DOE-designated national user facility and is available at no charge to qualified researchers. Access is controlled by an external steering committee. Interested researchers may contact Jane Cavlina, Administrator, at 510/486-6036.

  11. aging female sencar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    should increase with age after puberty. To test this, we examined age Pierce, Graham 57 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  12. .Female Pupils Perception of Electrical Engineering

    E-Print Network [OSTI]

    Tal, Ayellet

    1 .Female Pupils Perception of Electrical Engineering OrzitHazzan Technion--Israel Institute. BACKGROUND The Department of Electrical Engineering at Technion1 TheDepartmentofElectricalEngineeringatTechnion is ranked among the top-10 electrical engineering and computer science departments in the world

  13. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    Towers, S

    2008-01-01T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females.

  14. Sexual partner concurrency among female sex workers and their intimate male partners in two Mexico-U.S. border cities

    E-Print Network [OSTI]

    Robertson, Angela Marie; Robertson, Angela Marie

    2012-01-01T23:59:59.000Z

    que tienen clientes de una-sola-vez o no- regulares. Desdeno regulares o de una-sola-vez? ¨? ¿Cuánta información creesean regulares o de una-sola-vez)? ¨? ¿Usted cree que su

  15. Refined understanding of sulfur amino acid nutrition in hybrid striped bass, Morone chrysops (male symbol) x M. saxatilis (female symbol)

    E-Print Network [OSTI]

    Kelly, Mark Christopher

    2005-08-29T23:59:59.000Z

    Previous studies have indicated the level of total sulfur amino acids (TSAA) (methionine + cystine) is most limiting in practical diet formulations for hybrid striped bass (HSB), especially if animal feedstuffs are replaced with plant feedstuffs...

  16. The role of constrictor prostanoids in the development of aortic coarctation-induced hypertension in male and female rats

    E-Print Network [OSTI]

    Baltzer, Wendy Irene

    2005-02-17T23:59:59.000Z

    function and arterial blood pressure (MAP) during development of aortic coarctation-induced hypertension (HT). M and F rats, (15-18 wks.) in four groups: normotensive (NT), hypertensive (HT), ovariectomized (OVX), and OVX estrogen-replaced (OE), underwent...

  17. First male sperm precedence in multiply-mated females of the cooperative spider Anelosimus studiosus (Araneae, Theridiidae)

    E-Print Network [OSTI]

    Jones, Thomas C.

    University, Johnson City, Tennessee 37614, USA. E-mail: jonestc@etsu.edu Patricia G. Parker: Department

  18. O Que Não Dá Chupa: The Male-to-Female ‘Homosexual’ As Star of Brazil’s Economic Boom

    E-Print Network [OSTI]

    Costa, Diego

    2012-01-01T23:59:59.000Z

    Homosexual” As The Star of Brazil’s Economic Boom (earlyof Southern California Two of Brazil’s most re-occurringabout itself are that Brazil is the country of the future,

  19. Self-selection contributes significantly to the lower adiposity of faster, longer-distanced, male and female walkers

    E-Print Network [OSTI]

    Williams, Paul T.

    2006-01-01T23:59:59.000Z

    depend upon the sample percentile of the BMI or body1 shows that the 90 th percentile of BMI declines morevelocity than lower BMI percentiles, a phenomenon also

  20. The effects of two situational variables on the self-confidence of males and females in achievement settings

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  1. The effects of two situational variables on the self-confidence of males and females in achievement settings 

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  2. Early career outcomes of male and female agricultural graduates: a synthesis of human capital and comparable worth theories

    E-Print Network [OSTI]

    Hamer-Cotten, Jennifer Faye

    1991-01-01T23:59:59.000Z

    spring 1987. Forty-two percent (n=2, 284) of the alumni responded. To adjust for institutional response bias, the sample of respondents was weighted according to each institution's proportion of the total 1977 agricultural enrollment. Men represent... with agricultural alumni in 1987 resulted in 2, 049 respondents. Overall, gender disparity occurred during graduates' early career development. Relative to men, women received lower employment compensation (i. e. , salary and benefits) regardless of similarities...

  3. Mathematical models and specific absorbed fractions of photon energy in the nonpregnant adult female and at the end of each trimester of pregnancy

    SciTech Connect (OSTI)

    Stabin, M.G.; Watson, E.E.; Cristy, M.; Ryman, J.C.; Eckerman, K.F. [Oak Ridge National Lab., TN (United States)] [Oak Ridge National Lab., TN (United States); Davis, J.L. [Tennessee Univ., Chattanooga, TN (United States)] [Tennessee Univ., Chattanooga, TN (United States); Marshall, D. [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering] [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering; Gehlen, M.K. [San Diego State Univ., CA (United States)] [San Diego State Univ., CA (United States)

    1995-05-08T23:59:59.000Z

    Mathematical phantoms representing the adult female at three, six, and nine months of gestation are described. They are modifications of the 15-year-old male/adult female phantom (15-AF phantom) of Cristy and Eckerman (1987). The model of uterine contents includes the fetus, fetal skeleton, and placenta. The model is suitable for dose calculations for the fetus as a whole; individual organs within the fetus (other than the skeleton) are not modeled. A new model for the nonpregnant adult female is also described, comprising (1) the 15-AF phantom; (2) an adjustment to specific absorbed fractions for organ self-dose from photons to better match Reference Woman masses; and (3) computation of specific absorbed fractions with Reference Woman masses from ICRP Publication 23 for both penetrating and nonpenetrating radiations. Specific absorbed fractions for photons emitted from various source regions are tabulated for the new non;pregnant adult female model and the three pregnancy models.

  4. asymptomatic female patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 33 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  5. anaesthetized female rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a 16-mg lead or a control solution for 30 days... Rocha, Angelica 2009-05-15 55 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  6. allotriploid hybryd females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 10 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  7. Abnormal reproductive function in female homozygous leaner mice

    E-Print Network [OSTI]

    Serpedin, Nesrin

    2004-09-30T23:59:59.000Z

    Major Subject: Toxicology ABNORMAL REPRODUCTIVE FUNCTION IN FEMALE HOMOZYGOUS LEANER MICE A Thesis...) (Chair of Toxicology Faculty) December 2003 Major Subject: Toxicology iii ABSTRACT Abnormal Reproductive Function in Female Homozygous...

  8. Impaired Visuospatial Processing in Young Adult Female Fragile X

    E-Print Network [OSTI]

    Nguyen, Danh

    Trends in Children Yingratana Bella McLennan, Ling Wong, Naomi Goodrich-Hunsaker, Danielle Harvey, FloraXPCs show faster psychomotor speed compared to HCs Female Motor Reaction Times Female Oral Reaction Times was accounted for but had no significant difference in error rates as compared to controls However, female

  9. Male body image: testosterone's response to body comparisons

    E-Print Network [OSTI]

    Brown, Joshua D.

    2006-08-16T23:59:59.000Z

    Although there have been only a few etiological studies that have examined the development and maintenance of body image in males, research fairly consistently reports that exposure and presumed comparison to images of ideal male bodies increases...

  10. Current measurement apparatus

    DOE Patents [OSTI]

    Umans, Stephen D. (Belmont, MA)

    2008-11-11T23:59:59.000Z

    Apparatus and methods are provided for a system for measurement of a current in a conductor such that the conductor current may be momentarily directed to a current measurement element in order to maintain proper current without significantly increasing an amount of power dissipation attributable to the current measurement element or adding resistance to assist in current measurement. The apparatus and methods described herein are useful in superconducting circuits where it is necessary to monitor current carried by the superconducting elements while minimizing the effects of power dissipation attributable to the current measurement element.

  11. The role of human and social capital in explaining the lack of female head coaches in women's intercollegiate sports

    E-Print Network [OSTI]

    Stumph, Kelly J

    2013-02-22T23:59:59.000Z

    likely receiving lower salaries than males. vet the 1'cmales did not report less career satisfaction (Parks et al. , 1995). There are specific factors attributed to the disparity ol' 1'emale head soccer coaches. 'I'he intrinsic measure of career success... that this salary deficit is simply a result of vvomen earning lower salaries in an array of industries not just that of coaching. For instance, it was reported that in 1995, a full-time female communications manager earned $. 86 for every $1. 00 earned bv her...

  12. adolescent female rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 48 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  13. adolescent female football: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    56 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  14. american female adolescents: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  15. american adolescent females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  16. adolescent female attendance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    35 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  17. adolescent female distance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    distance 26 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  18. adolescent females affected: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 42 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  19. adult female giraffe: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of 14 ESTIMATION OF ANNUAL AND SEMI-ANNUAL SURVIVAL OF ADULT FEMALE BLUE CRABS AND ASSESSMENT OF THE EFFECTIVENESS OF THE Biology and Medicine Websites Summary: ESTIMATION...

  20. A chimera embryo assay reveals a decrease in embryonic cellular proliferation induced by sperm from X-irradiated male mice

    SciTech Connect (OSTI)

    Obasaju, M.F.; Wiley, L.M.; Oudiz, D.J.; Raabe, O.; Overstreet, J.W.

    1989-05-01T23:59:59.000Z

    Male mice were divided into three experimental groups and a control group. Mice in the experimental groups received one of three doses of acute X irradiation (1.73, 0.29, and 0.05 Gy) and together with the control unirradiated mice were then mated weekly to unirradiated female mice for a 9-week experimental period. Embryos were recovered from the weekly matings at the four-cell stage and examined by the chimera assay for proliferative disadvantage. Aggregation chimeras were constructed of embryos from female mice mated to irradiated males (experimental embryos) and embryos from females mated to unexposed males (control embryos) and contained either one experimental embryo and one control embryo (heterologous chimera) or two control embryos (control chimera). The control embryo in heterologous chimeras and either embryo in control chimeras were prelabeled with the vital dye fluorescein isothiocyanate (FITC), and the chimeras were cultured for 40 h and viewed under phase-contrast and epifluorescence microscopy to obtain total embryo cell number and the cellular contribution from the FITC-labeled embryo. Experimental and control embryos that were cultured singly were also examined for embryo cell number at the end of the 40-h culture period. In control chimeras, the mean ratio of the unlabeled cells:total chimera cell number (henceforth referred to as ''mean ratio'') was 0.50 with little or no weekly variation over the 9-week experimental period. During Weeks 4-7, the mean ratios of heterologous chimeras differed significantly from the mean ratio of control chimeras with the greatest differences occurring during Week 7 (0.41 for chimeras of 0.05 Gy dose group, 0.40 for chimeras of the 0.29 Gy dose group, and 0.17 for chimeras of the 1.73 Gy dose group).

  1. Anomalous - viscosity current drive

    DOE Patents [OSTI]

    Stix, Thomas H. (Princeton, NJ); Ono, Masayuki (Princeton Junction, NJ)

    1988-01-01T23:59:59.000Z

    An apparatus and method for maintaining a steady-state current in a toroidal magnetically confined plasma. An electric current is generated in an edge region at or near the outermost good magnetic surface of the toroidal plasma. The edge current is generated in a direction parallel to the flow of current in the main plasma and such that its current density is greater than the average density of the main plasma current. The current flow in the edge region is maintained in a direction parallel to the main current for a period of one or two of its characteristic decay times. Current from the edge region will penetrate radially into the plasma and augment the main plasma current through the mechanism of anomalous viscosity. In another aspect of the invention, current flow driven between a cathode and an anode is used to establish a start-up plasma current. The plasma-current channel is magnetically detached from the electrodes, leaving a plasma magnetically insulated from contact with any material obstructions including the cathode and anode.

  2. aged male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male subjects: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. adolescent male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. american male smokers: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. asymptomatic older male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male voxel: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. aging male symptoms: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. adult male rural: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult male circumcision: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. adult males crustacea: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. adult male offspring: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. adult male subantarctic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. adult male rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. adult male case: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. abortive cytoplasmic male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. adult male rhesus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. adult male patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. adult male population: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adolescent male physical: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. adult male sprague: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male canaries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. adolescent male evidence: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male albino: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. atlantic male walruses: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male guppy: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. anesthetized male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male acquired: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. adult male patients: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult male reproductive: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. affects male type: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. adult male leather: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. abdominalis choosy males: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. adult males pt: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. adult males characterized: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. adolescent male kalenjin: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. adult male spinal: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. altered male physiologic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. apoe ko male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adult male mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. aging male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. aging male focus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. anopheles gambiae male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male wistar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. aging male treatment: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. advance transobturator male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. affecting male fertility: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. affected male demonstration: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. Limits of Equivalence: Thinking Gay Male Subjectivity Outside Feminist Theory

    E-Print Network [OSTI]

    Galloway, Samuel R.

    2010-01-01T23:59:59.000Z

    Limits of Equivalence: Thinking Gay Male Subjectivityor this limit of equivalence? The problem, of course, ispaper, the limits of equivalence emerge: while all subjects

  11. Management of Male Breast Cancer in the United States: A Surveillance, Epidemiology and End Results Analysis

    SciTech Connect (OSTI)

    Fields, Emma C., E-mail: emma.fields@ucdenver.edu [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States); DeWitt, Peter [Colorado Biostatistics Consortium, University of Colorado, Aurora, Colorado (United States); Fisher, Christine M.; Rabinovitch, Rachel [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States)

    2013-11-15T23:59:59.000Z

    Purpose: To analyze the stage-specific management of male breast cancer (MBC) with surgery and radiation therapy (RT) and relate them to outcomes and to female breast cancer (FBC). Methods and Materials: The Surveillance, Epidemiology, and End Results database was queried for all primary invasive MBC and FBC diagnosed from 1973 to 2008. Analyzable data included age, race, registry, grade, stage, estrogen and progesterone receptor status, type of surgery, and use of RT. Stage was defined as localized (LocD): confined to the breast; regional (RegD): involving skin, chest wall, and/or regional lymph nodes; and distant: M1. The primary endpoint was cause-specific survival (CSS). Results: A total of 4276 cases of MBC and 718,587 cases of FBC were identified. Male breast cancer constituted 0.6% of all breast cancer. Comparing MBC with FBC, mastectomy (M) was used in 87.4% versus 38.3%, and breast-conserving surgery in 12.6% versus 52.6% (P<10{sup ?4}). For males with LocD, CSS was not significantly different for the 4.6% treated with lumpectomy/RT versus the 70% treated with M alone (hazard ratio [HR] 1.33; 95% confidence interval [CI] 0.49-3.61; P=.57). Postmastectomy RT was delivered in 33% of males with RegD and was not associated with an improvement in CSS (HR 1.11; 95% CI 0.88-1.41; P=.37). There was a significant increase in the use of postmastectomy RT in MBC over time: 24.3%, 27.2%, and 36.8% for 1973-1987, 1988-1997, and 1998-2008, respectively (P<.0001). Cause-specific survival for MBC has improved: the largest significant change was identified for men diagnosed in 1998-2008 compared with 1973-1987 (HR 0.73; 95% CI 0.60-0.88; P=.0004). Conclusions: Surgical management of MBC is dramatically different than for FBC. The majority of males with LocD receive M despite equivalent CSS with lumpectomy/RT. Postmastectomy RT is greatly underutilized in MBC with RegD, although a CSS benefit was not demonstrated. Outcomes for MBC are improving, attributable to improved therapy and its use in this unscreened population.

  12. Regulation and Execution of Meiosis in Drosophh Males

    E-Print Network [OSTI]

    9 Regulation and Execution of Meiosis in Drosophh Males lean Maines and Steven Wasserm. Identification of Male Meiotic Mutant\\ IT. Regulation of the Meiotic Cell Divisions A. Entry into Meiosis B. Regulation of the Cell Cycle Machinery C. Coordination of Meio\\i\\ with Diflerentiation D. Regulation

  13. Adult Female English Language Learners: Investment, Identity and Benefits 

    E-Print Network [OSTI]

    Wharton, Anna

    2013-07-31T23:59:59.000Z

    for investing in the English language. This study explores the self-recounted experiences of three adult female English language learners’ (ELLs) motivation for investing in English language learning, their identities and the benefits gained in a nonacademic...

  14. adult female mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 18 19 20 21 22 23 24 25 Next Page Last Page Topic Index 1 The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice MIT - DSpace...

  15. Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model

    E-Print Network [OSTI]

    Brinton, Roberta Diaz

    Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model and suggests therapeutic targets for prevention of AD. ABAD aging bioenergetics brain hypometabolism mitochondria The essential role of mitochondria in cellular bioenergetics and survival has been well

  16. Communication Standards for the Female Technical Sales Professional

    E-Print Network [OSTI]

    Macke, Brenda

    2005-12-16T23:59:59.000Z

    Communication techniques to be used by female technical sales professionals (FTSP) with clients were explored by researching gender communication, technical communication, and sales communication. It was found that by ...

  17. Fertility, Female Participation in Employment and Reconciliation Policies in Spain 

    E-Print Network [OSTI]

    Ibanez, Marta

    2010-01-01T23:59:59.000Z

    Different aspects of decisions regarding parenthood are analysed. From an institutional perspective, reconciliation policies and features of the female labour market are studied, as well as the values and life views that ...

  18. Diet composition and performance of female collegiate soccer players 

    E-Print Network [OSTI]

    Clark, Mandy Michele

    2001-01-01T23:59:59.000Z

    intake. In conclusion, female soccer players appear to meet caloric needs during periods of training, but fail to meet minimum CHO and micronutrient recommendations. Foods higher in protein and fat, in addition to foods with low nutrient value may...

  19. The effects of ethylene dibromide on the reproductive system of male mice and male rabbits

    E-Print Network [OSTI]

    Hess, Kay

    1978-01-01T23:59:59.000Z

    Ethylene dibromide (EDB) is used as an addit1ve in leaded gasolines, as a fumigant and pesticide, as a solvent and as an intermediate to various products. But recently, due to some speculat1on, concern has grown over the possible effects of EDB... has terminated in ei ther conflicting reports or unpublished data. The newspapers caption front page articles--"Worries Are Growing Over Male Infertility Because of Job Hazards". And due to growing I Citations used on the following pages follow...

  20. The relationship of male socialization and personality pathology in male batterer subtypes

    E-Print Network [OSTI]

    Shefferman, Lee

    2007-09-17T23:59:59.000Z

    invaluable. I always joked that you were my Texas mother and yet there is a lot of truth in that statement. You fed me (love the wine mushrooms) and looked out for me. I would also like to thank John Wagner for sitting me down and giving me a talking... techniques may not be the sole or most effective 9 therapeutic intervention for treating male batterers. Specifically, such a finding may provide further evidence for the need to tailor treatment approaches based on batterer subtype and to consider...

  1. Electric current locator

    DOE Patents [OSTI]

    King, Paul E. (Corvallis, OR); Woodside, Charles Rigel (Corvallis, OR)

    2012-02-07T23:59:59.000Z

    The disclosure herein provides an apparatus for location of a quantity of current vectors in an electrical device, where the current vector has a known direction and a known relative magnitude to an input current supplied to the electrical device. Mathematical constants used in Biot-Savart superposition equations are determined for the electrical device, the orientation of the apparatus, and relative magnitude of the current vector and the input current, and the apparatus utilizes magnetic field sensors oriented to a sensing plane to provide current vector location based on the solution of the Biot-Savart superposition equations. Description of required orientations between the apparatus and the electrical device are disclosed and various methods of determining the mathematical constants are presented.

  2. SWET for the Summit: Exploration of Singapore’s First All-female Mount Everest Team

    E-Print Network [OSTI]

    Goh, Tan Leng

    2009-01-01T23:59:59.000Z

    FEMALE MOUNT EVEREST TEAM SWET for the Summit: ExplorationAll-female Mount Everest Team Tan Leng Goh California Statecommunity. The first all female team to summit Mount Everest

  3. A Crack in the Pipeline: Why Female Underrepresented Racial Minority Students Leave Engineering

    E-Print Network [OSTI]

    Vazquez-Akim, Jenn

    2014-01-01T23:59:59.000Z

    Espinosa, Lorelle L. (2011). Pipelines and pathways: womenAngeles A Crack in the Pipeline: Why Female UnderrepresentedA Crack in the Pipeline: Why Female Underrepresented Racial

  4. Exploration of pathways related to the decline in female circumcision in Egypt

    E-Print Network [OSTI]

    Modrek, Sepideh; Liu, Jenny X

    2013-01-01T23:59:59.000Z

    decline in female circumcision in Egypt. BMC Public HealthFemale circumcision in Egypt: social implications, currentfemale circumcision in Egypt: evidence and interpretation.

  5. Ultracapacitor current collector

    DOE Patents [OSTI]

    Jerabek, Elihu Calfin (Glenmont, NY); Mikkor, Mati (Ann Arbor, MI)

    2001-10-16T23:59:59.000Z

    An ultracapacitor having two solid, nonporous current collectors, two porous electrodes separating the collectors, a porous separator between the electrodes and an electrolyte occupying the pores in the electrodes and separator. At least one of the current collectors comprises a conductive metal substrate coated with a metal nitride, carbide or boride coating.

  6. Current to Current Corporation | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand JumpConceptual Model, clickInformationNew|CoreCpWing County,ElectricCumingCurrent Group,LLC

  7. Current to Current | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand JumpConceptual Model, clickInformationNew|CoreCpWing County,ElectricCumingCurrent Group,LLCto

  8. SWORDTAIL MATE CHOICE AND REPRODUCTIVE ALLOCATION: EFFECTS OF MALE CONDITION

    E-Print Network [OSTI]

    Simpson, Suzanne

    2011-04-26T23:59:59.000Z

    were placed on a ?High-food? (HF) or ?Low-food? (LF) diet with 30 HF and 30 LF. Within each group (HF or LF) the males were then divided into tanks with 5 males per tank. Thus we had 6 HF replicates and 6 LF replicates. The males were consistently fed... of covariance GLM Generalized linear model GLMM Generalized linear mixed model HF High-food LF Low-food R Statistical program used for data analysis vi TABLE OF CONTENTS Page ABSTRACT...

  9. adolescent male health: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROMOTION AMONG RACIAL AND ETHNIC MINORITY MALES Funding Opportunity Number: PA-10-236. CFDA Number(s): 93.361, 93.847, 93.837, 93.399. Engineering Websites Summary: initial and...

  10. Alternative mating tactics and extreme male dimorphism in fig wasps. 

    E-Print Network [OSTI]

    Cook, James M; Compton, Steven G; Herre, E Allen; West, Stuart A

    1997-01-01T23:59:59.000Z

    The dimorphisms in morphology and behaviour of male fig wasps are among the most extreme in the animal kingdom, and offer excellent oppotunities to test the predictions of certain sexual selection models.

  11. Current control circuitry

    DOE Patents [OSTI]

    Taubman, Matthew S. (Richland, WA)

    2005-03-15T23:59:59.000Z

    Among the embodiments of the present invention is an apparatus that includes a transistor (30), a servo device (40), and a current source (50). The servo device (40) is operable to provide a common base mode of operation of the transistor (30) by maintaining an approximately constant voltage level at the transistor base (32b). The current source (150) is operable to provide a bias current to the transistor (30). A first device (24) provides an input signal to an electrical node (70) positioned between the emitter (32e) of the transistor (30) and the current source (50). A second device (26) receives an output signal from the collector (32c) of the transistor (30).

  12. Geothermal Energy: Current abstracts

    SciTech Connect (OSTI)

    Ringe, A.C. (ed.)

    1988-02-01T23:59:59.000Z

    This bulletin announces the current worldwide information available on the technologies required for economic recovery of geothermal energy and its use as direct heat or for electric power production. (ACR)

  13. Photocatalysis Currently, the research

    E-Print Network [OSTI]

    Vollmer, Heribert

    Photocatalysis Currently, the research activit in the area ofies Photocatalysis focus on the topics Photocatalysis and Prof. Dr. Detlef Bahnemann Nanotechnology Research Topics Bioprocess Engineering Bioprocess Modeling and Control Photocatalysis and Nanotechnology Institute of Technical Chemistry Contact Person

  14. Zinc levels in hair of pre-adolescent females

    E-Print Network [OSTI]

    Earp, Cheryl Fricke

    1978-01-01T23:59:59.000Z

    values in the same row, bearing a, common super- script letter, are not (P+. 05) significantly different. 29 Figure 3. Zinc Content of Hair from Medium Income Females According to Age and Ethnic Origin. IOyr. olds 9 yr. olds cd I I yr. olds l50... loo Negro Ethnic Origin Mexican CaUcasian 31 Figure 4. Zinc Content oi Hair from Low Income Females According to age and Ethnic Origin. 9yr. olds O z lO r O C N II yr, olds 100 Negro Ethnic Origin Mexican Caucasian The hair zinc means...

  15. Female Health Issues: Part I Gynecological Dif:iculties

    E-Print Network [OSTI]

    Dever, Jennifer A.

    care provider B. The Progressive Era (1890's-1920's) · Reformers worked to change availability of prenatal & child health care #12;10/29/12 3 C. 60's & 70's redefining10/29/12 1 Female Health Issues: Part I ­ Gynecological Dif:iculties I

  16. A Female Homo erectus Pelvis from Gona, Ethiopia

    E-Print Network [OSTI]

    Utrecht, Universiteit

    A Female Homo erectus Pelvis from Gona, Ethiopia Scott W. Simpson,1,2 Jay Quade,3 Naomi E. Levin,4 of Gona, Afar, Ethiopia. This obstetrically capacious pelvis demonstrates that pelvic shape in H. erectus), in the Gona Paleoanthropological Research Project study area in the Afar Regional State, Ethiopia (Fig. 1

  17. Fault current limiter

    DOE Patents [OSTI]

    Darmann, Francis Anthony

    2013-10-08T23:59:59.000Z

    A fault current limiter (FCL) includes a series of high permeability posts for collectively define a core for the FCL. A DC coil, for the purposes of saturating a portion of the high permeability posts, surrounds the complete structure outside of an enclosure in the form of a vessel. The vessel contains a dielectric insulation medium. AC coils, for transporting AC current, are wound on insulating formers and electrically interconnected to each other in a manner such that the senses of the magnetic field produced by each AC coil in the corresponding high permeability core are opposing. There are insulation barriers between phases to improve dielectric withstand properties of the dielectric medium.

  18. Current Solicitations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublicCurrent ProjectsCurrentDOE -

  19. Current Wind Power Capacity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublicCurrent ProjectsCurrentDOE

  20. Current Schedule of Experiments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItem NotEnergy,ARMFormsGas SeparationsRelevant toSiteCurrent Long-Term OperatingCurrent

  1. Hydrogen Delivery- Current Technology

    Broader source: Energy.gov [DOE]

    Hydrogen is transported from the point of production to the point of use via pipeline, over the road in cryogenic liquid trucks or gaseous tube trailers, or by rail or barge. Read on to learn more about current hydrogen delivery and storage technologies.

  2. Current address: Samuel Johnson

    E-Print Network [OSTI]

    Johnson, Samuel

    CV: E-mail : Homepage: Current address: Samuel Johnson samuel.johnson@imperial.ac.uk www. #12;Submitted work 1. The meaning of niche: Cause or consequence of food-web structure?, S. Johnson, V learning, S. Johnson, J. Marro, and J.J. Torres, PLoS ONE 8(1): e50276 (2013) 3. Enhancing neural network

  3. Aternating current photovoltaic building block

    DOE Patents [OSTI]

    Bower, Ward Issac; Thomas, Michael G.; Ruby, Douglas S.

    2004-06-15T23:59:59.000Z

    A modular apparatus for and method of alternating current photovoltaic power generation comprising via a photovoltaic module, generating power in the form of direct current; and converting direct current to alternating current and exporting power via one or more power conversion and transfer units attached to the module, each unit comprising a unitary housing extending a length or width of the module, which housing comprises: contact means for receiving direct current from the module; one or more direct current-to-alternating current inverters; an alternating current bus; and contact means for receiving alternating current from the one or more inverters.

  4. High current ion source

    DOE Patents [OSTI]

    Brown, Ian G. (1088 Woodside Rd., Berkeley, CA 94708); MacGill, Robert A. (645 Kern St., Richmond, CA 94805); Galvin, James E. (2 Commodore Dr. #276, Emeryville, CA 94608)

    1990-01-01T23:59:59.000Z

    An ion source utilizing a cathode and anode for producing an electric arc therebetween. The arc is sufficient to vaporize a portion of the cathode to form a plasma. The plasma leaves the generation region and expands through another regon. The density profile of the plasma may be flattened using a magnetic field formed within a vacuum chamber. Ions are extracted from the plasma to produce a high current broad on beam.

  5. Women & early-stage entrepreneurship : examining the impact of the venture funding crisis on male and female-led technology start-ups

    E-Print Network [OSTI]

    Swaminathan, Shuba

    2010-01-01T23:59:59.000Z

    Women in technology have always been a minority and the number of women who are founders of venture backed start-ups is even lower. This research empirically investigates venture capital funding received by entrepreneurs ...

  6. An exploratory study of the effects of job characteristics on wage determination and wage differentials between workers in male-dominated and female-dominated occupations

    E-Print Network [OSTI]

    Allen, William Keith

    1984-01-01T23:59:59.000Z

    in construct validity. Past studies in the area of wage determination and wage differentials have ttvually looked at wage differentials between men and women. After the introduction of legislation such as the Equal Pay Act of 1963 and Title VII of the Civil... the passage oi' the Equal Pay Act of 1963 and at that time it wss not unusual to find men receiving higher wages than women for virtually the same work). The results of studies by McNulty (1967) and Buckley (1971) support Fuchs' (1971) findings...

  7. Fiona R.L. Burford Peter K. McGregor Rui F. Oliveira Male-like mudballing behavior of some female fiddler crabs (Uca tangeri)

    E-Print Network [OSTI]

    are carried from within the burrow to the mudflat surface and placed in the area surrounding the burrow

  8. Quantitative genetics of growth, carcass-quality traits, and disease resistance in hybrid striped bass (Morone chrysops [female] x Morone saxatilis [male])

    E-Print Network [OSTI]

    Wang, Xiaoxue

    2009-05-15T23:59:59.000Z

    A 10 x 10 factorial mating design and a ‘common-garden’ rearing approach were employed to examine genetic effects and heritability of growth, carcass-quality traits, and disease resistance, important production traits in the aquaculture of hybrid...

  9. Race and Male Employment in the Wake of the Great Recession

    E-Print Network [OSTI]

    Saldin, Dilano

    Race and Male Employment in the Wake of the Great Recession: Black Male Employment Rates by this Center), nearly half of working-age black males were not employed in many inner city neighborhoods.1 another devastating blow to inner city economies and the employment prospects of African American males

  10. The female protagonists in the novels of Romulo Gallegos

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  11. The female protagonists in the novels of Romulo Gallegos 

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  12. The evolution of infanticide by males in mammalian societies

    E-Print Network [OSTI]

    Lukas, Dieter; Huchard, Elise

    2014-11-14T23:59:59.000Z

    of social monogamy in mammals. Science 341, 526-530 (2013). 10. C. Opie, Q. D. Atkinson, R. I. M. Dunbar, S. Schultz, Male infanticide leads to social monogamy in mammals. Proc. Natl. Acad. Sci. U. S. A. 110, 13328-13332 (2013). 11. G. R. Pradhan, C. P. Van...

  13. Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini)

    E-Print Network [OSTI]

    Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini) Simone C 2011 ­ Accepted 23 June 2011 Abstract ­ Several groups of solitary bees, known as oil-collecting bees, oil-collecting bees belong to the tribes Centridini, Tapinotaspidini, and Tetrapediini (Apidae: Apinae

  14. Commercial Current Promotions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power Administration would like submit the following commentsCurrent-Promotions Sign In About |

  15. An Analysis of Three White Male High School Assistant Principal Perceptions of Black Males Students in a Suburban District

    E-Print Network [OSTI]

    Ragsdale, Laura Anne

    2013-05-09T23:59:59.000Z

    Introduction ????.????????????????.. 28 Employment ????????????????????.. 31 Equity of Salary and Low Wages ????????????. 37 Mobility ?????????????????????? 38 Structure of a Nuclear Family ?????????????.. 41 Discrimination in Society...-Identification ???????????????.??? 57 ?Acting White? ???????????????????. 61 Discipline ?????????????????????.. 65 Theories Impacting Achievement of Black Males ?????????. 71 Discrimination and Prejudice in Society ?????????... 71 Expectations by Schools...

  16. Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective

    E-Print Network [OSTI]

    Fedigan, Linda M.

    Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective MARY S; reproductive termination ABSTRACT This study explores the question of reproductive termination (loss used a large sample of completed lives to identify reproductively terminated female Japanese macaques

  17. Maternal Diet-induced Obesity Programs Cardiovascular Dysfunction in Adult Male Mouse Offspring Independent of Current Body Weight

    E-Print Network [OSTI]

    Blackmore, Heather L.; Niu, Youguo; Fernandez-Twinn, Denise S.; Tarry-Adkins, Jane L.; Giussani, Dino A.; Ozanne, Susan E.

    2014-07-22T23:59:59.000Z

    of age) were weaned ad libitium onto standard laboratory chow [RM1 (Spe- cial Dietary Services)]. At 3, 5, and 8 weeks of age mice were culled after an overnight fast by carbon dioxide asphyxiation. Due to the requirements of the isolated Langendorff... in both the chronotropic and inotropic response to sympathetic stimulation (33, 34) and are involved in calcium mobilization. Concurrent with the functional sympathetic dominance, protein levels of the #2;1 adrenergic receptor were increased in hearts...

  18. Maternal diet-induced obesity programmes cardiovascular dysfunction in adult male mouse offspring independent of current body weight

    E-Print Network [OSTI]

    Blackmore, Heather L.; Niu, Youguo; Fernandez-Twinn, Denise S.; Tarry-Adkins, Jane L.; Giussani, Dino A.; Ozanne, Susan E.

    2014-07-18T23:59:59.000Z

    health and disease. N Engl J Med. 2008;359(1):61–73. 5. Giussani DA, Davidge ST. Developmental programming of cardio- vascular disease by prenatal hypoxia. J Dev Orig Health Dis. 2013; 6(5):328–337. 6. Reynolds RM, Allan KM, Raja EA, et al. Maternal...

  19. Oscillatory nonohomic current drive for maintaining a plasma current

    DOE Patents [OSTI]

    Fisch, N.J.

    1984-01-01T23:59:59.000Z

    Apparatus and methods are described for maintaining a plasma current with an oscillatory nonohmic current drive. Each cycle of operation has a generation period in which current driving energy is applied to the plasma, and a relaxation period in which current driving energy is removed. Plasma parameters, such as plasma temperature or plasma average ionic charge state, are modified during the generation period so as to oscillate plasma resistivity in synchronism with the application of current driving energy. The invention improves overall current drive efficiencies.

  20. The fundamental properties of current controlled current source amplifiers

    E-Print Network [OSTI]

    Terry, Michael Buford

    1978-01-01T23:59:59.000Z

    The thesis studies the fundamental properties of current controlled current source (CCCS) amplifiers for use in a wide bandwidth voltage gain application. Theoretical expressions are derived which describe the p'erformance of the CCCS in terms of circuit... of this research was to conduct a theoretical and experimental study of the fundamental properties of Current Controlled Current Source (CCCS) amplifiers. Of particular interest was the bandwidth independence on the closed loop voltage gain of the CCCS used...

  1. Stray current interference control for HVDC earth currents

    SciTech Connect (OSTI)

    Fitzgerald, J.H. III [PSG Corrosion Engineering/Corrpro Cos., Detroit, MI (United States); Kroon, D.H. [Corrpro Companies Inc., Spring, TX (United States)

    1995-06-01T23:59:59.000Z

    High-voltage direct current (HVDC) transmission lines exist around the world, with several in the US. When one conductor must be taken out of operation (in case of emergency), the earth may be used as an alternate conductor. The earth current may be accumulated on and discharged from underground metallic structures that cross the voltage gradient created by the current. Test results on two lines showed that stray current interference is not a major problem if mitigated properly.

  2. Berries Bittersweet: Visual Representations of Black Female Sexuality in Contemporary American Pornography

    E-Print Network [OSTI]

    Cruz, Ariane Renee

    2010-01-01T23:59:59.000Z

    moving image porn featuring gay male anal penetration usings Anal Show (1-5). Renowned originator of gonzo porn, John

  3. Circulating current battery heater

    DOE Patents [OSTI]

    Ashtiani, Cyrus N. (West Bloomfield, MI); Stuart, Thomas A. (Toledo, OH)

    2001-01-01T23:59:59.000Z

    A circuit for heating energy storage devices such as batteries is provided. The circuit includes a pair of switches connected in a half-bridge configuration. Unidirectional current conduction devices are connected in parallel with each switch. A series resonant element for storing energy is connected from the energy storage device to the pair of switches. An energy storage device for intermediate storage of energy is connected in a loop with the series resonant element and one of the switches. The energy storage device which is being heated is connected in a loop with the series resonant element and the other switch. Energy from the heated energy storage device is transferred to the switched network and then recirculated back to the battery. The flow of energy through the battery causes internal power dissipation due to electrical to chemical conversion inefficiencies. The dissipated power causes the internal temperature of the battery to increase. Higher internal temperatures expand the cold temperature operating range and energy capacity utilization of the battery. As disclosed, either fixed frequency or variable frequency modulation schemes may be used to control the network.

  4. Factors Influencing a Female’s Selection of a Construction Management Degree: A Study of Junior- and Senior-Level Undergraduate Students

    E-Print Network [OSTI]

    Ritter, Lisa M

    2014-07-24T23:59:59.000Z

    the industry so they may tap into this market segment. Many influential factors have been identified as to a female’s decision to pursue a career in the construction industry, starting with their decision to pursue an undergraduate construction management (CM...

  5. Current Awards | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Laser User Facilities Program Current Awards Current Awards National Laser Users' Facility Grant Program Current Awards Under Construction...

  6. Current Awards | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Stewardship Science Academic Alliances Program Current Awards Current Awards Stewardship Science Academic Alliances (SSAA) Program Current Awards Under Construction...

  7. ORIGINAL PAPER A lover, not a fighter: mating causes male crickets

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    studies have examined the effects of mating experience on agonistic behaviour, despite the fact that dominant males usually acquire more matings. We investigated the effect of mating experience on male weapon size) and conducted two experiments. In the first, we varied male mating experience by allowing

  8. Adenosine analogs inhibit fighting in isolated male mice

    SciTech Connect (OSTI)

    Palmour, R.M.; Lipowski, C.J.; Simon, C.K.; Ervin, F.R.

    1989-01-01T23:59:59.000Z

    The potent adenosine analogs N-ethylcarboxamide adenosine (NECA) and phenylisopropyladenosine (PIA) inhibit fighting and associated agonistic behaviors in isolated male mice. These effects are reversed by methylxanthines; moderate doses of NECA which inhibit fighting have minimal effects on spontaneous locomotor activity. At very low doses, both NECA and PIA increase fighting in parallel with previously reported increases of motor activity. Brain levels of (/sup 3/H)-NECA and (/sup 3/H)-PIA achieved at behaviorally effective doses suggest an involvement of adenosine receptors. The biochemical mechanism of adenosine receptor action with respect to fighting is unknown, but may include neuromodulatory effects on the release of other, more classical neurotransmitters.

  9. Fault current limiter and alternating current circuit breaker

    DOE Patents [OSTI]

    Boenig, H.J.

    1998-03-10T23:59:59.000Z

    A solid-state circuit breaker and current limiter are disclosed for a load served by an alternating current source having a source impedance, the solid-state circuit breaker and current limiter comprising a thyristor bridge interposed between the alternating current source and the load, the thyristor bridge having four thyristor legs and four nodes, with a first node connected to the alternating current source, and a second node connected to the load. A coil is connected from a third node to a fourth node, the coil having an impedance of a value calculated to limit the current flowing therethrough to a predetermined value. Control means are connected to the thyristor legs for limiting the alternating current flow to the load under fault conditions to a predetermined level, and for gating the thyristor bridge under fault conditions to quickly reduce alternating current flowing therethrough to zero and thereafter to maintain the thyristor bridge in an electrically open condition preventing the alternating current from flowing therethrough for a predetermined period of time. 9 figs.

  10. Ionization tube simmer current circuit

    DOE Patents [OSTI]

    Steinkraus, Jr., Robert F. (Livermore, CA)

    1994-01-01T23:59:59.000Z

    A highly efficient flash lamp simmer current circuit utilizes a fifty percent duty cycle square wave pulse generator to pass a current over a current limiting inductor to a full wave rectifier. The DC output of the rectifier is then passed over a voltage smoothing capacitor through a reverse current blocking diode to a flash lamp tube to sustain ionization in the tube between discharges via a small simmer current. An alternate embodiment of the circuit combines the pulse generator and inductor in the form of an FET off line square wave generator with an impedance limited step up output transformer which is then applied to the full wave rectifier as before to yield a similar simmer current.

  11. Ionization tube simmer current circuit

    DOE Patents [OSTI]

    Steinkraus, R.F. Jr.

    1994-12-13T23:59:59.000Z

    A highly efficient flash lamp simmer current circuit utilizes a fifty percent duty cycle square wave pulse generator to pass a current over a current limiting inductor to a full wave rectifier. The DC output of the rectifier is then passed over a voltage smoothing capacitor through a reverse current blocking diode to a flash lamp tube to sustain ionization in the tube between discharges via a small simmer current. An alternate embodiment of the circuit combines the pulse generator and inductor in the form of an FET off line square wave generator with an impedance limited step up output transformer which is then applied to the full wave rectifier as before to yield a similar simmer current. 6 figures.

  12. Geomagnetically Induced Currents / Telluric Currents and Potential for Power

    E-Print Network [OSTI]

    Schrijver, Karel

    Geomagnetically Induced Currents / Telluric Currents and Potential for Power System Impacts from System Impacts for Extreme Size Storm Events #12;Space Weather ­ GIC & Power System Impacts Overview Aspects of Future Grid Expansion are Unsettled One Concept ~7 times increase in US 765kV Transmission

  13. Smart Home Concepts: Current Trends

    E-Print Network [OSTI]

    Venkatesh, Alladi

    2003-01-01T23:59:59.000Z

    Smart Home Concepts: Current Trends Alladi Venkatesh Ph.D.developments concerning smart home technologies and theirNews (Southern Report): Smart homes and high-tech clothing

  14. Spring Chinook Salmon Interactions Indices and Residual/Precocious Male Monitoring in the Upper Yakima Basin; Yakima/Klickitat Fisheries Project Monitoring and Evaluation, 2004-2005 Annual Report.

    SciTech Connect (OSTI)

    Pearsons, Todd N.; Johnson, Christopher L. (Washington Department of Fish and Wildlife, Olympia, WA); James, Brenda B. (Cascade Aquatics, Ellensburg, WA)

    2005-05-01T23:59:59.000Z

    This report examines some of the factors that can influence the success of supplementation, which is currently being tested in the Yakima Basin using upper Yakima stock of spring chinook salmon. Supplementation success in the Yakima Basin is defined relative to four topic areas: natural production, genetics, ecological interactions, and harvest (Busack et al. 1997). The success of spring chinook salmon supplementation in the Yakima Basin is dependent, in part, upon fish culture practices and favorable physical and biological conditions in the natural environment (Busack et al. 1997; James et al. 1999; Pearsons et al., 2003; Pearsons et al. 2004). Shortfalls in either of these two topics (i.e., failure in culturing many fish that have high long-term fitness or environmental conditions that constrain spring chinook salmon production) will cause supplementation success to be limited. For example, inadvertent selection or propagation of spring chinook that residualize or precocially mature may hinder supplementation success. Spring chinook salmon that residualize (do not migrate during the normal migration period) may have lower survival rates than migrants and, additionally, may interact with wild fish and cause unacceptable impacts to non-target taxa. Large numbers of precocials (nonanadromous spawners) may increase competition for females and significantly skew ratios of offspring sired by nonanadromous males, which could result in more nonanadromous spring chinook in future generations. Conditions in the natural environment may also limit the success of spring chinook supplementation. For example, intra or interspecific competition may constrain spring chinook salmon production. Spring chinook salmon juveniles may compete with each other for food or space or compete with other species that have similar ecological requirements. Monitoring of spring chinook salmon residuals, precocials, prey abundance, carrying capacity, and competition will help researchers interpret why supplementation is working or not working (Busack et al. 1997). Monitoring ecological interactions will be accomplished using interactions indices. Interactions indices will be used to index the availability of prey and competition for food and space. The tasks described below represent various subject areas of juvenile spring chinook salmon monitoring but are treated together because they can be accomplished using similar methods and are therefore more cost efficient than if treated separately. Topics of investigation we pursued in this work were: (1) strong interactor monitoring (competition index and prey index), (2) carrying capacity monitoring (microhabitat monitoring); (3) residual and precocious male salmon monitoring (abundance); (4) performance of growth modulation in reducing precocious males during spawning; (5) incidence of predation by residualized chinook salmon; and (6) benefits of salmon carcasses to juvenile salmonids. This report is organized into six chapters to represent these topics of investigation. Data were collected during the summer and fall, 2004 in index sections of the upper Yakima Basin (Figure 1). Previous results on the topics in this report were reported in James et al. (1999), and Pearsons et al. (2003; 2004). Hatchery-reared spring chinook salmon were first released during the spring of 1999. The monitoring plan for the Yakima/Klickitat Fisheries Project calls for the continued monitoring of the variables covered in this report. All findings in this report should be considered preliminary and subject to further revision as more data and analytical results become available.

  15. Anomalous-viscosity current drive

    DOE Patents [OSTI]

    Stix, T.H.; Ono, M.

    1986-04-25T23:59:59.000Z

    The present invention relates to a method and apparatus for maintaining a steady-state current for magnetically confining the plasma in a toroidal magnetic confinement device using anomalous viscosity current drive. A second aspect of this invention relates to an apparatus and method for the start-up of a magnetically confined toroidal plasma.

  16. Embryonic effects transmitted by male mice irradiated with 512 MeV/u {sup 56}Fe nuclei

    SciTech Connect (OSTI)

    Wiley, L.M.; Van Beek, M.E.A.B.; Raabe, O.G.

    1994-06-01T23:59:59.000Z

    High-energy, high-charge nuclei may contribute substantially to the yearly equivalent dose in space flight from galactic cosmic radiation (GCR) at solar minimum. The largest single heavy-ion component is {sup 56}Fe. We used the mouse embryo chimera assay to test 512 MeV/u {sup 56}Fe nuclei for effects on the rate of proliferation of embryonic cells transmitted by sperm from irradiated mice. Male CD1 mice were acutely irradiated with 0.01, 0.05, or 0.1 Gy (LET, 184 keV/{mu}m; fluence, 3.5 x 10{sup 4}-3.3 x 10{sup 5} nuclei/cm{sup 2}; average dose rate, 0.02 Gy/min) at the Lawrence Berkeley Laboratory BEVATRON/BEVALAC Facility in Berkeley, CA. Irradiated males were bred weekly for 7 weeks to nonirradiated females and their four-cell embryos were paired with control embryos, forming aggregation chimeras. After 30-35 h of culture, chimeras were dissociated to obtain {open_quotes}proliferation ratios{close_quotes} (number of cells contributed by the embryo from the irradiated male/total number of cells in the chimera). Significant dose-dependent decreases in proliferation ratios were obtained across all three dose groups for postirradiation week 2 (P < 0.05 to P < 0.003). The 0.01- and 0.05-Gy dose groups also produced significant decreases in proliferation ratios for postirradiation week 1 (P < 0.05 to P < 0.01) and the 0.05-Gy dose group produced significant decreases in proliferation ratios for postirradiation week 6 (P < 0.05). Postirradiation weeks 1, 2 and 6 correspond to irradiation of epididymal sperm, testicular spermatids and spermatogonia, respectively. We calculate that only about 5% of sperm in the 0.1-Gy, 2.5% in the 0.05-Gy and 0.5% in the 0.01-Gy dose groups sustained direct hits from {sup 56}Fe nuclei. However, up to 47% of sperm during postirradiation weeks 1 and 2 transmitted proliferation ratios that were at or below one standard deviation from control mean proliferation ratios. 26 refs., 4 figs., 10 tabs.

  17. Current

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China U.S. DepartmentEnergy This partAsAmandaRev. 1) | DepartmentDepartmentDollars in

  18. Current

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power Administration would likeConstitution4 Department ofDepartment of EnergyCuring

  19. Passive fault current limiting device

    DOE Patents [OSTI]

    Evans, Daniel J. (Wheeling, IL); Cha, Yung S. (Darien, IL)

    1999-01-01T23:59:59.000Z

    A passive current limiting device and isolator is particularly adapted for use at high power levels for limiting excessive currents in a circuit in a fault condition such as an electrical short. The current limiting device comprises a magnetic core wound with two magnetically opposed, parallel connected coils of copper, a high temperature superconductor or other electrically conducting material, and a fault element connected in series with one of the coils. Under normal operating conditions, the magnetic flux density produced by the two coils cancel each other. Under a fault condition, the fault element is triggered to cause an imbalance in the magnetic flux density between the two coils which results in an increase in the impedance in the coils. While the fault element may be a separate current limiter, switch, fuse, bimetal strip or the like, it preferably is a superconductor current limiter conducting one-half of the current load compared to the same limiter wired to carry the total current of the circuit. The major voltage during a fault condition is in the coils wound on the common core in a preferred embodiment.

  20. Passive fault current limiting device

    DOE Patents [OSTI]

    Evans, D.J.; Cha, Y.S.

    1999-04-06T23:59:59.000Z

    A passive current limiting device and isolator is particularly adapted for use at high power levels for limiting excessive currents in a circuit in a fault condition such as an electrical short. The current limiting device comprises a magnetic core wound with two magnetically opposed, parallel connected coils of copper, a high temperature superconductor or other electrically conducting material, and a fault element connected in series with one of the coils. Under normal operating conditions, the magnetic flux density produced by the two coils cancel each other. Under a fault condition, the fault element is triggered to cause an imbalance in the magnetic flux density between the two coils which results in an increase in the impedance in the coils. While the fault element may be a separate current limiter, switch, fuse, bimetal strip or the like, it preferably is a superconductor current limiter conducting one-half of the current load compared to the same limiter wired to carry the total current of the circuit. The major voltage during a fault condition is in the coils wound on the common core in a preferred embodiment. 6 figs.

  1. The Effects of Alcohol and Age on Astrocytes In Female Rats Following an Inflammatory Stimulus

    E-Print Network [OSTI]

    Simpson, Ashley

    2009-09-30T23:59:59.000Z

    THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING AN INFLAMMATORY STIMULUS A Senior Scholars Thesis by ASHLEY NICOLE SIMPSON Submitted to the Office of Undergraduate Research Texas A...&M University In partial fulfillment of the requirements for the designation as UNDERGRADUATE RESEARCH SCHOLAR April 2006 Major: Biology THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING...

  2. IMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK DIETS WITH

    E-Print Network [OSTI]

    tested, menhaden fish oil provided female white bass broodstock the fatty acids (~3.9% n-3 long fish oil are essential for embryonic survival, sunshine bass appear to have lower n-3 LCIMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK

  3. Why have there been so few female Nobel laureates in science and just

    E-Print Network [OSTI]

    Barbosa, Marcia C. B.

    Why have there been so few female Nobel laureates in science ­ and just two in physics? The usual werecausedbyoxidationatthetipsof thecarbonanodes.Shetookoutmany patents for searchlights and cinema projectors, and in 1902 be secondary." She ended up abandoning science. But being single did not make the life of the female scientist

  4. Current balancing for battery strings

    DOE Patents [OSTI]

    Galloway, James H. (New Baltimore, MI)

    1985-01-01T23:59:59.000Z

    A battery plant is described which features magnetic circuit means for balancing the electrical current flow through a pluraliircuitbattery strings which are connected electrically in parallel. The magnetic circuit means is associated with the battery strings such that the conductors carrying the electrical current flow through each of the battery strings pass through the magnetic circuit means in directions which cause the electromagnetic fields of at least one predetermined pair of the conductors to oppose each other. In an alternative embodiment, a low voltage converter is associated with each of the battery strings for balancing the electrical current flow through the battery strings.

  5. Numerical solution of transient eddy current problems with input current intensities as boundary data

    E-Print Network [OSTI]

    Rodríguez, Rodolfo

    Numerical solution of transient eddy current problems with input current intensities as boundary to solve transient eddy current problems with input current intensities as data, formulated in terms: Eddy current problems, time-dependent electromagnetic problems, input current intensities, finite

  6. Current Awards | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    High Energy Density Laboratory Plasmas Current Awards Current Awards High Energy Density Laboratory Plasmas (HEDLP) Program Current Awards Supported by NNSA Name Affiliation...

  7. Magneto-optic current sensor

    DOE Patents [OSTI]

    Lanagan, Michael T.; Valsko-Vlasov, Vitalii K.; Fisher, Brandon L.; Welp, Ulrich

    2003-10-07T23:59:59.000Z

    An optical current transducer configured to sense current in the conductor is disclosed. The optical current transducer includes a light source and a polarizer that generates linearly polarized light received from a the light source. The light is communicated to a magneto-optic garnet that includes, among other elements, bismuth, iron and oxygen and is coupled to the conductor. The magneto-optic garnet is configured to rotate the polarization of the linearly polarized light received from the polarizer. The optical current transducer also includes an analyzer in optical communication with the magneto-optic garnet. The analyzer detects the rotation of the linearly polarized light caused by the magneto-optic garnet.

  8. A current density distribution tool

    E-Print Network [OSTI]

    Jagush, Frederic A.

    1989-01-01T23:59:59.000Z

    . I. INTRODUCTION Current density distribution is an important consideration for those involved in electrochemical systems and electroplating in particular. In the printed wiring board (PWB) business, great emphasis is placed on the study of current... exist. Numerical techniques on the other hand, are usually easy to implement and are easily applicable to microcomputers. Their disadvantage as with any approximation technique is that the exactness of the results with This document follows the style...

  9. aging male hypothalamic-pituitary-gonadal: Topics by E-print...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. advertisement-call modification male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. Human exploitation of male fiddler crab claws: behavioural consequences and implications for conservation

    E-Print Network [OSTI]

    during low tide and the major claw is pulled off and the male is then released on the mudflat. This human

  12. Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males

    E-Print Network [OSTI]

    Rüedi, Peter

    Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males on wild banded mongooses, Mungos mungo, suggests that overmarking may primarily affect behavioural mating

  13. Chemical mediation of male mate location behavior in the parasitoid Cardiochiles nigriceps (Hymenoptera: Braconidae)

    E-Print Network [OSTI]

    Syvertsen, Thomas Charles

    1992-01-01T23:59:59.000Z

    . nigriceps on the downwind edge of the slide (Figure 4). After the male became relaxed the air stream was turned on and the responses of the male were recorded with a video camera. Each male was allowed 1. 0 minute to respond. If the response was positive... and courtship was elicited no max- imum observation time was set and the behaviors were observed until the male dismounted the model. Video recordings of the experiments were re- played at a later time and events were logged with an event recorder. Courtship...

  14. The role of male-male relationships in partner violence treatment groups: the effects of improving same sex relationships on attachment

    E-Print Network [OSTI]

    Barnes, Ashley D.

    2009-05-15T23:59:59.000Z

    ; Gondolf, 1997; Holtzworth-Munroe & Meehan, 2004). Outcome research has demonstrated that of those males who completed treatment for domestic violence, recidivism rates ranged from 24% to 40% within 6 to 24 months 3 following termination (Gondolf...

  15. Electrochemically Stable Cathode Current Collectors for Rechargeable...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stable Cathode Current Collectors for Rechargeable Magnesium Batteries . Electrochemically Stable Cathode Current Collectors for Rechargeable Magnesium Batteries . Abstract:...

  16. Current responsive devices for synchronous generators

    DOE Patents [OSTI]

    Karlicek, R.F.

    1983-09-27T23:59:59.000Z

    A device for detecting current imbalance between phases of a polyphase alternating current generator. A detector responds to the maximum peak current in the generator, and detecting means generates an output for each phase proportional to the peak current of each phase. Comparing means generates an output when the maximum peak current exceeds the phase peak current. 11 figs.

  17. Variable current speed controller for eddy current motors

    DOE Patents [OSTI]

    Gerth, H.L.; Bailey, J.M.; Casstevens, J.M.; Dixon, J.H.; Griffith, B.O.; Igou, R.E.

    1982-03-12T23:59:59.000Z

    A speed control system for eddy current motors is provided in which the current to the motor from a constant frequency power source is varied by comparing the actual motor speed signal with a setpoint speed signal to control the motor speed according to the selected setpoint speed. A three-phase variable voltage autotransformer is provided for controlling the voltage from a three-phase power supply. A corresponding plurality of current control resistors is provided in series with each phase of the autotransformer output connected to inputs of a three-phase motor. Each resistor is connected in parallel with a set of normally closed contacts of plurality of relays which are operated by control logic. A logic circuit compares the selected speed with the actual motor speed obtained from a digital tachometer monitoring the motor spindle speed and operated the relays to add or substract resistance equally in each phase of the motor input to vary the motor current to control the motor at the selected speed.

  18. Eddy current scanning at Fermilab

    SciTech Connect (OSTI)

    Boffo, C.; Bauer, P.; Foley, M.; /Fermilab; Brinkmann, A.; /DESY; Ozelis, J.; /Jefferson Lab

    2005-07-01T23:59:59.000Z

    In the framework of SRF cavity development, Fermilab is creating the infrastructure needed for the characterization of the material used in the cavity fabrication. An important step in the characterization of ''as received'' niobium sheets is the eddy current scanning. Eddy current scanning is a non-destructive technique first adopted and further developed by DESY with the purpose of checking the cavity material for sub-surface defects and inclusions. Fermilab has received and further upgraded a commercial eddy current scanner previously used for the SNS project. The upgrading process included developing new filtering software. This scanner is now used daily to scan the niobium sheets for the Fermilab third harmonic and transverse deflecting cavities. This paper gives a status report on the scanning results obtained so far, including a discussion of the typology of signals being detected. We also report on the efforts to calibrate this scanner, a work conducted in collaboration with DESY.

  19. Current Students | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublicCurrent ProjectsCurrentDOE

  20. LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA)

    E-Print Network [OSTI]

    LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA) IN SHARK BAY Management Title of Thesis: Large-Scale Movement Patterns of Male Loggerhead Sea Turtles (Caretta caretta) in Shark Bay, Australia Report No. 524 Examining Committee: Chair: Christine Gruman Master of Resource

  1. Mechanisms of Mating-Behavior Deterioration in Early Aging Male C. elegans 

    E-Print Network [OSTI]

    Guo, Xiaoyan

    2014-08-06T23:59:59.000Z

    . This is consistent with the observation that old males exhibit reduced control over their ability to mate. Caloric restriction is an efficient non-genetic intervention to increase lifespan. I demonstrated here that it also improves mating behavior in 3-day-old males...

  2. Gene expression divergence and nucleotide differentiation between males of different color morphs and mating

    E-Print Network [OSTI]

    Gene expression divergence and nucleotide differentiation between males of different color morphs sequencing, it is possible to obtain data on both nucleotide sequence variation and gene expression. We have between males, but many genetic markers showed nucleotide differentiation between different color morphs

  3. The Conditional Effects of Female Descriptive Representation: A Study of Policy Influence in State Legislatures, 1983-2002

    E-Print Network [OSTI]

    Barnes, Mary Elizabeth

    2012-02-14T23:59:59.000Z

    (Phillips 1995; Weldon 2002). This study will examine female descriptive representation and incorporation and its effect on substantive representation of female group salient issues and answer the following research question: Does an increase in female...), but there is also a significant amount or literature negating this claim. Women may behave in an isolated manner when legislating and they may not be able to articulate what females as a group really want (Weldon 2002). There may be no way to establish...

  4. UNL WATER CENTER WATER CURRENT

    E-Print Network [OSTI]

    Nebraska-Lincoln, University of

    ................ Sidney Area Deals with Drought 6................ Water and Electricity Are Inseparable 10's East Campus. "Consolidating administration,faculty and staff and facilities is costeffectiveandper or commercial products constitute endorsement by the U.S. Government. WATER CURRENT Water Center University

  5. Optimization of Current Carrying Multicables

    E-Print Network [OSTI]

    Kraft, Hanspeter

    of electric devices in modern cars grows continuously whereas available space remains the same or even reduces. Especially in hybrid and electric cars, many components have to be supplied by high currents. To save bundles contribute to hotspot generation and overheating of essential car elements, especially

  6. High critical current superconducting tapes

    DOE Patents [OSTI]

    Holesinger, Terry G. (Los Alamos, NM); Jia, Quanxi (Los Alamos, NM); Foltyn, Stephen R. (Los Alamos, NM)

    2003-09-23T23:59:59.000Z

    Improvements in critical current capacity for superconducting film structures are disclosed and include the use of a superconducting RE-BCO layer including a mixture of rare earth metals, e.g., yttrium and europium, where the ratio of yttrium to europium in the RE-BCO layer ranges from about 3 to 1 to from about 1.5 to 1.

  7. Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals to work on rural projects that

    E-Print Network [OSTI]

    Richner, Heinz

    Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals. Policy message n Pakistan is a highly gender-segregated society, and more well-qualified female field for well-educat- ed Pakistani women Pakistan has one of the lowest female labour force

  8. Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan

    E-Print Network [OSTI]

    Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan Xavier Giné Akbar at the Pakistan Poverty Alleviation Program (PPAF) in Islamabad for their support

  9. The perceived influence of past mentoring experiences on the mentoring practices of selected female school executives

    E-Print Network [OSTI]

    Ashley, Betty Diane

    2009-05-15T23:59:59.000Z

    Although research on mentoring dates back to the early 1980’s, there is little research available which examines the influence of past mentoring experiences on relationships in which female school executives, in turn, serve as the mentors...

  10. POETISA CHIC: FASHIONING THE MODERN FEMALE POET IN CENTRAL AMERICA, 1929-1944

    E-Print Network [OSTI]

    Finzer, Erin S.

    2008-01-01T23:59:59.000Z

    This dissertation explores the cultural and literary "fashionings" of Central American female poets of the 1930s in order to demonstrate how some of these poets entered the lettered city (Ángel Rama's term for the nexus ...

  11. The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice

    E-Print Network [OSTI]

    Eisenberg, Rahel E. (Rahel Esther)

    2009-01-01T23:59:59.000Z

    This research sought to create an animal model of secondary hyperparathyroidism through continuous infusion of parathyroid hormone (PTH) in adult female mice, and to subsequently study the catabolic effects of PTH. Osmotic ...

  12. Osteopontin-mediated neutrophilic infiltration and higher liver injury in a female rodent alcoholic steatohepatitis model

    E-Print Network [OSTI]

    Banerjee, Atrayee

    2009-05-15T23:59:59.000Z

    Females are known to be more susceptible to alcoholic liver disease (ALD), but the precise mechanism behind this increased susceptibility is not well understood. The objective of this study was to identify the molecular mechanism behind...

  13. This Is “Ladies’ Night”: A Case Study of a Grassroots Golf Program for Black Females

    E-Print Network [OSTI]

    Rosselli, Anthony C

    2014-07-24T23:59:59.000Z

    beginner golfers. Individual interviews with the golf instructor and seven of her participants were conducted. These women were self-identifying Black and female who attended at least three of the original ladies’ clinics. Additional data were gathered...

  14. "Imbued with the science of Venus": Female Fallenness, Sexual Pedagogy, and Victorian Pornography

    E-Print Network [OSTI]

    Wicktor, Emily D.

    2010-12-16T23:59:59.000Z

    As a decidedly heterogeneous genre, Victorian pornography offers a wide range of sexual narratives, including those that directly challenge both real and fictional narrative constructions of female fallenness by foregrounding ...

  15. Identifying the Predictors of Female Project Managers' Salaries in the United States

    E-Print Network [OSTI]

    Kamranzadeh, Amineh

    2012-11-30T23:59:59.000Z

    This study seeks to explore the predictors of female project managers’ salary in the construction industry, and to analyze their impacts on determining the salary. Experience, age, marital status, motherhood, having children at home, and the number...

  16. The Falkland Current: an element of the Antarctic Circumpolar Current

    E-Print Network [OSTI]

    Divins, Ebbe Ward

    1989-01-01T23:59:59.000Z

    Current match the water mass characteristics above 2000 m in northern Drake Passage. Antarctic Intermediate Water (AAIW), Antarctic Surface Water, and Circumpolar Deep Water are traced, using quasi-synoptic CTD-02 station data, from northern Drake... colder and fresher water from the region of the Polar Front with the water found in the Polar Frontal Zone and the Subantarctic Zone as the flow proceeds past Drake Passage. ACKNOWLEDGMENTS I would like to thank Dr. Nowlin for his patience and his...

  17. A dyadic protocol for training complex skills: a replication using female participants 

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  18. A dyadic protocol for training complex skills: a replication using female participants

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  19. Menstrual Support for Females with Developmental Disabilities: Survey and Interview of Parents or Caretakers

    E-Print Network [OSTI]

    Park, Hye Ran

    2013-12-31T23:59:59.000Z

    ramifications of the eugenics movement, however, have proved much more durable. Simultaneously, the state’s interests in requiring sterilization started outweighing the rights of a person with retardation (Vitello, 1978). In addition, the various movements (de...; Williams & Nind, 1999); and for many years little research investigated the perspectives of females with developmental disabilities (Rodgers, Lipscombe, & Santer, 2006). Although several publications have addressed contraceptive management in females...

  20. Effect of age on vibration sensitivity and motor nerve conduction among females

    E-Print Network [OSTI]

    Crumpton, Lesia LaWon

    1990-01-01T23:59:59.000Z

    EFFECT OF AGE ON VIBRATION SENSITIVITY AND MOTOR NERVE CONDUCTION AMONG FEMALES A Thesis by LES IA LA WON CRUMPTON Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE December 1990 Major Subject: Industrial Engineering EFFECT OF AGE ON VIBRATION SENS~ AND MOTOR NERVE CONDUCTION AlvIONG FEMALES A Thesis by LESIA LAWON CRUMPTON Approved as to style and content by: erome J. nglet (Chair...

  1. Leakage currents in SOI MOSFETS

    SciTech Connect (OSTI)

    Annamala, N.K.; Biwer, M.C.

    1988-12-01T23:59:59.000Z

    Total dose response of both NMOS and PMOS FETs fabricated on SOI substrates was studied. Two types of back-channel leakage currents were identified. A back-channel leakage due to MOSFET action uses the substrate bias as the gate bias. The other component is due to soft reverse characteristics of the body-drain junction. The back-channel leakage due to MOSFET action varies with the substrate bias and hence varies with irradiation due to threshold voltage shift. The soft reverse characteristics are a function of drain-body voltage and hence vary with substrate bias and irradiation. I-V characteristics and subthreshold currents of both front and back channels as a function of total dose were obtained.

  2. High PRF high current switch

    DOE Patents [OSTI]

    Moran, Stuart L. (Fredericksburg, VA); Hutcherson, R. Kenneth (College Park, MD)

    1990-03-27T23:59:59.000Z

    A triggerable, high voltage, high current, spark gap switch for use in pu power systems. The device comprises a pair of electrodes in a high pressure hydrogen environment that is triggered by introducing an arc between one electrode and a trigger pin. Unusually high repetition rates may be obtained by undervolting the switch, i.e., operating the trigger at voltages much below the self-breakdown voltage of the device.

  3. For current viewing resistor loads

    DOE Patents [OSTI]

    Lyons, Gregory R. (Tijeras, NM); Hass, Jay B. (Lee's Summit, MO)

    2011-04-19T23:59:59.000Z

    The invention comprises a terminal unit for a flat cable comprising a BNC-PCB connector having a pin for electrically contacting one or more conducting elements of a flat cable, and a current viewing resistor having an opening through which the pin extends and having a resistor face that abuts a connector face of the BNC-PCB connector, wherein the device is a terminal unit for the flat cable.

  4. For Immediate Release --Wednesday, July 17, 2013 Counselling in female-only groups shows promise as

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    of the participants in gambling addiction treatment programs. Many programs designed to help with gambling problems, the traditional male-oriented treatment model for addiction, as well as economic and child-care concerns surrounding treatment, among many other

  5. The Current Status of Asteroseismology

    E-Print Network [OSTI]

    C. Aerts; J. Christensen-Dalsgaard; M. Cunha; D. W. Kurtz

    2008-03-25T23:59:59.000Z

    Stellar evolution, a fundamental bedrock of modern astrophysics, is driven by the physical processes in stellar interiors. While we understand these processes in general terms, we lack some important ingredients. Seemingly small uncertainties in the input physics of the models, e.g., the opacities or the amount of mixing and of interior rotation, have large consequences for the evolution of stars. The goal of asteroseismology is to improve the description of the interior physics of stars by means of their oscillations, just as global helioseismology led to a huge step forward in our knowledge about the internal structure of the Sun. In this paper we present the current status of asteroseismology by considering case studies of stars with a variety of masses and evolutionary stages. In particular, we outline how the confrontation between the observed oscillation frequencies and those predicted by the models allows us to pinpoint limitations of the input physics of current models and improve them to a level that cannot be reached with any other current method.

  6. Are quit attempts among U.S. female nurses who smoke different from female smokers in the general population? An analysis of the 2006/2007 Tobacco Use Supplement to the Current Population Survey

    E-Print Network [OSTI]

    Sarna, Linda; Bialous, Stella; Nandy, Karabi; Yang, Qing

    2012-01-01T23:59:59.000Z

    California, Los Angeles, 700 Tiverton Ave, Los Angeles, CACalifornia, Los Angeles, 700 Tiverton Ave, Los Angeles, CA

  7. Quantifying turbidity current interactions with topography

    E-Print Network [OSTI]

    Straub, Kyle M

    2007-01-01T23:59:59.000Z

    This thesis advances our understanding of how transport properties of turbidity currents are mediated by interactions with seafloor topography, specifically channelized surfaces. Turbidity currents are responsible for ...

  8. Fuel Cells - Current Technology | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cells - Current Technology Fuel Cells - Current Technology Today, fuel cells are being developed to power passenger vehicles, commercial buildings, homes, and even small...

  9. Hydrogen Production - Current Technology | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Current Technology Hydrogen Production - Current Technology The development of clean, sustainable, and cost-competitive hydrogen production processes is key to a viable future...

  10. The Black Male Youth Academy: Understanding the impact of a critical literacy intervention program on underserved youth

    E-Print Network [OSTI]

    Scorza, D'Artagnan

    2013-01-01T23:59:59.000Z

    of your participation in the Black Male Youth Academy? 5.recommend the Black Male Youth Academy to your peers? PleaseJournal of the American Academy of Child & Adolescent

  11. Current trends in income statements 

    E-Print Network [OSTI]

    Cass, Edwin Childers

    1948-01-01T23:59:59.000Z

    years 2 000 000 sy&i~9 Earnings of' prior years transferred to capital stock account. ' 99 dr 124, 4452088 Accumulated. earnings invested in plant facilitlss and added to zorking oaptta1 at ead od' year . ~189 4'14 919 An example of' the second...~the ?clams surplus theory, ?2 . ?& the ?all-inclusive income statement", , = or ths. "historical approach" ~ . And those who favor tbs second belief' are said to accept ths ?eiarning* power approach", oz the "current opera- ?, 5 ting perf'ozmance concept...

  12. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100 PST

  13. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100 PST200

  14. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100

  15. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100400 PST

  16. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100400

  17. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment100400700

  18. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current

  19. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST Ceiling

  20. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST Ceiling000

  1. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST Ceiling000100

  2. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST

  3. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300 PST

  4. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300 PST400 PST

  5. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300 PST400

  6. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300 PST400600

  7. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300

  8. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800 PST

  9. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800 PST900

  10. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800

  11. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800100 PST

  12. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800100

  13. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 PST300800100300

  14. Current HMS Observations - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900

  15. Current Month Summary - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900Met and Climate

  16. ARM - Lesson Plans: Current Weather

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP : XDC documentationBarrow, Alaska Outreach HomeClimate in theCurrent

  17. ARM - Lesson Plans: Surface Currents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP : XDC documentationBarrow, Alaska OutreachMakingPastSurface Currents

  18. Currents, Berkeley Lab's Biweekly Newspaper

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power Administration would likeConstitution4 Department ofDepartmentPower-Rates SignCurrent

  19. Current | OpenEI Community

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual Siteof EnergyInnovationinConcentratingEnergyCoosaPage EditCrystalsol OUCumberlandCurrent

  20. A male of the bee genus Agapostemon in Dominican amber (Hymenoptera: Halictidae)

    E-Print Network [OSTI]

    Engel, Michael S.; Breitkreuz, Laura C.V.

    2013-09-04T23:59:59.000Z

    The first fossil species of the caenohalictine bee genus Agapostemon Guérin-Méneville (Halictinae: Caenohalictini:Agapostemonina) is described and figured from a single male preserved in EarlyMiocene (Burdigalian) amber ...

  1. Investigating the influence of media on male body image: in search of a potential moderator

    E-Print Network [OSTI]

    Mignogna, Joseph

    2013-02-22T23:59:59.000Z

    of all three of the body image assessment measures (Body Image Assessment, BIA; Body Morph Assessment, BMA; and Somatomorphic Matrix, SM) in measuring various aspects of male body image. The BIA and BMA were mainly sensitive to measuring "thinness...

  2. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds 

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  3. Fitting It All Together: How Courtship- and Mating-Responsive Genes Affect Drosophila melanogaster Male Behavior

    E-Print Network [OSTI]

    Ellis, Lisa Lynn

    2011-10-21T23:59:59.000Z

    interactions ..................................................................................... 1 Drosophila melanogaster as a tool for understanding behavior .... 3 Reproductive behaviors of Drosophila males ................................ 4... melanogaster courtship ritual .................................................. 6 3 The Drosophila somatic sex-determination hierarchy regulates somatic tissue development and courtship behavior ............................................... 7 4...

  4. The neuromolecular mechanisms that coordinate food availability with C. elegans male sexual behavior

    E-Print Network [OSTI]

    Gruninger, Todd Ryan

    2009-05-15T23:59:59.000Z

    -103, results in spontaneous seizures of the male sex muscles.Interestingly, I found that food deprivation can suppress unc-103(lf)-induced seizures,suggesting that pathways activated under this environmental condition can suppress theexcitability...

  5. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  6. The Leadership Perspectives of African American Males after Participation in a Leadership Development Program

    E-Print Network [OSTI]

    Preston, Tammie M

    2014-10-14T23:59:59.000Z

    This study investigated the perceptions of African American undergraduate males who attend a predominately White institution in the southwest as they concern leadership after participation in a leadership development program and the influence...

  7. Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US

    E-Print Network [OSTI]

    Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US in Eastern US showed that when the acetates were omitted from a 7-component blend in rubber septa, fewer

  8. High Critical Current Coated Conductors

    SciTech Connect (OSTI)

    Paranthaman, M. P.; Selvamanickam, V. (SuperPower, Inc.)

    2011-12-27T23:59:59.000Z

    One of the important critical needs that came out of the DOE’s coated conductor workshop was to develop a high throughput and economic deposition process for YBCO. Metal-organic chemical vapor deposition (MOCVD) technique, the most critical steps in high technical micro fabrications, has been widely employed in semiconductor industry for various thin film growth. SuperPower has demonstrated that (Y,Gd)BCO films can be deposited rapid with world record performance. In addition to high critical current density with increased film thickness, flux pinning properties of REBCO films needs to be improved to meet the DOE requirements for various electric-power equipments. We have shown that doping with Zr can result in BZO nanocolumns, but at substantially reduced deposition rate. The primary purpose of this subtask is to develop high current density MOCVD-REBCO coated conductors based on the ion-beam assisted (IBAD)-MgO deposition process. Another purpose of this subtask is to investigate HTS conductor design optimization (maximize Je) with emphasis on stability and protection issues, and ac loss for REBCO coated conductors.

  9. The postnatal development of the sex organs in prenatally and early postnatally irradiated male albino rats

    E-Print Network [OSTI]

    Ricks, Robert Clinton

    1964-01-01T23:59:59.000Z

    THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Submitted to the Graduate College of the Texas ARM University in partial fulfillment of the requirements... for the degree of MASTER OF SCIENCE August, 1964 Major Subject: Zoology THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Approved as to style and content by...

  10. Nonlocal Condensates and Current-Current Correlators within the Instanton Liquid Model

    E-Print Network [OSTI]

    A. E. Dorokhov

    2006-01-14T23:59:59.000Z

    The quark and gluon nonlocal condensates and current-current correlators are discussed within the instanton liquid model.

  11. Rotating concave eddy current probe

    SciTech Connect (OSTI)

    Roach, Dennis P. (Albuquerque, NM); Walkington, Phil (Albuquerque, NM); Rackow, Kirk A. (Albuquerque, NM); Hohman, Ed (Albuquerque, NM)

    2008-04-01T23:59:59.000Z

    A rotating concave eddy current probe for detecting fatigue cracks hidden from view underneath the head of a raised head fastener, such as a buttonhead-type rivet, used to join together structural skins, such as aluminum aircraft skins. The probe has a recessed concave dimple in its bottom surface that closely conforms to the shape of the raised head. The concave dimple holds the probe in good alignment on top of the rivet while the probe is rotated around the rivet's centerline. One or more magnetic coils are rigidly embedded within the probe's cylindrical body, which is made of a non-conducting material. This design overcomes the inspection impediment associated with widely varying conductivity in fastened joints.

  12. Space use by female Greater Prairie-Chickens in response to wind energy development

    E-Print Network [OSTI]

    Sandercock, Brett K.

    Space use by female Greater Prairie-Chickens in response to wind energy development V. L. WINDER,1-Chickens in response to wind energy development. Ecosphere 5(1):3. http://dx.doi.org/10.1890/ ES13-00206.1 Abstract. Wind energy development is targeted to meet 20% of U.S. energy demand by 2030. In Kansas, optimal sites

  13. Daily movements of female white-tailed deer relative to parturition and breeding.

    SciTech Connect (OSTI)

    Gino J. D'Angelo; Christopher E. Comer; John C. Kilgo; Cory D. Drennan; David A. Osborn; Karl V. Miller

    2005-10-01T23:59:59.000Z

    Abstract: To assess how white-tailed deer (Odocoileus virginianus) herd demographics influence reproductive behaviors, we examined 24-h diel movements of female whitetailed deer relative to parturition and breeding in a low-density population with a near even sex ratio at the Savannah River Site (SRS), South Carolina. We conducted a series of intensive, 24-h radio-tracking periods of 13 females during spring and fall 2002. We compared daily range (ha), rate of travel (m/h), and distance between extreme daily locations (m), among the periods of pre-parturition and post-parturition and pre-, peak-, and post-rut. From pre-parturition to post-parturition, we observed decreases in diel range size (�¢����38.2%), distance between extreme diel locations (�¢����17.0%), and diel rate of travel (�¢����18.2%). Diel range size, distance between extreme diel locations, and diel rate of travel during the pre-rut and rut exceeded those observed during post-rut. We further identified substantial increases in mobility during 12 24-h diel periods for eight females during our fall monitoring. Our data suggest that female white-tailed deer reduce mobility post-fawning following exaggerated movements during pre-parturition. Furthermore, despite a near equal sex ratio, estrous does may be required to actively seek potential mates due to low population density.

  14. Patterns of coalition formation by adult female baboons in Amboseli, Kenya

    E-Print Network [OSTI]

    Alberts, Susan C

    Patterns of coalition formation by adult female baboons in Amboseli, Kenya JOAN B. SILK*, SUSAN CDepartment of Biology, Duke University zInstitute for Primate Research, National Museums of Kenya, Nairobi, Kenya x, in Amboseli, Kenya. There is a broad consensus that, when ecological conditions favour collective defence

  15. Original Article The effect of ecological harshness on perceptions of the ideal female body size

    E-Print Network [OSTI]

    Cooper, Brenton G.

    Original Article The effect of ecological harshness on perceptions of the ideal female body size Why do researchers regularly observe a relationship between ecological conditions and the heaviness life history strategies typically adopted by individuals living in harsh versus benign ecologies

  16. Effects of wind energy development on survival of female greater prairie-chickens

    E-Print Network [OSTI]

    Sandercock, Brett K.

    community, grouse, hazard function, mortality, preda- tion, wind turbine *Correspondence author. EEffects of wind energy development on survival of female greater prairie-chickens Virginia L of Florida, Gainesville, FL 32611, USA Summary 1. The potential effects of wind energy development

  17. Research Report Effects of ethanol consumption by adult female rats on subsequent

    E-Print Network [OSTI]

    Galef Jr., Bennett G.

    Research Report Effects of ethanol consumption by adult female rats on subsequent consumption January 2004 Abstract We used a two-bottle choice test to measure voluntary ethanol consumption by adolescent rats that had lived with ethanol-consuming or water-consuming adult conspecifics. We found

  18. Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley

    E-Print Network [OSTI]

    California at Berkeley, University of

    Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley Rats Asians. However, studies from our laboratory suggest that the anti-estrogenic effects of dietary kelp modulation related to kelp ingestion in a pilot study of premenopausal women, we investigated the endocrine

  19. What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs

    E-Print Network [OSTI]

    Virginia Tech

    What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs may become inflamed, irritated, swollen and possibly scarred. The most common causes of PID. PID is one of the leading causes of infertility in women. How does someone get PID? PID is caused

  20. Lee Smith's Fair and Tender Ladies: the female espistolary novel and the construction of knowledge

    E-Print Network [OSTI]

    Grubbs, Amy Marie

    1994-01-01T23:59:59.000Z

    This thesis focuses on how Lee Smith, a North Carolina writer, uses the traditional female epistolary form in a revolutionary way in her 1988 novel Fair and Tender Ladies. Smith's use of the form is revolutionary because, as many critics have...

  1. PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS

    E-Print Network [OSTI]

    PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS (ENHYDRA LUTRIS phenotypic plasticity. When populations are near carrying capacity (K) or when they are declining due) populations in Alaska provides an opportunity to examine phenotypic plasticity. Using premolar teeth

  2. MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE

    E-Print Network [OSTI]

    1099 MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE in intensively (>80%) cultivated areas. From January 2001 to August 2002, we monitored movements of 77 (61 adult of seasonal migration, whereas crop emergence and harvest had minimal effects. Four deer (8%) dispersed a mean

  3. Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice

    E-Print Network [OSTI]

    Frick, Karyn M.

    Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice Lauren to determine how different elements of enrichment, for example, cognitive stimu- lation and voluntary exercise), running wheels alone (exercise), or both toys and running wheels (complex enrichment) for 4 weeks prior

  4. Current ramp-up with lower hybrid current drive in EAST B. J. Ding,1

    E-Print Network [OSTI]

    Current ramp-up with lower hybrid current drive in EAST B. J. Ding,1 M. H. Li,1 N. J. Fisch,2 H hybrid current drive. The first stage of cyclic operation would be to ramp up the plasma current with lower hybrid waves alone in low-density plasma. Such a current ramp-up was carried out successfully

  5. Current DOE and OSHA VPP Sites

    Broader source: Energy.gov [DOE]

    Need to know which sites are current DOE-VPP or OSHA VPP Sites? The link, below, will take you to a Voluntary Protection Programs Participant's Association web page where you may search for current...

  6. LIBRARY AND INFORMATION SERVICES DIVISION Current References

    E-Print Network [OSTI]

    - ) CRIS/USDA (CURRENT RESEARCH INFORMATION SYSTEM (Current) DISSERTATION ABSTRACTS (1861- ) ENERGY SCIENCE Administration National Environmental Satellite, Data, and Information Service National Oceanographic Data Center National Oceanic and Atmospheric Administration National Environmental Satellite, Data, and Information

  7. HIGH STABILITY CURRENT SUPPLY FOR ELECTRON MICROSCOPY

    E-Print Network [OSTI]

    Motamedi, Maryam Melani

    2012-01-01T23:59:59.000Z

    the current regulator. The power losses through the powerFETs are (31): Power Loss = I drain V ds The drain current (by design to lower the power loss is the drain to source

  8. Energy Current Correlations For Weakly Anharmonic Lattices

    E-Print Network [OSTI]

    Herbert Spohn

    2007-06-06T23:59:59.000Z

    We discuss energy current correlations in thermal equilibrium and point out the linkage to the fluctuating Peierls equation.

  9. Current generation in a relativistic plasma

    SciTech Connect (OSTI)

    Fisch, N.J.

    1981-01-01T23:59:59.000Z

    The relativistic dynamics of fast current carriers are rich in intriguing phenomena not appearing in the Newtonian limit. It is shown that because of these dynamics there is a bound to the efficiency of driving current in a tokamak either by waves or other means. Analytic techniques uncover the current-drive scheme which yields the maximum attainable efficiency.

  10. Apparatus and method for critical current measurements

    DOE Patents [OSTI]

    Martin, Joe A. (Espanola, NM); Dye, Robert C. (Los Alamos, NM)

    1992-01-01T23:59:59.000Z

    An apparatus for the measurement of the critical current of a superconductive sample, e.g., a clad superconductive sample, the apparatus including a conductive coil, a means for maintaining the coil in proximity to a superconductive sample, an electrical connection means for passing a low amplitude alternating current through the coil, a cooling means for maintaining the superconductive sample at a preselected temperature, a means for passing a current through the superconductive sample, and, a means for monitoring reactance of the coil, is disclosed, together with a process of measuring the critical current of a superconductive material, e.g., a clad superconductive material, by placing a superconductive material into the vicinity of the conductive coil of such an apparatus, cooling the superconductive material to a preselected temperature, passing a low amplitude alternating current through the coil, the alternating current capable of generating a magnetic field sufficient to penetrate, e.g., any cladding, and to induce eddy currents in the superconductive material, passing a steadily increasing current through the superconductive material, the current characterized as having a different frequency than the alternating current, and, monitoring the reactance of the coil with a phase sensitive detector as the current passed through the superconductive material is steadily increased whereby critical current of the superconductive material can be observed as the point whereat a component of impedance deviates.

  11. Sliding Interfaces for Eddy Current Simulations

    E-Print Network [OSTI]

    Hiptmair, Ralf

    Sliding Interfaces for Eddy Current Simulations Raffael Casagrande Master Thesis Supervisor: Prof. Dr. Ralf Hiptmair Zürich, April 2013 #12;Contents Contents i 1. Introduction 1 2. Eddy Current-formulation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 2.4. The eddy current problem in a moving, solid body . . . . . . . . . . . . . 9 3. Discontinuous

  12. Expert system for analyzing eddy current measurements

    DOE Patents [OSTI]

    Levy, Arthur J. (Schenectady, NY); Oppenlander, Jane E. (Scotia, NY); Brudnoy, David M. (Albany, NY); Englund, James M. (Clifton Park, NY); Loomis, Kent C. (Clifton Park, NY)

    1994-01-01T23:59:59.000Z

    A method and apparatus (called DODGER) analyzes eddy current data for heat exchanger tubes or any other metallic object. DODGER uses an expert system to analyze eddy current data by reasoning with uncertainty and pattern recognition. The expert system permits DODGER to analyze eddy current data intelligently, and obviate operator uncertainty by analyzing the data in a uniform and consistent manner.

  13. Aquantis Ocean Current Turbine Development Project Report

    SciTech Connect (OSTI)

    Fleming, Alex J.

    2014-08-23T23:59:59.000Z

    The Aquantis® Current Plane (“C-Plane”) technology developed by Dehlsen Associates, LLC (DA) and Aquantis, Inc. is an ocean current turbine designed to extract kinetic energy from ocean currents. The technology is capable of achieving competitively priced base-load, continuous, and reliable power generation from a source of renewable energy not before possible in this scale or form.

  14. High temperature superconducting fault current limiter

    DOE Patents [OSTI]

    Hull, J.R.

    1997-02-04T23:59:59.000Z

    A fault current limiter for an electrical circuit is disclosed. The fault current limiter includes a high temperature superconductor in the electrical circuit. The high temperature superconductor is cooled below its critical temperature to maintain the superconducting electrical properties during operation as the fault current limiter. 15 figs.

  15. EFFICIENCY OF FAST WAVE CURRENT DRIVE FOR

    E-Print Network [OSTI]

    Karney, Charles

    EFFICIENCY OF FAST WAVE CURRENT DRIVE FOR A WEAKLY RELATIVISTIC PLASMA by S.C. CHIU, C.F.F. KARNEY: http://charles.karney.info/biblio/chiu94.html #12;Chiu e t al. THE EFFICIENCY OF FAST WAVE CURRENT DRIVE FOR A WEAKLY RELATIVISTIC PLASMA THE EFFICIENCY OF FAST WAVE CURRENT DRIVE FOR A WEAKLY

  16. High temperature superconducting fault current limiter

    DOE Patents [OSTI]

    Hull, John R. (Hinsdale, IL)

    1997-01-01T23:59:59.000Z

    A fault current limiter (10) for an electrical circuit (14). The fault current limiter (10) includes a high temperature superconductor (12) in the electrical circuit (14). The high temperature superconductor (12) is cooled below its critical temperature to maintain the superconducting electrical properties during operation as the fault current limiter (10).

  17. Intrusive gravity currents in two-layer

    E-Print Network [OSTI]

    Flynn, Morris R.

    Intrusive gravity currents in two-layer stratified media Morris R. Flynn & Paul F. Linden Dept.avalanche.org/pictures #12;· `Microbursts' pose a non-trivial threat to airplane safety Introduction Impacts on human health;· Whereas gravity currents travel along a solid boundary, intrusive gravity currents or intrusions propagate

  18. Costs of mating competition limit male lifetime breeding success in polygynous mammals

    E-Print Network [OSTI]

    Lukas, Dieter; Clutton-Brock, Tim

    2014-05-14T23:59:59.000Z

    . Nature 462(7274), 786-789. 42. Young, A. J. & Bennett, N. C. 2013 Intra-sexual selection in cooperative mammals and birds: why are females not bigger and better armed? Phil. Trans. R. Soc. B 368(1631), 20130075. Supplementary references S43. Glander, K. E...

  19. A Current Perspective on Photocatalysis

    SciTech Connect (OSTI)

    Fujita, E.; Muckerman, J.T.; Domen, K.

    2011-02-18T23:59:59.000Z

    The efficient conversion of solar photons into solar electricity and solar fuels is one of the most important scientific challenges of this century owing to dwindling fossil fuel reserves and the need for clean energy. While research in the direct conversion of solar energy to electricity in the areas of low-cost photovoltaic (PV) systems based on all-inorganic semiconductors, dye-sensitized solar cells, organic, and molecular PV is more technically advanced than its direct conversion to fuels, electricity may not be the ultimate primary solar energy conversion choice owing to the intermittence of solar radiation, the considerable energy loss during transmission, the availability of cost-effective storage media for electricity, and the continuing need for liquid transportation fuels. On the other hand, the direct conversion of solar photons to fuels such as H{sub 2}, CO, alcohols, and hydrocarbons using H{sub 2}O and CO{sub 2} as feedstocks offers a solution for the storage and distribution of solar energy in the form of stable chemical bonds that can be activated to provide energy at arbitrary times and locations. The latter approach to photocatalysis is generally called artificial photosynthesis, and has received renewed interest over the past five or so years. While 'photocatalysis' has not traditionally been restricted to the generation of 'solar fuels,' and has included the production of other useful chemicals, polymerization, and environmental remediation applications, the recent upsurge of interest has been driven mostly by renewable energy issues. It was the pioneering work on photo-electrochemical splitting of water to H{sub 2} and O{sub 2} by n-type TiO{sub 2} using ultraviolet light, by Fujishima and Honda in 1972, that ushered in the area of research that has come to be known as 'solar fuels,' and that has led to the terms 'photocatalysis' and 'solar fuels' becoming almost synonymous. This special issue of ChemSusChem is devoted to providing a current perspective on the field of photocatalysis. It contains invited papers from leading researchers in a wide range of important aspects of the field that address materials, photophysical, photochemical, and electrocatalysis issues. The area remains primarily the domain of basic research studies because progress toward the promise offered by the early work has (at least until recently) been slow, despite its significance having become increasingly recognized. The present collection of papers deals with new semiconductor photocatalysts, molecular catalysts for hydrogen production and water oxidation, dye-sensitized photoelectrochemical cells, and electrochemical CO{sub 2} reduction. Overall photochemical water splitting without any applied bias potential is achieved in several systems, especially under UV irradiation. Further advances are also achieved in a few semiconductor systems, such as GaZn oxynitrides or two-step (so-called 'Z-scheme') systems to produce H{sub 2} and O{sub 2} without any sacrificial reagent under visible irradiation. When band gaps of semiconductors are narrowed to absorb more visible light for greater efficiency, or when band positions are not suitable for carrying out one-electron redox processes, multielectron catalysts are required to promote proton-coupled electron transfer reactions in producing solar fuels. In homogeneous photocatalysis systems, sacrificial reagents are typically used to investigate the catalytic activity, detailed kinetics, and mechanisms of a half reaction. Photoelectrolysis systems with immobilized catalysts (metals, metal oxides, or molecular catalysts) on electrodes can separate oxidized products, such as O{sub 2}, and reduced products, such as H{sub 2}, CO, CH{sub 3}OH, and others, by means of proton- or hydroxide-conducting membranes. The following paragraphs briefly summarize these contributions. In the area of UV-driven water splitting, Townsend et al. prepared Pt-and/or IrO{sub x}-coated niobate (Nb{sub 6}O{sub 17}{sup 4-}) nanoscrolls and tested photochemical water reduction with methanol as a sacrificial rea

  20. Comparative distribution of misonidazole and its amine metabolite in female Swiss Webster mice

    SciTech Connect (OSTI)

    Born, J.L.; Hadley, W.M.

    1985-06-01T23:59:59.000Z

    The distribution of misonidazole and its terminal reduction product 1-(2-amino-1-imidazolyl)-3-methoxy-2-propanol (misoamine) were compared in female Swiss Webster mice to determine if either misonidazole or misoamine is distributed to peripheral nerves. Female Swiss Webster mice received a 100 mg/kg (5 ..mu..Ci/..mu..mole) i.p. dose of either /sup 3/H-misonidazole or /sup 3/H-miso-amine and the distribution of radioactivity was determined in various tissues including sciatic nerves and other myelinated nerves. Misonidazole produced higher initial tissue concentrations of radioactivity than did miso-amine. The relative tissue concentrations of radioactivity produced by misonidazole or miso-amine were similar, although not identical, 48 hours after administration of the drugs. Both sciatic and other myelinated nerves were found to retain radioactivity following the administration of either misonidazole or miso-amine.

  1. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  2. Mutation analysis of BRCA1 and BRCA2 in a male breast cancer population

    SciTech Connect (OSTI)

    Friedman, L.S.; Gayther, S.A.; Ponder, B.A.J. [Univ. of Cambridge (United Kingdom)] [and others

    1997-02-01T23:59:59.000Z

    A population-based series of 54 male breast cancer cases from Southern California were analyzed for germ-line mutations in the inherited breast/ovarian cancer genes, BRCA1 and BRCA2. Nine (17%) of the patients had a family history of breast and/or ovarian cancer in at least one first-degree relative. A further seven (13%) of the patients reported breast/ovarian cancer in at least one second-degree relative and in no first-degree relatives. No germ-line BRCA1 mutations were found. Two male breast cancer patients (4% of the total) were found to carry novel truncating mutations in the BRCA2 gene. Only one of the two male breast cancer patients carrying a BRCA2 mutation had a family history of cancer, with one case of ovarian cancer in a first-degree relative. The remaining eight cases (89%) of male breast cancer with a family history of breast/ovarian cancer in first-degree relatives remain unaccounted for by mutations in either the BRCA1 gene or the BRCA2 gene. 23 refs., 1 fig., 5 tabs.

  3. FOREST ENTOMOLOGY A Male-Produced Aggregation Pheromone of Monochamus alternatus

    E-Print Network [OSTI]

    Hanks, Lawrence M.

    )- ethanol, the male-produced pheromone of the congeneric M. galloprovincialis Dejean, in Ã?eld ex- periments consisting of 2-(undecyloxy)-ethanol combined with the host plant volatiles -pinene and ethanol. A follow-up experiment showed that 2-(undecyloxy)-ethanol was synergized by both ethanol and -pinene. Coupled gas

  4. Site fidelity, home range behaviour and habitat utilization of male harlequin toads (Amphibia:Atelopus hoogmoedi)

    E-Print Network [OSTI]

    Hödl, Walter

    :Atelopus hoogmoedi) from Suriname:relevant aspects for conservation breeding SALAMANDRA 1 45 Abstract. Recently, neotropical harlequin toads (Atelopus spp.) have undergone drastic population de- clines. Captive breeding has rainy season (April to August) at Brownsberg Nature Park, Suriname. Dur- ing this period, males

  5. An exploration of the stages of change model in a group treatment program for male batterers

    E-Print Network [OSTI]

    Wells, Robert Davis

    2005-02-17T23:59:59.000Z

    in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2004 Major Subject: Counseling Psychology AN EXPLORATION OF THE STAGES OF CHANGE MODEL IN A GROUP TREATMENT PROGRAM...) __________________________ Michael R. Benz (Head of Department) December 2004 Major Subject: Counseling Psychology iii ABSTRACT An Exploration of the Stages of Change Model in a Group Treatment Program for Male Batterers. (December 2004...

  6. Clinical overlap between Posttraumatic Stress Disorder and Borderline Personality Disorder in male veterans

    E-Print Network [OSTI]

    Boggs, Christina Danielle

    2006-10-30T23:59:59.000Z

    previous literature by providing an investigation of clinical features across two groups: PTSD only and comorbid PTSD and BPD in a sample of male veterans (n=178). Results suggest that the two groups were distinct, with the comorbid group displaying higher...

  7. Ape Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive

    E-Print Network [OSTI]

    [1] have shown that chimpanzees trade mating opportunities for support in power contests. OddlyApe Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive rare among animals, exchange of one currency for another -- in this case sex for power -- may

  8. A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the

    E-Print Network [OSTI]

    Gruber, Jonathan

    A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the Drosophila- ship behavior, genes acting downstream of fru have not yet been identified. Here we demonstrate that the yellow (y) gene is genetically downstream of fru in the 3rd -instar larval brain. Yellow protein

  9. Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White-

    E-Print Network [OSTI]

    Nelson, Randy J.

    Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White to long day lengths (LD) and short day lengths (SD) for 10 to 15 weeks and then examined olfactory bulb cell proliferation and survival using the thymidine analog BrdU, olfactory bulb granule cell morphology

  10. Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae: Salticidae)

    E-Print Network [OSTI]

    Hoy, Ronald R.

    Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae of multicomponent seismic courtship signals in addition to and produced in concert with its multiple visual ornaments and movement displays. Here, we demonstrate the importance of these seismic signals

  11. Mechanisms of Individual Variation in Reproductive Behavior in Female Xiphophorous birchmanni

    E-Print Network [OSTI]

    Smith, Victoria Lee

    2014-06-06T23:59:59.000Z

    for the Cayman Cortisol EIA kit ......... 12 2.5 Individual female cortisol levels over repeated sampling ....................................... 12 3.1 Validation of the cayman cortisol EIA kit with Xiphophorus birchmanni pooled water samples... of steroids from the column. This technique should collect only free (and not glucuronidated or sulfated) steroids (Vermeirssen and Scott, 1996). Eluates were dried under nitrogen and re-suspended in   9 600 microliters EIA buffer. Additional details...

  12. The effectiveness of visual evaluation scores as predictors of growth and fertility in Brangus females

    E-Print Network [OSTI]

    Harkey, Gary Don

    1990-01-01T23:59:59.000Z

    ). However, other studies indicated that higher postweaning growth delayed puberty in beef heifers (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Seemingly, the interrelationships which exist between growth and reproductive performance may vary... growth and age at puberty (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Managerial practices designed to maximize postweaning gain of replacement females are not only economically unfeasible in most instances, but have also been shown to reduce...

  13. (Per)Forming Female Politics: The Making of the `Modern Woman'

    E-Print Network [OSTI]

    Anderson, Christine Aliisa

    2008-01-01T23:59:59.000Z

    (Per)Forming Female Politics: The Making of the ?Modern Woman? in London, 1890-1914 By Copyright 2008 Christine A. Anderson Submited to the graduate degre program in History and the Graduate Faculty of the University of Kansas..., history, and the performing arts, and nurtured my pasion for and talents in these subjects. It is to both of them, therefore, that I dedicate this disertation. v v List of Abreviations AFL Actreses? Franchise League ILP Independent...

  14. The Social Mobility-Fertility Hypothesis: a racial and class comparison among southern females.

    E-Print Network [OSTI]

    White, Carolyn Delores

    1974-01-01T23:59:59.000Z

    and Level of Occupational Aspiration for Mate (LOAM) Summary of Phase I Test of the SMF Hypothesis. Social Mobility Tables Comparing Mean Fertility by the Educational Level of Mother (ELM) and the Level of Educational Aspiration (LEA) . Social Mobility... . Number and Percentage of Adjusted (}uota of Females Recontacted at Wave III by State and Race. Outline of Analytical Phases Bivariate Relationship Between Parity and Level of Educational Aspirations (LEA) Bivariate Relationship Between Parity...

  15. Difference as a means of defiance: a study of female subjectivity in six Jacobean plays

    E-Print Network [OSTI]

    Rodriguez, Mary Grace

    1995-01-01T23:59:59.000Z

    of the requirements for the degree of MASTER OF ARTS Approved as to style and content by: Katherine E. Kelly (Chair of Committee ffrey Cox (Member) Moocha 1 R. Han (Member) J. Lawrence Mitchell (Head of Department) August 1995 Major Subject: English... ABSTRACT Difference as a Means of Defiance: A Study of Female Subjectivity in Six Jacobean Plays. (August 1995) Mary Grace Rodriguez, B. A. , Texas A&M University Chair of Advisory Committee: Dr. Katherine E. Kelly The Hegelian dialectic clearly...

  16. Temperature compensated and self-calibrated current sensor using reference current

    DOE Patents [OSTI]

    Yakymyshyn, Christopher Paul (Seminole, FL); Brubaker, Michael Allen (Loveland, CO); Yakymyshyn, Pamela Jane (Seminole, FL)

    2008-01-22T23:59:59.000Z

    A method is described to provide temperature compensation and self-calibration of a current sensor based on a plurality of magnetic field sensors positioned around a current carrying conductor. A reference electrical current carried by a conductor positioned within the sensing window of the current sensor is used to correct variations in the output signal due to temperature variations and aging.

  17. A Transect of Glacier Bay Ocean Currents Measured by Acoustic Doppler Current Profiler (ADCP)

    E-Print Network [OSTI]

    that the tidal flow accelerates over Glacier Bay's shallow entrance sill to speeds of 180 cm/s and then slowsA Transect of Glacier Bay Ocean Currents Measured by Acoustic Doppler Current Profiler (ADCP shipboard acoustic Doppler current profiler (ADCP) transects of ocean current in Glacier Bay and Muir Inlet

  18. Lightning strikes to tall objects: Currents inferred from far electromagnetic fields versus directly measured currents

    E-Print Network [OSTI]

    Florida, University of

    -field-to-current conversion factor for lightning strikes to flat ground based on the transmission line model and (b currents on tall towers are used for testing the validity of field-to-current conversion equations [e on current measurement location (e.g., near the top or bottom of the tower) and on whether initial or largest

  19. Eddy Current Model of Ball Lightning

    E-Print Network [OSTI]

    J. D. Shelton

    2011-02-07T23:59:59.000Z

    Eddy Current Model of Ball Lightning Calculations show that high-energy ball lightning may consist of a ball of plasma containing a large circular electric current arising as an eddy current generated by lightning. Synthetic ball lightning might serve as a method of plasma confinement for purposes of nuclear fusion. In this paper, three articles concerning ball lightning and the related phenomenon of large ball lightning are combined to provide insight into this rarely glimpsed occurrence.

  20. Lectures on current-drive theory

    SciTech Connect (OSTI)

    Fisch, N.J.

    1986-01-01T23:59:59.000Z

    Separate abstracts were prepared for 2 papers in this report. The papers present an introduction and an overview to the theory of current drive. (JDB)

  1. Theory of current-drive in plasmas

    SciTech Connect (OSTI)

    Fisch, N.J.

    1986-12-01T23:59:59.000Z

    The continuous operation of a tokamak fusion reactor requires, among other things, a means of providing continuous toroidal current. Such operation is preferred to the conventional pulsed operation, where the plasma current is induced by a time-varying magnetic field. A variety of methods has been proposed to provide continuous current, including methods which utilize particle beams or radio frequency waves in any of several frequency regimes. Currents as large as half a mega-amp have now been produced in the laboratory by such means, and experimentation in these techniques has now involved major tokamak facilities worldwide.

  2. Tubular solid oxide fuel cell current collector

    DOE Patents [OSTI]

    Bischoff, Brian L. (Knoxville, TN); Sutton, Theodore G. (Kingston, TN); Armstrong, Timothy R. (Clinton, TN)

    2010-07-20T23:59:59.000Z

    An internal current collector for use inside a tubular solid oxide fuel cell (TSOFC) electrode comprises a tubular coil spring disposed concentrically within a TSOFC electrode and in firm uniform tangential electrical contact with the electrode inner surface. The current collector maximizes the contact area between the current collector and the electrode. The current collector is made of a metal that is electrically conductive and able to survive under the operational conditions of the fuel cell, i.e., the cathode in air, and the anode in fuel such as hydrogen, CO, CO.sub.2, H.sub.2O or H.sub.2S.

  3. Hybrid high direct current circuit interrupter

    DOE Patents [OSTI]

    Rockot, J.H.; Mikesell, H.E.; Jha, K.N.

    1998-08-11T23:59:59.000Z

    A device and a method are disclosed for interrupting very high direct currents (greater than 100,000 amperes) and simultaneously blocking high voltages (greater than 600 volts). The device utilizes a mechanical switch to carry very high currents continuously with low loss and a silicon controlled rectifier (SCR) to bypass the current around the mechanical switch while its contacts are separating. A commutation circuit, connected in parallel with the SCR, turns off the SCR by utilizing a resonant circuit to divert the SCR current after the switch opens. 7 figs.

  4. Hybrid high direct current circuit interrupter

    SciTech Connect (OSTI)

    Rockot, J.H.; Mikesell, H.E.; Jha, K.N.

    1996-12-31T23:59:59.000Z

    A device and a method for interrupting very high direct currents (greater than 100,000 amperes) and simultaneously blocking high voltages (greater than 600 volts). The device utilizes a mechanical switch to carry very high currents continuously with low loss and a silicon controlled rectifier (SCR) to bypass the current around the mechanical switch while its contacts are separating. A commutation circuit, connected in parallel with the SCR, turns off the SCR by utilizing a resonant circuit to divert the SCR current after the switch opens.

  5. Current Status of Concentrator Photovoltaic (CPV) Technology

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (CPV) technology has recently entered the market as a utility- scale option for the generation of solar electricity. This report explores the current status of CPV technology...

  6. A new 3-D EDDY current model

    SciTech Connect (OSTI)

    Polak, S.J.; van Welij, J.S.; Wachters, A.J.H.

    1983-11-01T23:59:59.000Z

    This paper presents a new EDDY current model. This model minimizes the number of unknown per point. The authors also discuss the uniqueness aspects involved.

  7. Acoustic Doppler Current Profiler Principles of Operation

    E-Print Network [OSTI]

    deYoung, Brad

    .............................................................................................................................2 2. The Doppler Effect and Radial Current Velocity..................................................................................................................................................4 The Doppler Effect.............................................................6 The Doppler Effect Measures Relative, Radial Motion

  8. Sandia National Laboratories: current energy converter array...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    array optimization framework Current Energy Converter Array Optimization Framework On March 13, 2014, in Computational Modeling & Simulation, Energy, News, News & Events,...

  9. Additional Guidance Regarding Application of Current Procedures...

    Broader source: Energy.gov (indexed) [DOE]

    Additional Guidance Regarding Application of Current Procedures for Testing Energy Consumption of Clothes Washers with Warm Rinse Cycles, Issued: June 30, 2010. Draft of DOE...

  10. Sandia National Laboratories: river current energy converters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    marine hydrokinetic (MHK) reference models (RMs) for wave energy converters and tidal, ocean, and river current energy converters. The RMP team includes a partnership between...

  11. Currents driven by electron cyclotron waves

    SciTech Connect (OSTI)

    Karney, C.F.F.; Fisch, N.J.

    1981-07-01T23:59:59.000Z

    Certain aspects of the generation of steady-state currents by electron cyclotron waves are explored. A numerical solution of the Fokker-Planck equation is used to verify the theory of Fisch and Boozer and to extend their results into the nonlinear regime. Relativistic effects on the current generated are discussed. Applications to steady-state tokamak reactors are considered.

  12. RealReal heterojunctionsheterojunctions Schottky barrier current

    E-Print Network [OSTI]

    Pulfrey, David L.

    -EFFICIENCY CDTE AND CIGS THIN-FILM SOLAR CELLS: HIGHLIGHTS AND CHALLENGES. National Renewable Energy Laboratory1 RealReal heterojunctionsheterojunctions LECTURE 9 · Schottky barrier current · CdS/CIGS · Energy is the forward-bias current? #12;33 HeterostructureHeterostructure, thin film, cells: a lower, thin film, cells

  13. Neutral-current x-distributions

    SciTech Connect (OSTI)

    Bogert, D.; Burnstein, R.; Fisk, R.; Fuess, S.; Bofill, J.; Busza, W.; Eldridge, T.; Friedman, J.I.; Abolins, M.; Brock, R.

    1984-06-01T23:59:59.000Z

    The role of the semi-leptonic neutral current interaction as a probe of nucleon structure is examined. Previous measurements of neutral current x-distributions are reviewed, and new results from the Fermilab - MIT - MSU collaboration are presented. 4 references.

  14. Electric Current Wound Healing David Cukjati

    E-Print Network [OSTI]

    Ljubljana, University of

    , Slovenia The authors review the existing physical modalities for treatment of chronic wounds and show the advantages of electric current and electromagnetic field stimulation. Direct currents, low frequency pulsed disruption is activation of the coagulation cascade and the production of blood clot. After several minutes

  15. How sustainable are current transport biofuels?

    E-Print Network [OSTI]

    How sustainable are current transport biofuels? Jérémie Mercier 7th BIEE Academic Conference biofuels and what is expected from them? 2) Sustainability impacts of agrofuels and the UK certification Conference - Oxford 24th September 2008 1) What are current transport biofuels and what is expected from them

  16. Metal current collect protected by oxide film

    DOE Patents [OSTI]

    Jacobson, Craig P. (Lafayette, CA); Visco, Steven J. (Berkeley, CA); DeJonghe, Lutgard C. (Lafayette, CA)

    2004-05-25T23:59:59.000Z

    Provided are low-cost, mechanically strong, highly electronically conductive current collects and associated structures for solid-state electrochemical devices, techniques for forming these structures, and devices incorporating the structures. The invention provides solid state electrochemical devices having as current interconnects a ferritic steel felt or screen coated with a protective oxide film.

  17. Analytical examples of reversal current, zero core current, and surface current, toroidal magnetostatic equilibria with nested flux surfaces

    SciTech Connect (OSTI)

    Aly, J.-J. [AIM, Unite Mixte de Recherche CEA - UP7 - CNRS, UMR no. 7158, Centre d'Etudes de Saclay, F-91191 Gif-sur-Yvette Cedex (France)

    2012-07-15T23:59:59.000Z

    We present exact analytical examples of three types of axisymmetric toroidal magnetostatic equilibria with nested flux surfaces: (1) current reversal equilibria, for which the net toroidal current switches from a negative to a positive value when moving away from the magnetic axis; these equilibria have a non-monotonic pressure profile, in accordance with Hammett et al.'s theorem stating that the pressure on the current reversal surface has to exceed the volume-averaged pressure within that surface; (2) zero core current equilibria, in which the toroidal current density vanishes inside some flux surface; and (3) surface current equilibria, constituted of an arbitrary number of nested layers inside which the plasma pressure is constant and the magnetic field force-free, with two adjacent layers being separated by a current sheet. All these configurations are obtained by shaping in an adequate way the arbitrary function which intervenes in the class of generalized isodynamic equilibria first constructed by Palumbo and recovered later on by Bishop and Taylor. A derivation of these equilibria by a method slightly different from Palumbo's is given in an Appendix.

  18. Electric field induced spin-polarized current

    DOE Patents [OSTI]

    Murakami, Shuichi; Nagaosa, Naoto; Zhang, Shoucheng

    2006-05-02T23:59:59.000Z

    A device and a method for generating an electric-field-induced spin current are disclosed. A highly spin-polarized electric current is generated using a semiconductor structure and an applied electric field across the semiconductor structure. The semiconductor structure can be a hole-doped semiconductor having finite or zero bandgap or an undoped semiconductor of zero bandgap. In one embodiment, a device for injecting spin-polarized current into a current output terminal includes a semiconductor structure including first and second electrodes, along a first axis, receiving an applied electric field and a third electrode, along a direction perpendicular to the first axis, providing the spin-polarized current. The semiconductor structure includes a semiconductor material whose spin orbit coupling energy is greater than room temperature (300 Kelvin) times the Boltzmann constant. In one embodiment, the semiconductor structure is a hole-doped semiconductor structure, such as a p-type GaAs semiconductor layer.

  19. Self-triggering superconducting fault current limiter

    DOE Patents [OSTI]

    Yuan, Xing (Albany, NY); Tekletsadik, Kasegn (Rexford, NY)

    2008-10-21T23:59:59.000Z

    A modular and scaleable Matrix Fault Current Limiter (MFCL) that functions as a "variable impedance" device in an electric power network, using components made of superconducting and non-superconducting electrically conductive materials. The matrix fault current limiter comprises a fault current limiter module that includes a superconductor which is electrically coupled in parallel with a trigger coil, wherein the trigger coil is magnetically coupled to the superconductor. The current surge doing a fault within the electrical power network will cause the superconductor to transition to its resistive state and also generate a uniform magnetic field in the trigger coil and simultaneously limit the voltage developed across the superconductor. This results in fast and uniform quenching of the superconductors, significantly reduces the burnout risk associated with non-uniformity often existing within the volume of superconductor materials. The fault current limiter modules may be electrically coupled together to form various "n" (rows).times."m" (columns) matrix configurations.

  20. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does exist between certain...

  1. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools 

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, ...

  2. Head black woman in charge: An investigation of how black female athletic directors negotiate their race, gender, and class identities

    E-Print Network [OSTI]

    McDowell, Jacqueline

    2009-05-15T23:59:59.000Z

    Framed as an instrumental case study, the purpose of this investigation was to understand how a select group of women, Black female athletic directors, define and negotiate their race, gender, and class identities. Data was collected via a...

  3. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States 

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does ...

  4. The Role Mentoring Plays in a White Female Novice Teacher's Perceptions of Her Enculturation into a Culturally Diverse Campus

    E-Print Network [OSTI]

    Noble, Erica Michelle

    2012-07-16T23:59:59.000Z

    played in a White female novice teacher's perceptions of her enculturation into a culturally diverse campus. Several methods of data collection were used, including 9 semi-structured interviews with the novice teacher, email dialogues, 3 days...

  5. A Cholinergic Sensory-Motor Circuit Controls the Male Copulation Behavior in C. elegans

    E-Print Network [OSTI]

    Liu, Yishi

    2012-07-16T23:59:59.000Z

    for the degree of DOCTOR OF PHILOSOPHY Approved by: Chair of Committee, L. Rene Garcia Committee Members, James Grau Brian Perkins Michael Smotherman Head of Department, Jack McMahan May 2011 Major Subject: Biology iii ABSTRACT A... Cholinergic Sensory-motor Circuit Controls the Male Copulation Behavior In C. elegans. (May 2011) Yishi Liu, B.S., Huazhong Agricultural University Chair of Advisory Committee: Dr. L. Rene Garcia The nervous system coordinates a sequence of muscle...

  6. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE TEACHERS IN DIVERSE SCHOOLS A Dissertation by KATHY ANN ATTAWAY Submitted to the Office of Graduate Studies of Texas A&M University... in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2007 Major Subject: Educational Administration INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE...

  7. Acculturation and Transformation among Female Immigrant Military Spouses in an ESL Learning Program at a Community College

    E-Print Network [OSTI]

    Darnell, Patricia

    2012-07-16T23:59:59.000Z

    ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A&M University in partial... Copyright 2012 Patricia Darnell ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A...

  8. Current generation by phased injection of pellets

    SciTech Connect (OSTI)

    Fisch, N.J.

    1983-08-01T23:59:59.000Z

    By phasing the injection of frozen pellets into a tokamak plasma, it is possible to generate current. The current occurs when the electron flux to individual members of an array of pellets is asymmetric with respect to the magnetic field. The utility of this method for tokamak reactors, however, is unclear; the current, even though free in a pellet-fueled reactor, may not be large enough to be worth the trouble. Uncertainty as to the utility of this method is, in part, due to uncertainty as to proper modeling of the one-pellet problem.

  9. Rotor heating effects from geomagnetic induced currents

    SciTech Connect (OSTI)

    Gish, W.B.; Feero, W.E.; Rockefeller, G.D. (Electric Research and Management, Inc., State College, PA (United States))

    1994-04-01T23:59:59.000Z

    The heating effects at the end-ring connection areas of the rotor due to the harmonic current generation of a saturating unit transformer from geomagnetic induced currents (GIC) on the transmission system have been calculated from observed data and from EMTP studies sponsored by the Electric Power Research Institute. These calculations show that damage may occur during strong GIC storm activity. This damage can occur from unit transformer saturation or other transformers in the system near the generator. The possibility of damage should be monitored during strong GIC storms through the use of appropriate negative sequence current monitoring and alarms.

  10. Eddy current technique for predicting burst pressure

    DOE Patents [OSTI]

    Petri, Mark C. (Yorkville, IL); Kupperman, David S. (Oak Park, IL); Morman, James A. (Woodridge, IL); Reifman, Jaques (Western Springs, IL); Wei, Thomas Y. C. (Downers Grove, IL)

    2003-01-01T23:59:59.000Z

    A signal processing technique which correlates eddy current inspection data from a tube having a critical tubing defect with a range of predicted burst pressures for the tube is provided. The method can directly correlate the raw eddy current inspection data representing the critical tubing defect with the range of burst pressures using a regression technique, preferably an artificial neural network. Alternatively, the technique deconvolves the raw eddy current inspection data into a set of undistorted signals, each of which represents a separate defect of the tube. The undistorted defect signal which represents the critical tubing defect is related to a range of burst pressures utilizing a regression technique.

  11. Apparatus for producing voltage and current pulses

    DOE Patents [OSTI]

    Kirbie, Hugh (Los Alamos, NM); Dale, Gregory E. (Los Alamos, NM)

    2010-12-21T23:59:59.000Z

    An apparatus having one or more modular stages for producing voltage and current pulses. Each module includes a diode charging means to charge a capacitive means that stores energy. One or more charging impedance means are connected to the diode charging means to provide a return current pathway. A solid-state switch discharge means, with current interruption capability, is connected to the capacitive means to discharge stored energy. Finally, a control means is provided to command the switching action of the solid-state switch discharge means.

  12. Transformer current sensor for superconducting magnetic coils

    DOE Patents [OSTI]

    Shen, S.S.; Wilson, C.T.

    1985-04-16T23:59:59.000Z

    The present invention is a current transformer for operating currents larger than 2kA (two kiloamps) that is capable of detecting a millivolt level resistive voltage in the presence of a large inductive voltage. Specifically, the present invention includes substantially cylindrical primary turns arranged to carry a primary current and substantially cylindrical secondary turns arranged coaxially with and only partially within the primary turns, the secondary turns including an active winding and a dummy winding, the active and dummy windings being coaxial, longitudinally separated and arranged to mutually cancel voltages excited by commonly experienced magnetic fields, the active winding but not the dummy winding being arranged within the primary turns.

  13. Polarized electron beams at milliampere average current

    SciTech Connect (OSTI)

    Poelker, Matthew [JLAB

    2013-11-01T23:59:59.000Z

    This contribution describes some of the challenges associated with developing a polarized electron source capable of uninterrupted days-long operation at milliAmpere average beam current with polarization greater than 80%. Challenges will be presented in the context of assessing the required level of extrapolation beyond the performance of today's CEBAF polarized source operating at ~ 200 uA average current. Estimates of performance at higher current will be based on hours-long demonstrations at 1 and 4 mA. Particular attention will be paid to beam-related lifetime-limiting mechanisms, and strategies to construct a photogun that operate reliably at bias voltage > 350kV.

  14. Current Reversals and Synchronization in Coupled Ratchets

    E-Print Network [OSTI]

    U. E. Vincent; A. Kenfack; D. V. Senthilkumar; D. Mayer; J. Kürths

    2010-09-26T23:59:59.000Z

    Current reversal is an intriguing phenomenon that has been central to recent experimental and theoretical investigations of transport based on ratchet mechanism. By considering a system of two interacting ratchets, we demonstrate how the coupling can be used to control the reversals. In particular, we find that current reversal that exists in a single driven ratchet system can ultimately be eliminated with the presence of a second ratchet. For specific coupling strengths a current-reversal free regime has been detected. Furthermore, in the fully synchronized state characterized by the coupling threshold $k_{th}$, a specific driving amplitude $a_{opt}$ is found for which the transport is optimum.

  15. 04/16/2007 11:56 AMMore Females Because Sisters Kill Their Brothers -Not such an altruistic behavior in parasitoid wasps -Softpedia Page 1 of 2http://news.softpedia.com/news/More-Females-Because-They-Kill-Male-Offspring-51802.shtml

    E-Print Network [OSTI]

    Gardner, Andy

    Insect Brain Changed as They Evolved to More Social Parasitoid Wasps Could Be Future's Weapon AgainstDefender Antivirus Guaranteed detection and removal of all viruses. PC World Best Buy! visit site > SIPfoundry A Free

  16. Protection of the female reproductive system from natural and artificial insults

    DOE Patents [OSTI]

    Tilly, Jonathan L. (Windham, NH); Kolesnick, Richard N. (New York, NY)

    2010-12-14T23:59:59.000Z

    Described are methods for protecting the female reproductive system against natural and artificial insults by administering to women a composition comprising an agent that antagonizes one or more acid sphingomyelinase (ASMase) gene products. Specifically, methods disclosed herein serve to protect women's germline from damage resulting from cancer therapy regimens including chemotherapy or radiotherapy. In one aspect, the method preserves, enhances, or revives ovarian function in women, by administering to women a composition containing sphingosine-1-phosphate, or an analog thereof. Also disclosed are methods to prevent or ameliorate menopausal syndromes and to improve in vitro fertilization techniques.

  17. A review of "Rembrandt and the Female Nude" by Eric Jan Sluijter

    E-Print Network [OSTI]

    Silver, Larry

    2007-01-01T23:59:59.000Z

    arguments. The center of the book, nearly 200 pages long, is aptly titled ?Doctrine.? Eric Jan Sluijter. Rembrandt and the Female Nude. Amsterdam University Press, 2006. 448pp. + 100 color, 250 b/w illus. $74.50/59.50 Euros. Review by LARRY SILVER... materials. Eric Jan Sluijter, professor of Dutch and Renaissance art history at the University of Leiden, wrote his earlier studies exploring the Dutch visual- ization of Greco-Roman myths as well as interpretive issues concerning the 186 SEVENTEENTH...

  18. alternating current systems: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an absolute accuracy of 0.2 % in the current range from 1 to 180 A Parametric Current Transformer (PCT calibrations against a parametric current transformer (PCT) manufactured...

  19. A Superconducting transformer system for high current cable testing

    E-Print Network [OSTI]

    Godeke, A.

    2010-01-01T23:59:59.000Z

    A Superconducting Transformer System for High Current Cablea Direct-Current (DC) superconducting transformer system forhigh current test of superconducting cables. The transformer

  20. Eddy-current-induced multipole field calculations.

    SciTech Connect (OSTI)

    Sereno, N. S.; Kim, S. H.

    2003-10-15T23:59:59.000Z

    Time-varying magnetic fields of magnets in booster accelerators induce substantial eddy currents in the vacuum chambers. The eddy currents in turn act to produce various multipole fields that act on the beam. These fields must be taken into account when doing a lattice design. In the APS booster, the relatively long dipole magnets (3 meters) are linearly ramped to accelerate the injected 325 MeV beam to 7 GeV. Substantial dipole and sextupole fields are generated in the elliptical vacuum chamber from the induced eddy currents. In this note, formulas for the induced dipole and sextupole fields are derived for elliptical and rectangular vacuum chambers for a time-varying dipole field. A discussion is given on how to generalize this derivation method to include eddy-current-induced multipole fields from higher multipole magnets (quadrupole, sextupole, etc.). Finally, transient effects are considered.

  1. Transformer current sensor for superconducting magnetic coils

    DOE Patents [OSTI]

    Shen, Stewart S. (Oak Ridge, TN); Wilson, C. Thomas (Norris, TN)

    1988-01-01T23:59:59.000Z

    A transformer current sensor having primary turns carrying a primary current for a superconducting coil and secondary turns only partially arranged within the primary turns. The secondary turns include an active winding disposed within the primary turns and a dummy winding which is not disposed in the primary turns and so does not experience a magnetic field due to a flow of current in the primary turns. The active and dummy windings are wound in opposite directions or connected in series-bucking relationship, and are exposed to the same ambient magnetic field. Voltages which might otherwise develop in the active and dummy windings due to ambient magnetic fields thus cancel out. The resultant voltage is purely indicative of the rate of change of current flowing in the primary turns.

  2. Current TES Capabilities in TRNSYS (Presentation)

    SciTech Connect (OSTI)

    Price, H.; Blair, N.

    2003-02-01T23:59:59.000Z

    This presentation includes: a brief overview of TRNSYS, a review of current SolarPaces models, potential of other models appropriate for CSP TES, and a review of a project proposal.

  3. AGRICULTURE, 2003 Current Wisconsin Farm Financial Conditions

    E-Print Network [OSTI]

    Radeloff, Volker C.

    STATUS OF WISCONSIN AGRICULTURE, 2003 Current Wisconsin Farm Financial Conditions Situation and Challenges Department of Agricultural and Applied Economics College of Agricultural and Life Sciences OF WISCONSIN AGRICULTURE, 2003 An Annual Report by: Department of Agricultural and Applied Economics College

  4. AGRICULTURE, 2001 Current Wisconsin Farm Financial Conditions

    E-Print Network [OSTI]

    Radeloff, Volker C.

    STATUS OF WISCONSIN AGRICULTURE, 2001 Current Wisconsin Farm Financial Conditions Situation and Outlook for Farm Products and Inputs Special Articles · Outlook for the National Economy and Agricultural Policies · Smart Growth and Wisconsin Agriculture · The Wisconsin Agricultural Economy: A Broader

  5. CURRENT SITUATION AND COUNTERMEASURES OF AGRICULTURAL

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    CURRENT SITUATION AND COUNTERMEASURES OF AGRICULTURAL INFORMATION CONSTRUCTION IN JIAMUSI AREA of agricultural information construction in Jiamusi area, the achievements obtained from agricultural information, the existing problems of agricultural information construction are found. The reasons of these problems

  6. Detecting topological currents in graphene superlattices

    E-Print Network [OSTI]

    Gorbachev, R. V.

    Topological materials may exhibit Hall-like currents flowing transversely to the applied electric field even in the absence of a magnetic field. In graphene superlattices, which have broken inversion symmetry, topological ...

  7. Current technologies and trends of aluminum design

    E-Print Network [OSTI]

    Chen, Michael, 1981-

    2004-01-01T23:59:59.000Z

    A literature review of current aluminum technology in the building and construction industry was carried out. Aluminum is an ideal material for building in corrosive environments and for building structures where small ...

  8. Comparison of Current LCD Tracking Options

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Comparison of Current LCD Tracking Options Bruce Schumm Santa Cruz Institute for Particle Physics for new S design (pattern recognition, resolution) S detector in real trouble at low angle w/out beam

  9. Comparison of Current LCD Tracking Options

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Comparison of Current LCD Tracking Options Bruce Schumm Santa Cruz Institute for Particle Physics tracking somewhat more pressed for new S design (pattern recognition, ` resolution) S detector in real

  10. On the Measured Current in Electrospinning

    E-Print Network [OSTI]

    Bhattacharjee, P. K.

    The origin and scaling of the current measured during steady electrospinning of polymer solutions in organic solvents are considered. For a specified electric field strength E, flow rate Q, and conductivity K, the total ...

  11. Non-contact current and voltage sensor

    DOE Patents [OSTI]

    Carpenter, Gary D; El-Essawy, Wael; Ferreira, Alexandre Peixoto; Keller, Thomas Walter; Rubio, Juan C; Schappert, Michael A

    2014-03-25T23:59:59.000Z

    A detachable current and voltage sensor provides an isolated and convenient device to measure current passing through a conductor such as an AC branch circuit wire, as well as providing an indication of an electrostatic potential on the wire, which can be used to indicate the phase of the voltage on the wire, and optionally a magnitude of the voltage. The device includes a housing that contains the current and voltage sensors, which may be a ferrite cylinder with a hall effect sensor disposed in a gap along the circumference to measure current, or alternative a winding provided through the cylinder along its axis and a capacitive plate or wire disposed adjacent to, or within, the ferrite cylinder to provide the indication of the voltage.

  12. INNOVATIVE EDDY CURRENT PROBE FOR MICRO DEFECTS

    SciTech Connect (OSTI)

    Santos, Telmo G.; Vilaca, Pedro; Quintino, Luisa [IDMEC, Av. Rovisco Pais, 1049-001 Lisbon (Portugal); Santos, Jorge dos [GKSS, Max-Planck-Street 1, D-21502 Geesthacht (Germany); Rosado, Luis [IST, UTL, Av. Rovisco Pais, 1049-001 Lisbon (Portugal)

    2010-02-22T23:59:59.000Z

    This paper reports the development of an innovative eddy current (EC) probe, and its application to micro-defects on the root of the Friction Stir Welding (FSW). The new EC probe presents innovative concept issues, allowing 3D induced current in the material, and a lift-off independence. Validation experiments were performed on aluminium alloys processed by FSW. The results clearly show that the new EC probe is able to detect and sizing surface defects about 60 microns depth.

  13. Heating and current drive systems for TPX

    SciTech Connect (OSTI)

    Swain, D.; Goranson, P. [Oak Ridge National Lab., TN (United States); Halle, A. von; Bernabei, S.; Greenough, N. [Princeton Univ., NJ (United States). Plasma Physics Lab.

    1994-05-24T23:59:59.000Z

    The heating and current drive (H and CD) system proposed for the TPX tokamak will consist of ion cyclotron, neutral beam, and lower hybrid systems. It will have 17.5 MW of installed H and CD power initially, and can be upgraded to 45 MW. It will be used to explore advanced confinement and fully current-driven plasma regimes with pulse lengths of up to 1,000 s.

  14. Stray currents -- Generation, interference effects and control

    SciTech Connect (OSTI)

    Nikolakakos, S. [Raytheon Engineers and Constructors, Inc., Lyndhurst, NJ (United States)

    1998-12-31T23:59:59.000Z

    Stray currents, mostly known for their detrimental corrosion affects on the underground structures, can be effectively controlled by the implementation of specific measures at both the source of generation and at the affected structure(s). This paper discusses the most serious sources of stray current generation, the resulting problems and the numerous control methods that can be utilized to minimize corrosion and safety problems. Safety concerns associated with dc power systems are also discussed.

  15. Electronic constant current and current pulse signal generator for nuclear instrumentation testing

    DOE Patents [OSTI]

    Brown, Roger A. (Amsterdam, NY)

    1994-01-01T23:59:59.000Z

    Circuitry for testing the ability of an intermediate range nuclear instrut to detect and measure a constant current and a periodic current pulse. The invention simulates the resistance and capacitance of the signal connection of a nuclear instrument ion chamber detector and interconnecting cable. An LED flasher/oscillator illuminates an LED at a periodic rate established by a timing capacitor and circuitry internal to the flasher/oscillator. When the LED is on, a periodic current pulse is applied to the instrument. When the LED is off, a constant current is applied. An inductor opposes battery current flow when the LED is on.

  16. Electronic constant current and current pulse signal generator for nuclear instrumentation testing

    DOE Patents [OSTI]

    Brown, R.A.

    1994-04-19T23:59:59.000Z

    Circuitry is described for testing the ability of an intermediate range nuclear instrument to detect and measure a constant current and a periodic current pulse. The invention simulates the resistance and capacitance of the signal connection of a nuclear instrument ion chamber detector and interconnecting cable. An LED flasher/oscillator illuminates an LED at a periodic rate established by a timing capacitor and circuitry internal to the flasher/oscillator. When the LED is on, a periodic current pulse is applied to the instrument. When the LED is off, a constant current is applied. An inductor opposes battery current flow when the LED is on. 1 figures.

  17. KAUAI CEANNEL CURRENTS THESIS SUBMITTED TO TEE GRADUATE

    E-Print Network [OSTI]

    Luther, Douglas S.

    from August L95, through Novem ber 1966. Direct current measurements were made by a Savonius current

  18. Semen parameters of Callithrix jacchus: ejaculates from selected males of proven fertility

    E-Print Network [OSTI]

    Busch, Leo Joseph

    1981-01-01T23:59:59.000Z

    . Presently, however, both of these species are only available in extremely limited numbers from a small number of domestic breeding facilities. Although researchers here in the United States have only just begun utilizing the small Brazilian common... laboratory primate. Its small size, approximately 25 cm in height and 300 g in weight at maturity, makes it relatively easy to handle and inexpens1ve to house and feed. It becomes sexually mature at 14 to 18 months, with the female hav1ng an ovar1an cycle...

  19. The Effect of Cues of Parental Investment on Attractiveness Ratings of Males: The Impact of Child Presence and Age 

    E-Print Network [OSTI]

    Went, Hannah

    2007-01-01T23:59:59.000Z

    According to evolutionary theories of mate choice, male parental investment is a desired characteristic of long term mates. Brase (2006) found that cues of a positive disposition towards parental investment increased ...

  20. The Effect of Music Therapy on Executive Function Skills in Male, Incarcerated Adults in a Correctional Facility

    E-Print Network [OSTI]

    Ellis, Elisha

    2014-05-31T23:59:59.000Z

    The purpose of the present study was to examine the effect of participation in a music therapy group on the executive function skills of male, incarcerated adults in a county correctional facility. Participants (N=16) were ...

  1. The Relationship Between Teachers' Preparation and Perceived Level of Technology Use in Mathematics With Middle School African American Males

    E-Print Network [OSTI]

    Mason, Sherrie Dee

    2012-10-19T23:59:59.000Z

    that the level of teachers' preparedness had an influence on the use and implementation of technology use in the classroom. Teachers' preparedness in the use of instructional technology was related to their African American male students' mathematical achievement...

  2. SPALLATION NEUTRON SOURCE BEAM CURRENT MONITOR ELECTRONICS.

    SciTech Connect (OSTI)

    KESSELMAN, M.

    2001-06-18T23:59:59.000Z

    The Spallation Neutron Source (SNS) to be constructed at ORNL is a collaboration of six laboratories. Beam current monitors for SNS will be used to monitor H-minus and H-plus beams ranging from the 15 mA (tune-up in the Front End and Linac) to over 60 A fully accumulated in the Ring. The time structure of the beams to be measured range from 645 nsec ''mini'' bunches, at the 1.05 MHz ring revolution rate, to an overall 1 mS long macro pulse. Beam current monitors (BCMs) for SNS have requirements depending upon their location within the system. The development of a general approach to satisfy requirements of various locations with common components is a major design objective. This paper will describe the development of the beam current monitors and electronics.

  3. Polarized electron beams at milliampere average current

    SciTech Connect (OSTI)

    Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States)

    2013-11-07T23:59:59.000Z

    This contribution describes some of the challenges associated with developing a polarized electron source capable of uninterrupted days-long operation at milliAmpere average beam current with polarization greater than 80%. Challenges will be presented in the context of assessing the required level of extrapolation beyond the performance of today’s CEBAF polarized source operating at ? 200 uA average current. Estimates of performance at higher current will be based on hours-long demonstrations at 1 and 4 mA. Particular attention will be paid to beam-related lifetime-limiting mechanisms, and strategies to construct a photogun that operate reliably at bias voltage > 350kV.

  4. Topological Current in Fractional Chern Insulators

    E-Print Network [OSTI]

    Koma, Tohru

    2015-01-01T23:59:59.000Z

    We consider interacting fermions in a magnetic field on a two-dimensional lattice with the periodic boundary conditions. In order to measure the Hall current, we apply an electric potential with a compact support. Then, due to the Lorentz force, the Hall current appears along the equipotential line. Introducing a local current operator at the edge of the potential, we derive the Hall conductance as a linear response coefficient. For a wide class of the models, we prove that if there exists a spectral gap above the degenerate ground state, then the Hall conductance of the ground state is fractionally quantized without averaging over the fluxes. This is an extension of the topological argument for the integrally quantized Hall conductance in noninteracting fermion systems on lattices.

  5. Topological Current in Fractional Chern Insulators

    E-Print Network [OSTI]

    Tohru Koma

    2015-04-06T23:59:59.000Z

    We consider interacting fermions in a magnetic field on a two-dimensional lattice with the periodic boundary conditions. In order to measure the Hall current, we apply an electric potential with a compact support. Then, due to the Lorentz force, the Hall current appears along the equipotential line. Introducing a local current operator at the edge of the potential, we derive the Hall conductance as a linear response coefficient. For a wide class of the models, we prove that if there exists a spectral gap above the degenerate ground state, then the Hall conductance of the ground state is fractionally quantized without averaging over the fluxes. This is an extension of the topological argument for the integrally quantized Hall conductance in noninteracting fermion systems on lattices.

  6. Variable energy constant current accelerator structure

    DOE Patents [OSTI]

    Anderson, O.A.

    1988-07-13T23:59:59.000Z

    A variable energy, constant current ion beam accelerator structure is disclosed comprising an ion source capable of providing the desired ions, a pre-accelerator for establishing an initial energy level, a matching/pumping module having means for focusing means for maintaining the beam current, and at least one main accelerator module for continuing beam focus, with means capable of variably imparting acceleration to the beam so that a constant beam output current is maintained independent of the variable output energy. In a preferred embodiment, quadrupole electrodes are provided in both the matching/pumping module and the one or more accelerator modules, and are formed using four opposing cylinder electrodes which extend parallel to the beam axis and are spaced around the beam at 90/degree/ intervals with opposing electrodes maintained at the same potential. 12 figs., 3 tabs.

  7. Factors affecting alcohol treatment in males: an estimation of gender-role issues, self-concept, and psychiatric symptomatology

    E-Print Network [OSTI]

    Clark, Betty Lynn

    1993-01-01T23:59:59.000Z

    FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER ROLE ISSUES ~ SELF CONCEPT AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY LYNN CLARK Submitted to the Office of Graduate Studies of Texas A&M University in partial... fulfillment of the requirements for the degree MASTER OF SCIENCE August 1993 Major Subject: Psychology FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER-ROLE ISSUES, SELF-CONCEPT, AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY...

  8. Casimir interaction from magnetically coupled eddy currents

    E-Print Network [OSTI]

    Francesco Intravaia; Carsten Henkel

    2009-09-06T23:59:59.000Z

    We study the quantum and thermal fluctuations of eddy (Foucault) currents in thick metallic plates. A Casimir interaction between two plates arises from the coupling via quasi-static magnetic fields. As a function of distance, the relevant eddy current modes cross over from a quantum to a thermal regime. These modes alone reproduce previously discussed thermal anomalies of the electromagnetic Casimir interaction between good conductors. In particular, they provide a physical picture for the Casimir entropy whose nonzero value at zero temperature arises from a correlated, glassy state.

  9. Casimir Interaction from Magnetically Coupled Eddy Currents

    SciTech Connect (OSTI)

    Intravaia, Francesco; Henkel, Carsten [Institut fuer Physik und Astronomie, Universitaet Potsdam, 14476 Potsdam (Germany)

    2009-09-25T23:59:59.000Z

    We study the quantum and thermal fluctuations of eddy (Foucault) currents in thick metallic plates. A Casimir interaction between two plates arises from the coupling via quasistatic magnetic fields. As a function of distance, the relevant eddy current modes cross over from a quantum to a thermal regime. These modes alone reproduce previously discussed thermal anomalies of the electromagnetic Casimir interaction between good conductors. In particular, they provide a physical picture for the Casimir entropy whose nonzero value at zero temperature arises from a correlated, glassy state.

  10. Modular High Current Test Facility at LLNL

    SciTech Connect (OSTI)

    Tully, L K; Goerz, D A; Speer, R D; Ferriera, T J

    2008-05-20T23:59:59.000Z

    This paper describes the 1 MA, 225 kJ test facility in operation at Lawrence Livermore National Laboratory (LLNL). The capacitor bank is constructed from three parallel 1.5 mF modules. The modules are capable of switching simultaneously or sequentially via solid dielectric puncture switches. The bank nominally operates up to 10 kV and reaches peak current with all three cabled modules in approximately 30 {micro}s. Parallel output plates from the bank allow for cable or busbar interfacing to the load. This versatile bank is currently in use for code validation experiments, railgun related activities, switch testing, and diagnostic development.

  11. Current Status of Concentrator Photovoltaic (CPV) Technology

    SciTech Connect (OSTI)

    Philipps, S. P.; Bett, A. W.; Horowitz, K.; Kurtz, S.

    2015-01-01T23:59:59.000Z

    This report describes the current status of the market and technology for concentrator photovoltaic (CPV) cells and modules. Significant progress in CPV has been achieved, including record efficiencies for modules (36.7%) and cells (46%), as well as growth of large field installations in recent years. CPV technology may also have the potential to be cost-competitive on a levelized cost of energy (LCOE) basis in regions of high direct normal irradiance (DNI). The study includes an overview of all installations larger than 1 MW, information on companies currently active in the CPV field, efficiency data, and estimates of the LCOE in different scenarios.

  12. Casimir interaction from magnetically coupled eddy currents

    E-Print Network [OSTI]

    Intravaia, Francesco

    2009-01-01T23:59:59.000Z

    We study the Casimir interaction due to eddy (Foucault) currents in thick metallic plates. The Drude model is used to describe the optical response of the metal at low frequencies. A repulsive force arises from the electromagnetic coupling between chargeless currents filling the metallic half-spaces. We show that these overdamped modes are entirely responsible for the thermal anomalies of the Casimir force between good conductors. It turns out that the applicability of the Nernst heat theorem (third law of thermodynamics) must be reviewed since the ground state of the coupled metal+field system can become highly degenerate at zero temperature.

  13. Current Long-Term Operating Schedule

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 EmploymentCurrent

  14. Current in Batteries | GE Global Research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublicCurrent ProjectsCurrentDOEWhy

  15. Columbia River Plume andColumbia River Plume and California Current Ecosystem:California Current Ecosystem

    E-Print Network [OSTI]

    Leonard, Fish, Wildlife, Ecosystem Monitoring and Evaluation Manager SUBJECT: Summary of Public and ISAB substitution), wildlife, habitat/ecosystem questions thereby balancing the currently predominant anadromous

  16. Solar neutrino interactions: Using charged currents at SNO to tell neutral currents at Super-Kamiokande

    E-Print Network [OSTI]

    F. L. Villante; G. Fiorentini; E. Lisi

    1998-07-13T23:59:59.000Z

    In the presence of flavor oscillations, muon and tau neutrinos can contribute to the Super-Kamiokande (SK) solar neutrino signal through the neutral current process \

  17. Measured voltages and currents internal to closed metal cylinders due to diffusion of simulated lightning currents

    SciTech Connect (OSTI)

    Schnetzer, G.H.; Fisher, R.J.

    1994-08-01T23:59:59.000Z

    One mechanism for the penetration of lightning energy into the interior of a weapon is by current diffusion through the exterior metal case. Tests were conducted in which simulated lightning currents were driven over the exteriors of similar aluminum and ferrous steel cylinders of 0.125-in wall thickness. Under conditions in which the test currents were driven asymmetrically over the exteriors of the cylinders, voltages were measured between various test points in the interior as functions of the amplitude and duration of the applied current. The maximum recorded open-circuit voltage, which occurred in the steel cylinder, was 1.7 V. On separate shots, currents flowing on a low impedance shorting conductor between the same set of test points were also measured, yielding a maximum current of 630 A, again occurring across the interior of the steel cylinder. Under symmetrical exterior drive current conditions, a maximum end-to-end internal voltage of 4.1 V was obtained, also in the steel cylinder, with a corresponding current of 480 A measured on a coaxial conductor connected between the two end plates of the cylinder. Data were acquired over a range of input current amplitudes between about 40 and 100 kA. These data provide the experimental basis for validating models that can subsequently be applied to real weapons and other objects of interest.

  18. LEDs_3LEDs_3 current efficiency

    E-Print Network [OSTI]

    Pulfrey, David L.

    efficiencySec. 8.2 From our toolbox Current efficiency #12;4 Light extraction efficiencyLight extraction extraction efficiencyDesign to improve extraction efficiencySec. 8.4 What are the features of this LED from;6 Various efficienciesVarious efficienciesSecs. 8.4, 8.5 Present record is 56%Wall-plug efficiency Wall

  19. CURRENT DEGREE PROGRAMS MBO NON-DEGREE

    E-Print Network [OSTI]

    Guenther, Frank

    CURRENT DEGREE PROGRAMS MBO NON-DEGREE Masters level coursework MBO 40 0000 A CONTROL GROUPS FOR NON-DEGREE CANDIDATES The control group is not a major; a non-degree program of study also be selected. - CERTIFICATE Computer Information Systems This program of study is for Brussels - Vrije only MBO 01 0702

  20. Light sources based on semiconductor current filaments

    DOE Patents [OSTI]

    Zutavern, Fred J. (Albuquerque, NM); Loubriel, Guillermo M. (Albuquerque, NM); Buttram, Malcolm T. (Sandia Park, NM); Mar, Alan (Albuquerque, NM); Helgeson, Wesley D. (Albuquerque, NM); O'Malley, Martin W. (Edgewood, NM); Hjalmarson, Harold P. (Albuquerque, NM); Baca, Albert G. (Albuquerque, NM); Chow, Weng W. (Cedar Crest, NM); Vawter, G. Allen (Albuquerque, NM)

    2003-01-01T23:59:59.000Z

    The present invention provides a new type of semiconductor light source that can produce a high peak power output and is not injection, e-beam, or optically pumped. The present invention is capable of producing high quality coherent or incoherent optical emission. The present invention is based on current filaments, unlike conventional semiconductor lasers that are based on p-n junctions. The present invention provides a light source formed by an electron-hole plasma inside a current filament. The electron-hole plasma can be several hundred microns in diameter and several centimeters long. A current filament can be initiated optically or with an e-beam, but can be pumped electrically across a large insulating region. A current filament can be produced in high gain photoconductive semiconductor switches. The light source provided by the present invention has a potentially large volume and therefore a potentially large energy per pulse or peak power available from a single (coherent) semiconductor laser. Like other semiconductor lasers, these light sources will emit radiation at the wavelength near the bandgap energy (for GaAs 875 nm or near infra red). Immediate potential applications of the present invention include high energy, short pulse, compact, low cost lasers and other incoherent light sources.

  1. Experimental investigation of beryllium: plans and current

    E-Print Network [OSTI]

    McDonald, Kirk

    1 Experimental investigation of beryllium: plans and current results within the Ra;3 Beryllium is a promising candidate because of: · good "nuclear" properties; · appropriate mechanical will Beryllium be used? Application Operating conditions Proton beam parametersAvg. T (°C) Peak T (°C) Total DPA

  2. CANARY CURRENT LARGE MARINE ECOSYSTEM (CCLME) PROJECT

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    1 CANARY CURRENT LARGE MARINE ECOSYSTEM (CCLME) PROJECT CCLME Inception Workshop 2-3 November 2010. Two possible case studies are presented: the Imraguen social-ecosystem of the Banc d'Arguin National Park, the Bamboung marine protected area social-ecosystem. Key words Social-ecological system, climate

  3. AGRICULTURE, 2002 Current Wisconsin Farm Financial Conditions

    E-Print Network [OSTI]

    Radeloff, Volker C.

    STATUS OF WISCONSIN AGRICULTURE, 2002 Current Wisconsin Farm Financial Conditions Situation of the Wisconsin Cranberry Industry Department of Agricultural and Applied Economics College of Agricultural-Extension #12;STATUS OF WISCONSIN AGRICULTURE, 2002 An Annual Report by: Department of Agricultural and Applied

  4. Energy Storage: Current landscape for alternative energy

    E-Print Network [OSTI]

    Energy Storage: Current landscape for alternative energy storage technologies and what the future may hold for multi-scale storage applications Presented by: Dave Lucero, Director Alternative Energy Implantable Devices Aerospace Systems Satellites Aircraft Commercial Alternative Energy #12;4Copyright© 2010

  5. The Maine Coastal Current: Spring Climatological Circulation

    E-Print Network [OSTI]

    on the Coastal Current. The nested calculations also expose finer structure due to river sources, heat flux, river discharges) and remote (Gulf­scale) forcing are examined. Tidal rectification in the Eastern Gulf; otherwise unreal­ istic exchanges with the Gulf occur. An approximate division of local and remote dynamical

  6. Deep boundary current disintegration in Drake Passage

    E-Print Network [OSTI]

    Naveira Garabato, Alberto

    , Alberto C. Naveira Garabato1 , David A. Smeed2 , Kevin G. Speer3 , Andreas M. Thurnherr4 , Michael P the Antarctic Circumpolar Current (ACC) [Marshall and Speer, 2012]. These interme- diate waters must transit and enters the ACC in Drake Passage [DeMets et al., 1990; Tsuchiya and Talley, 1998; Faure and Speer, 2012

  7. MER SAVA February, 2013 CURRENT RESEARCH SUMMARY

    E-Print Network [OSTI]

    Mofrad, Mohammad R. K.

    ) and Berkeley (Profs. Marcus and Sava). Ocean Wave Energy In current prototypes, buoy-type ocean wave energy established, the model is then used to show that the excitation scheme improves the power harvesting of the device's power harvesting capabilities to changes in damping becomes much smaller when the novel

  8. Beam current controller for laser ion source

    DOE Patents [OSTI]

    Okamura, Masahiro

    2014-10-28T23:59:59.000Z

    The present invention relates to the design and use of an ion source with a rapid beam current controller for experimental and medicinal purposes. More particularly, the present invention relates to the design and use of a laser ion source with a magnetic field applied to confine a plasma flux caused by laser ablation.

  9. Summary of beryllium specifications, current and historical

    SciTech Connect (OSTI)

    Abeln, S.P.; Kyed, P.

    1990-12-28T23:59:59.000Z

    This report summarizes beryllium properties included in producer, Department of Energy, and government specifications. The specifications are divided into two major categories: current and historical. Within each category the data are arranged primarily according to increasing purity and secondarily by increasing tensile properties. Qualitative comments on formability and weldability are included. Also, short summaries of powder production and consolidation techniques are provided.

  10. Bottom current measurements under the Gulf Stream

    E-Print Network [OSTI]

    Halikas, George

    1973-01-01T23:59:59.000Z

    of the Richardson type (RICHARDSON, STIMSON and WILKINS 1963) . A similar instrument partly dismantled is shown in Fig. 2 where the cage at the bottom of. the instrument contains the vane and the Savonius rotor for direction and speed sensing. The current...

  11. Flexible moldable conductive current-limiting materials

    SciTech Connect (OSTI)

    Shea, John Joseph (Pittsburgh, PA); Djordjevic, Miomir B. (Milwaukee, WI); Hanna, William Kingston (Pittsburgh, PA)

    2002-01-01T23:59:59.000Z

    A current limiting PTC device (10) has two electrodes (14) with a thin film of electric conducting polymer material (20) disposed between the electrodes, the polymer material (20) having superior flexibility and short circuit performance, where the polymer material contains short chain aliphatic diepoxide, conductive filler particles, curing agent, and, preferably, a minor amount of bisphenol A epoxy resin.

  12. Can biofuels justify current transport policies?

    E-Print Network [OSTI]

    Can biofuels justify current transport policies? Jérémie Mercier IARU Climate Congress - Copenhagen is growing 2) Today biofuels bring little or no greenhouse gas benefits 3) We need to change #12;IARU Climate;IARU Climate Congress, Copenhagen, 11th March 2009 - Jérémie Mercier 4 Biofuels consumption growing

  13. Current Directions in Freight and Logistics Industry

    E-Print Network [OSTI]

    Minnesota, University of

    Current Directions in Freight and Logistics Industry CTS Freight and Logistics Symposium November- the-box #12;Perspective Be sure to look-up from time-to-time #12;Why Discuss Freight and Logistics....Large Part of the Economy Logistics Cost As A Percent of GDP ­ 10% Source: CSCMP State of Logistics 2007 #12

  14. Current Status and Future Assumptions INTRODUCTION

    E-Print Network [OSTI]

    structure, higher electricity prices, and regional and national conservation efforts. 0 5000 10000 15000 of the region's electricity system, some relevant historical trends leading to that status, and the Council's projections of how that status might change in the future. An understanding of our current situation and how

  15. The Quail project: A Current Overview

    E-Print Network [OSTI]

    Oldford, R.W.

    The Quail project: A Current Overview R.W. Oldford Department of Statistics & Actuarial Science statistical systems for pcs, use of windows, icons, and mice for interface develop- ment, and new programming- tical modelling. Important extensions include a rich object- oriented statistical graphics and general

  16. Topology and current ribbons: A model for current, reconnection and flaring in a complex, evolving corona

    E-Print Network [OSTI]

    Longcope, Dana

    (MCC), for the build­up of magnetic energy in a three­dimensional corona of arbitrary geometry. The MCCTopology and current ribbons: A model for current, reconnection and flaring in a complex, evolving of energy from the Sun's chromosphere and corona. The build­up and release of energy in a flare has been

  17. Currents' Physical Components (CPC) In Circuits with Nonsinusoidal Voltages and Currents

    E-Print Network [OSTI]

    Czarnecki, Leszek S.

    and transformer turn ratio is 1:1, the active power at the supply terminals is P = 115.1 kW, while the apparentCurrents' Physical Components (CPC) In Circuits with Nonsinusoidal Voltages and Currents Part 2 state of discussions on power phenomena, power definitions and compensation in three-phase three

  18. Evaluating radial component current measurements from CODAR high frequency radars and moored in situ current meters

    E-Print Network [OSTI]

    California at Santa Barbara, University of

    error of 19o . The effects of bearing errors on total velocity vector estimates were evaluated usingEvaluating radial component current measurements from CODAR high frequency radars and moored of the moorings carried vector measuring current meters (VMCM's), the ninth an upward-looking acoustic Doppler

  19. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp 

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MANE MIGURA Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE August 1996 Major Subject: Horticulture EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MARIE MIGURA Submitted to Texas A...

  20. A review of "Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal" by Bryan Givens

    E-Print Network [OSTI]

    Hegstrom, Valerie

    2012-01-01T23:59:59.000Z

    reviews 65 Bryan Givens. Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal. Baton Rouge: Louisiana State University Press, 2011. viii + 255 pp. $48.00. Review by #17;#25; #30;#31;#18;#30; #23...;#30;#8;#26;#19;#31;#20;#21;, #28;#31;#18;#8;#23;#25;#21; #16;#20;#29;#27;#8; #29;#27;#18;#17;#30;#31;#26;#18;#19;#16;. In his preface to Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal, Bryan Givens tells us he did not set out to write a...

  1. Current algebra derivation of temperature dependence of hadron couplings with currents

    E-Print Network [OSTI]

    S. Mallik

    2006-08-12T23:59:59.000Z

    The vector and the axial-vector meson couplings with the vector and the axial-vector currents respectively at finite temperature have been obtained in Ref. \\cite{Mallik} by calculating all the relevant one-loop Feynman graphs with vertices obtained from the effective chiral Lagrangian. On the other hand, the same couplings were also derived in Ref.\\cite{Ioffe1} by applying the method of current algebra and the hypothesis of partial conservation of axial-vector current (PCAC). The latter method appears to miss certain terms; in the case of the vector meson coupling with the vector current, for example, a term containing the $\\rho\\omega\\pi$ coupling is missed. A similar situation would also appear for the nucleon coupling with the nucleon current. In this note we resolve these differences.

  2. Sex-based differences in gene expression in hippocampus following postnatal lead exposure

    SciTech Connect (OSTI)

    Schneider, J.S., E-mail: jay.schneider@jefferson.edu; Anderson, D.W.; Sonnenahalli, H.; Vadigepalli, R.

    2011-10-15T23:59:59.000Z

    The influence of sex as an effect modifier of childhood lead poisoning has received little systematic attention. Considering the paucity of information available concerning the interactive effects of lead and sex on the brain, the current study examined the interactive effects of lead and sex on gene expression patterns in the hippocampus, a structure involved in learning and memory. Male or female rats were fed either 1500 ppm lead-containing chow or control chow for 30 days beginning at weaning.Blood lead levels were 26.7 {+-} 2.1 {mu}g/dl and 27.1 {+-} 1.7 {mu}g/dl for females and males, respectively. The expression of 175 unique genes was differentially regulated between control male and female rats. A total of 167 unique genes were differentially expressed in response to lead in either males or females. Lead exposure had a significant effect without a significant difference between male and female responses in 77 of these genes. In another set of 71 genes, there were significant differences in male vs. female response. A third set of 30 genes was differentially expressed in opposite directions in males vs. females, with the majority of genes expressed at a lower level in females than in males. Highly differentially expressed genes in males and females following lead exposure were associated with diverse biological pathways and functions. These results show that a brief exposure to lead produced significant changes in expression of a variety of genes in the hippocampus and that the response of the brain to a given lead exposure may vary depending on sex. - Highlights: > Postnatal lead exposure has a significant effect on hippocampal gene expression patterns. > At least one set of genes was affected in opposite directions in males and females. > Differentially expressed genes were associated with diverse biological pathways.

  3. The declining use of the Mixtec language : the persistence of memory, discrimination, and social hierarchies of power

    E-Print Network [OSTI]

    Perry, Elizabeth

    2009-01-01T23:59:59.000Z

    Mixteco Spanish Female SMT Spanish None Male SMT SpanishNone Male SMT SpanishNone Male SMT Mixteco Spanish Male SMT Mixteco Spanish

  4. Current density fluctuations and ambipolarity of transport

    SciTech Connect (OSTI)

    Shen, W.; Dexter, R.N.; Prager, S.C.

    1991-10-01T23:59:59.000Z

    The fluctuation in the plasma current density is measured in the MIST reversed field pinch experiment. Such fluctuations, and the measured radial profile of the k spectrum of magnetic fluctuations, supports the view and that low frequency fluctuations (f < 30 kHz) are tearing modes and high frequency fluctuations (30 kHz < f < 250 kHz) are localized turbulence in resonance with the local equilibrium magnetic field (i.e., k {center dot} B = 0). Correlation of current density and magnetic fluctuations (< {tilde j}{parallel}{tilde B}{sub r} >) demonstrates that radial particle transport from particle motion parallel to a fluctuating magnetic field is ambipolar over the full frequency range.

  5. Current density fluctuations and ambipolarity of transport

    SciTech Connect (OSTI)

    Shen, W.; Dexter, R.N.; Prager, S.C.

    1991-10-01T23:59:59.000Z

    The fluctuation in the plasma current density is measured in the MIST reversed field pinch experiment. Such fluctuations, and the measured radial profile of the k spectrum of magnetic fluctuations, supports the view and that low frequency fluctuations (f < 30 kHz) are tearing modes and high frequency fluctuations (30 kHz < f < 250 kHz) are localized turbulence in resonance with the local equilibrium magnetic field (i.e., k {center_dot} B = 0). Correlation of current density and magnetic fluctuations (< {tilde j}{parallel}{tilde B}{sub r} >) demonstrates that radial particle transport from particle motion parallel to a fluctuating magnetic field is ambipolar over the full frequency range.

  6. SPALLATION NEUTRON SOURCE BEAM CURRENT MONITOR ELECTRONICS.

    SciTech Connect (OSTI)

    KESSELMAN,M.; DAWSON,W.C.

    2002-05-06T23:59:59.000Z

    This paper will discuss the present electronics design for the beam current monitor system to be used throughout the Spallation Neutron Source (SNS) under construction at Oak Ridge National Laboratory. The beam is composed of a micro-pulse structure due to the 402.5MHz RF, and is chopped into mini-pulses of 645ns duration with a 300ns gap, providing a macro-pulse of 1060 mini-pulses repeating at a 60Hz rate. Ring beam current will vary from about 15ma peak during studies, to about 50Amps peak (design to 100 amps). A digital approach to droop compensation has been implemented and initial test results presented.

  7. Current Experiments in Particle Physics (September 1996)

    SciTech Connect (OSTI)

    Galic, H.; Lehar, F.; Klyukhin, V.I.; Ryabov, Yu.G.; Bilak, S.V.; Illarionova, N.S.; Khachaturov, B.A.; Strokovsky, E.A.; Hoffman, C.M.; Kettle, P.-R.; Olin, A.; Armstrong, F.E.

    1996-09-01T23:59:59.000Z

    This report contains summaries of current and recent experiments in Particle Physics. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, Frascati, ITEP (Moscow), JINR (Dubna), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several proton decay and solar neutrino experiments. Excluded are experiments that finished taking data before 1991. Instructions are given for the World Wide Web (WWW) searching of the computer database (maintained under the SLAC-SPIRES system) that contains the summaries. This report contains full summaries of 180 approved current and recent experiments in elementary particle physics. The focus of the report is on selected experiments which directly contribute to our better understanding of elementary particles and their properties such as masses, widths or lifetimes, and branching fractions.

  8. Contoured Surface Eddy Current Inspection System

    DOE Patents [OSTI]

    Batzinger, Thomas James (Burnt Hills, NY); Fulton, James Paul (Clifton Park, NY); Rose, Curtis Wayne (Mechanicville, NY); Perocchi, Lee Cranford (Schenectady, NY)

    2003-04-08T23:59:59.000Z

    Eddy current inspection of a contoured surface of a workpiece is performed by forming a backing piece of flexible, resiliently yieldable material with a contoured exterior surface conforming in shape to the workpiece contoured surface. The backing piece is preferably cast in place so as to conform to the workpiece contoured surface. A flexible eddy current array probe is attached to the contoured exterior surface of the backing piece such that the probe faces the contoured surface of the workpiece to be inspected when the backing piece is disposed adjacent to the workpiece. The backing piece is then expanded volumetrically by inserting at least one shim into a slot in the backing piece to provide sufficient contact pressure between the probe and the workpiece contoured surface to enable the inspection of the workpiece contoured surface to be performed.

  9. Electric current generation in distorted graphene

    E-Print Network [OSTI]

    Ana Julia Mizher; Alfredo Raya; Cristian Villavicencio

    2014-09-23T23:59:59.000Z

    Graphene-like materials can be effectively described by quantum electrodynamics in 2+1 dimensions. In a pure state these systems exhibit a symmetry between the non-equivalent Dirac points in the honeycomb lattice. The effect of some types of doping or the contact with asymmetric external lattices (for instance a boron nitride layer) break this symmetry via a mechanism of effective mass generation that works differently for each Dirac point. In this work we show that the incorporation of an in-plane external magnetic field on this pseudochiral asymmetric configuration generates a non-dissipative electric current aligned with the magnetic field. This mass structure is associated to a Chern-Simons type of effective action. Together with the presence of a magnetic field generating an electric current, this scenario resembles the chiral magnetic effect in Quantum Chromodynamics.

  10. Alternating current long range alpha particle detector

    DOE Patents [OSTI]

    MacArthur, D.W.; McAtee, J.L.

    1993-02-16T23:59:59.000Z

    An alpha particle detector, utilizing alternating currents, which is capable of detecting alpha particles from distinct sources. The use of alternating currents allows use of simpler ac circuits which, in turn, are not susceptible to dc error components. It also allows the benefit of gas gain, if desired. In the invention, a voltage source creates an electric field between two conductive grids, and between the grids and a conductive enclosure. Air containing air ions created by collision with alpha particles is drawn into the enclosure and detected. In some embodiments, the air flow into the enclosure is interrupted, creating an alternating flow of ions. In another embodiment, a modulated voltage is applied to the grid, also modulating the detection of ions.

  11. Current experiments in elementary particle physics. Revision

    SciTech Connect (OSTI)

    Galic, H. [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Armstrong, F.E. [Lawrence Berkeley Lab., CA (United States); von Przewoski, B. [Indiana Univ. Cyclotron Facility, Bloomington, IN (United States)] [and others

    1994-08-01T23:59:59.000Z

    This report contains summaries of 568 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1988 are excluded. Included are experiments at BEPC (Beijing), BNL, CEBAF, CERN, CESR, DESY, FNAL, INS (Tokyo), ITEP (Moscow), IUCF (Bloomington), KEK, LAMPF, Novosibirsk, PNPI (St. Petersburg), PSI, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries.

  12. Fusion Rules for Extended Current Algebras

    E-Print Network [OSTI]

    Ernest Baver; Doron Gepner

    1996-01-30T23:59:59.000Z

    The initial classification of fusion rules have shown that rational conformal field theory is very limited. In this paper we study the fusion rules of extend ed current algebras. Explicit formulas are given for the S matrix and the fusion rules, based on the full splitting of the fixed point fields. We find that in s ome cases sensible fusion rules are obtained, while in others this procedure lea ds to fractional fusion constants.

  13. Current and lattice matched tandem solar cell

    DOE Patents [OSTI]

    Olson, Jerry M. (Lakewood, CO)

    1987-01-01T23:59:59.000Z

    A multijunction (cascade) tandem photovoltaic solar cell device is fabricated of a Ga.sub.x In.sub.1-x P (0.505.ltoreq.X.ltoreq.0.515) top cell semiconductor lattice matched to a GaAs bottom cell semiconductor at a low-resistance heterojunction, preferably a p+/n+ heterojunction between the cells. The top and bottom cells are both lattice matched and current matched for high efficiency solar radiation conversion to electrical energy.

  14. Natural Gas Regulatory Policy: Current Issues

    E-Print Network [OSTI]

    Watkins, G.

    NATURAL GAS REGULATORY roLICY: CURRENT ISSUES G. GAIL WATKINS Railroad Commission of Texas Austin, Texas ABSTRACT Many changes have occurred in recent months in both federal and state natural gas regulation. Those changes have increased... the options of industrial energy consumers for purchasing and moving natural gas. This panel viII discuss important developments in federal and state regulatory arenas and their impacts on purchasing options. Among the issues discussed viII be: 1...

  15. Current status of the liquid lithium target

    E-Print Network [OSTI]

    McDonald, Kirk

    in target (mm) 252 x 125Maximum beam current (mA) ~1~10~100Beam spot on the target (cm2) >2 (peak)0.52.5Beam Water direction #12;15 Be Trap Heat Exchanger Cross Section Design to remove ~12 kW Lithium tank #12;Oil cycle Flexible tubes Oil pump Heat exchanger Oil chamber Inside the lab Outside the lab #12;Elect

  16. Architecture for high critical current superconducting tapes

    DOE Patents [OSTI]

    Jia, Quanxi (Los Alamos, NM); Foltyn, Stephen R. (Los Alamos, NM)

    2002-01-01T23:59:59.000Z

    Improvements in critical current capacity for superconducting film structures are disclosed and include the use of, e.g., multilayer YBCO structures where individual YBCO layers are separated by a layer of an insulating material such as CeO.sub.2 and the like, a layer of a conducting material such as strontium ruthenium oxide and the like or by a second superconducting material such as SmBCO and the like.

  17. Ferrosilicon smelting in a direct current furnace

    DOE Patents [OSTI]

    Dosaj, Vishu D. (Midland, MI); May, James B. (Midland, MI)

    1992-12-29T23:59:59.000Z

    The present invention is a process for smelting ferrosilicon alloy. The process comprises adding a carbon source and tailings comprising oxides of silicon and iron to a substantially closed furnace. Heat is supplied to the furnace by striking a direct current arc between a cathode electrode and an anode functional hearth. In a preferred embodiment of the present invention, the cathode electrode is hollow and feed to the substantially closed furnace is through the hollow electrode.

  18. Ferrosilicon smelting in a direct current furnace

    DOE Patents [OSTI]

    Dosaj, V.D.; May, J.B.

    1992-12-29T23:59:59.000Z

    The present invention is a process for smelting ferrosilicon alloy. The process comprises adding a carbon source and tailings comprising oxides of silicon and iron to a substantially closed furnace. Heat is supplied to the furnace by striking a direct current arc between a cathode electrode and an anode functional hearth. In a preferred embodiment of the present invention, the cathode electrode is hollow and feed to the substantially closed furnace is through the hollow electrode. 1 figure.

  19. Current Rulemakings and Notices | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative FuelsNovember 13, 2014Contributing DataDepartment of Energy Current Fiscal

  20. Current Test Procedure Waivers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative FuelsNovember 13, 2014Contributing DataDepartment of Energy Current

  1. Near-earth Thin Current Sheets and Birkeland Currents during Substorm Growth Phase

    SciTech Connect (OSTI)

    Sorin Zaharia; C.Z. Cheng

    2003-04-30T23:59:59.000Z

    Two important phenomena observed during the magnetospheric substorm growth phase are modeled: the formation of a near-Earth (|X| {approx} 9 R{sub E}) thin cross-tail current sheet, as well as the equatorward shift of the ionospheric Birkeland currents. Our study is performed by solving the 3-D force-balance equation with realistic boundary conditions and pressure distributions. The results show a cross-tail current sheet with large current (J{sub {phi}} {approx} 10 nA/m{sup 2}) and very high plasma {beta} ({beta} {approx} 40) between 7 and 10 R{sub E}. The obtained region-1 and region-2 Birkeland currents, formed on closed field lines due to pressure gradients, move equatorward and become more intense (J{sub {parallel}max} {approx} 3 {micro}A/m{sup 2}) compared to quiet times. Both results are in agreement with substorm growth phase observations. Our results also predict that the cross-tail current sheet maps into the ionosphere in the transition region between the region-1 and region-2 currents.

  2. Indirectly sensing accelerator beam currents for limiting maximum beam current magnitude

    DOE Patents [OSTI]

    Bogaty, J.M.; Clifft, B.E.; Bollinger, L.M.

    1995-08-08T23:59:59.000Z

    A beam current limiter is disclosed for sensing and limiting the beam current in a particle accelerator, such as a cyclotron or linear accelerator, used in scientific research and medical treatment. A pair of independently operable capacitive electrodes sense the passage of charged particle bunches to develop an RF signal indicative of the beam current magnitude produced at the output of a bunched beam accelerator. The RF signal produced by each sensing electrode is converted to a variable DC voltage indicative of the beam current magnitude. The variable DC voltages thus developed are compared to each other to verify proper system function and are further compared to known references to detect beam currents in excess of pre-established limits. In the event of a system malfunction, or if the detected beam current exceeds pre-established limits, the beam current limiter automatically inhibits further accelerator operation. A high Q tank circuit associated with each sensing electrode provides a narrow system bandwidth to reduce noise and enhance dynamic range. System linearity is provided by injecting, into each sensing electrode, an RF signal that is offset from the bunching frequency by a pre-determined beat frequency to ensure that subsequent rectifying diodes operate in a linear response region. The system thus provides a large dynamic range in combination with good linearity. 6 figs.

  3. Indirectly sensing accelerator beam currents for limiting maximum beam current magnitude

    DOE Patents [OSTI]

    Bogaty, John M. (Lombard, IL); Clifft, Benny E. (Park Forest, IL); Bollinger, Lowell M. (Downers Grove, IL)

    1995-01-01T23:59:59.000Z

    A beam current limiter for sensing and limiting the beam current in a particle accelerator, such as a cyclotron or linear accelerator, used in scientific research and medical treatment. A pair of independently operable capacitive electrodes sense the passage of charged particle bunches to develop an RF signal indicative of the beam current magnitude produced at the output of a bunched beam accelerator. The RF signal produced by each sensing electrode is converted to a variable DC voltage indicative of the beam current magnitude. The variable DC voltages thus developed are compared to each other to verify proper system function and are further compared to known references to detect beam currents in excess of pre-established limits. In the event of a system malfunction, or if the detected beam current exceeds pre-established limits, the beam current limiter automatically inhibits further accelerator operation. A high Q tank circuit associated with each sensing electrode provides a narrow system bandwidth to reduce noise and enhance dynamic range. System linearity is provided by injecting, into each sensing electrode, an RF signal that is offset from the bunching frequency by a pre-determined beat frequency to ensure that subsequent rectifying diodes operate in a linear response region. The system thus provides a large dynamic range in combination with good linearity.

  4. Eddy current inspection tool. [Patent application

    DOE Patents [OSTI]

    Petrini, R.R.; Van Lue, D.F.

    1980-10-29T23:59:59.000Z

    A miniaturized inspection tool, for testing and inspection of metal objects in locations with difficult accessibility, which comprises eddy current sensing equipment with a probe coil, and associated coaxial coil cable, oil energizing means, and circuit means responsive to impedance changes in the coil as effected by induced eddy currents in a test object to produce a data output signal proportional to such changes. The coil and cable are slideably received in the utility channel of the flexible insertion tube of a fiberoptic scope. The scope is provided with light transmitting and receiving fiberoptics for viewing through the flexible tube, and articulation means for articulating the distal end of the tube and permitting close control of coil placement relative to a test object. The eddy current sensing equipment includes a tone generator for generating audible signals responsive to the data output signal. In one selected mode of operation, the tone generator responsive to the output signal above a selected level generates a constant single frequency tone for signalling detection of a discontinuity and, in a second selected mode, generates a tone whose frequency is proportional to the difference between the output signal and a predetermined selected threshold level.

  5. Variable energy constant current accelerator structure

    DOE Patents [OSTI]

    Anderson, Oscar A. (Berkeley, CA)

    1990-01-01T23:59:59.000Z

    A variable energy, constant current ion beam accelerator structure is disclosed comprising an ion source capable of providing the desired ions, a pre-accelerator for establishing an initial energy level, a matching/pumping module having means for focusing means for maintaining the beam current, and at least one main accelerator module for continuing beam focus, with means capable of variably imparting acceleration to the beam so that a constant beam output current is maintained independent of the variable output energy. In a preferred embodiment, quadrupole electrodes are provided in both the matching/pumping module and the one or more accelerator modules, and are formed using four opposing cylinder electrodes which extend parallel to the beam axis and are spaced around the beam at 90.degree. intervals with opposing electrodes maintained at the same potential. Adjacent cylinder electrodes of the quadrupole structure are maintained at different potentials to thereby reshape the cross section of the charged particle beam to an ellipse in cross section at the mid point along each quadrupole electrode unit in the accelerator modules. The beam is maintained in focus by alternating the major axis of the ellipse along the x and y axis respectively at adjacent quadrupoles. In another embodiment, electrostatic ring electrodes may be utilized instead of the quadrupole electrodes.

  6. Current Abstracts Nuclear Reactors and Technology

    SciTech Connect (OSTI)

    Bales, J.D.; Hicks, S.C. [eds.

    1993-01-01T23:59:59.000Z

    This publication Nuclear Reactors and Technology (NRT) announces on a monthly basis the current worldwide information available from the open literature on nuclear reactors and technology, including all aspects of power reactors, components and accessories, fuel elements, control systems, and materials. This publication contains the abstracts of DOE reports, journal articles, conference papers, patents, theses, and monographs added to the Energy Science and Technology Database during the past month. Also included are US information obtained through acquisition programs or interagency agreements and international information obtained through acquisition programs or interagency agreements and international information obtained through the International Energy Agency`s Energy Technology Data Exchange or government-to-government agreements. The digests in NRT and other citations to information on nuclear reactors back to 1948 are available for online searching and retrieval on the Energy Science and Technology Database and Nuclear Science Abstracts (NSA) database. Current information, added daily to the Energy Science and Technology Database, is available to DOE and its contractors through the DOE Integrated Technical Information System. Customized profiles can be developed to provide current information to meet each user`s needs.

  7. Master Thesis Proposal Eddy Current Imaging of Electrically Conducting Media

    E-Print Network [OSTI]

    Vuik, Kees

    Master Thesis Proposal Eddy Current Imaging of Electrically Conducting Media Domenico Lahaye and optimization techniques en- abling the eddy current imaging of electrically conducting media. Examples: · perform a literature study into topics such as eddy current imaging, inverse problems including

  8. Characterizing the Weather Band Variability of the Texas Coastal Current

    E-Print Network [OSTI]

    Zimmerle, Heather

    2014-07-17T23:59:59.000Z

    upcoast transport is present during the non-summer at all offshore locations. Little correlation is found between seasonal winds and along-shore current flow, meaning mesoscale features, such as Loop Current eddies, provide offshore current forcing....

  9. ULTRA-LOW-ENERGY HIGH-CURRENT ION SOURCE

    E-Print Network [OSTI]

    Anders, Andre

    2010-01-01T23:59:59.000Z

    a high current ion source for ultra-low energy ions has beenthe Department of Energy ULTRA-LOW-ENERGY HIGH-CURRENT IONedited by A. Anders. ULTRA-LOW-ENERGY HIGH-CURRENT ION

  10. Airborne coastal current survey system for difficult to access areas

    E-Print Network [OSTI]

    Pollock, Cheryl Elaine

    1994-01-01T23:59:59.000Z

    The development of an airborne current measurement system that can provide a near-synoptic view of near-bottom currents in extremely hostile wave and current environments is described. A helicopter is used as the support platform from which...

  11. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2009-05-15T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, little research has been done...

  12. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    Population. Subjects, . . . Instrumentation. . Data Collection. . . Data Analysis. IV FINDINGS AND DISCUSSION. . . . . . . . . 22 . . . . . . . 22 . . . . . . . 23 . . . . . . 26 27 . . . . . . . 29 Pilot Study Results... (Beck and Gilliard, 1995a). The National Center for Research in Vocational Education suggested female inmates need substantial support in acquiring skills to secure and maintain employment upon release from prison (Norton, Ciccone and Littlefield, 1987...

  13. Effects of obesity and metabolic syndrome on steroidogenesis and folliculogenesis in the female Ossabaw mini-pig

    E-Print Network [OSTI]

    Newell-Fugate, Annie; Taibl, Jessica; Alloosh, Mouhamad; Sturek, Michael; Bahr, Janice; Nowak, Romana; Krisher, Rebecca

    mini-pigs. Nineteen nulliparous, sexually mature female Ossabaw pigs were fed a high fat/cholesterol/fructose diet (n=10) or a control diet (n=9) for eight months. After a three-month diet-induction period, pigs remained on their respective diets...

  14. Treatment with 8-OH-DPAT attenuates the weight loss associated with activity-based anorexia in female rats

    E-Print Network [OSTI]

    Hull, Elaine

    ) plays an important role in controlling food intake and regulating body weight. In addition, clinical). This animal model allows researchers to directly manipulate neuronal and endocrine systems that may the effects of pharmacological manipulation of the 5-HT system in female rats exposed to conditions

  15. The effect of alcohol on the bone growth spurt of rats at a time equivalent to adolescent females 

    E-Print Network [OSTI]

    Chaffin, Catherine Lee

    1997-01-01T23:59:59.000Z

    The objective of this study is to determine the effect of long-term alcohol consumption on the growth spurt in adolescent rats. Female Sprague-Dawley rats were fed one of three diets (alcohol, pair-fed or chow) for 3 months. ...

  16. Computation of the current density in nonlinear materials subjected to large current pulses

    SciTech Connect (OSTI)

    Hodgdon, M.L.; Hixson, R.S.; Parsons, W.M.

    1990-01-01T23:59:59.000Z

    The finite element method and the finite difference method are used to calculate the current distribution in two nonlinear conductors. The first conductor is a small ferromagnetic wire subjected to a current pulse that rises to 10,000 Amperes in 10 microseconds. Results from the transient thermal and transient magnetic solvers of the finite element code FLUX2D are used to compute the current density in the wire. The second conductor is a metal oxide varistor. Maxwell's equations, Ohm's law and the varistor relation for the resistivity and the current density of {rho} = {alpha}j{sup {minus}{beta}} are used to derive a nonlinear differential equation. The solutions of the differential equation are obtained by a finite difference approximation and a shooting method. The behavior predicted by these calculations is in agreement with experiments. 9 refs., 6 figs.

  17. Pepco Update on Current Construction Work and Mirant Generation...

    Energy Savers [EERE]

    Update on Current Construction Work and Mirant Generation Needs for Pepco's Planned June Line Outage Pepco Update on Current Construction Work and Mirant Generation Needs for...

  18. Integration of Novel Flux Coupling Motor and Current Source Inverter...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Current Source Inverters for HEVs and FCVs Vehicle Technologies Office Merit Review 2014: Wireless Charging Integration of Novel Flux Coupling Motor and Current Source Inverter...

  19. Assessment of Energy Production Potential from Ocean Currents...

    Energy Savers [EERE]

    Ocean Currents along the United States Coastline Assessment of Energy Production Potential from Ocean Currents along the United States Coastline Report summarizing the results of...

  20. arthritis ii current: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1.2 times of rated current and transformer made cost also. Finally, several current transformers with different rated values are designed and results show that the proposed...

  1. apendicitis aguda current: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1.2 times of rated current and transformer made cost also. Finally, several current transformers with different rated values are designed and results show that the proposed...

  2. Novel Catalyst Support Materials for PEM Fuel Cells: Current...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Catalyst Support Materials for PEM Fuel Cells: Current Status and Future Prospects. Novel Catalyst Support Materials for PEM Fuel Cells: Current Status and Future Prospects....

  3. Investigations of Graphite Current Collectors and Metallic Lithium...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Graphite Current Collectors and Metallic Lithium Anodes Investigations of Graphite Current Collectors and Metallic Lithium Anodes Presentation from the U.S. DOE Office of Vehicle...

  4. Webinar: Hydrogen Fueling for Current and Anticipated Fuel Cell...

    Broader source: Energy.gov (indexed) [DOE]

    Hydrogen Fueling for Current and Anticipated Fuel Cell Electric Vehicles (FCEVs) Webinar: Hydrogen Fueling for Current and Anticipated Fuel Cell Electric Vehicles (FCEVs) Below is...

  5. Hydrogen Fueling for Current and Anticipated Fuel Cell Electric...

    Broader source: Energy.gov (indexed) [DOE]

    for Current and Anticipated Fuel Cell Electric Vehicles (FCEVs) Hydrogen Fueling for Current and Anticipated Fuel Cell Electric Vehicles (FCEVs) Download presentation slides from...

  6. PHYSICAL REVIEW B 84, 184508 (2011) Retrapping current, self-heating, and hysteretic current-voltage characteristics in ultranarrow

    E-Print Network [OSTI]

    Finkelstein, Gleb

    2011-01-01T23:59:59.000Z

    PHYSICAL REVIEW B 84, 184508 (2011) Retrapping current, self-heating, and hysteretic current that the measured retrapping current as a function of temperature can be quantitatively accounted for by the self-heating

  7. Current Filamentation Instability in Laser Wakefield Accelerators

    SciTech Connect (OSTI)

    Huntington, C. M.; Drake, R. P. [Atmospheric, Oceanic and Space Science, University of Michigan, Ann Arbor, Michigan, 48103 (United States); Thomas, A. G. R.; McGuffey, C.; Matsuoka, T.; Chvykov, V.; Kalintchenko, G.; Yanovsky, V.; Maksimchuk, A.; Krushelnick, K. [Center for Ultrafast Optical Science, University of Michigan, Ann Arbor, Michigan 48109 (United States); Kneip, S.; Najmudin, Z.; Palmer, C. [Blackett Laboratory, Imperial College London, London, SW7 2BZ (United Kingdom); Katsouleas, T. [Platt School of Engineering, Duke University, Durham, North Carolina, 27708 (United States)

    2011-03-11T23:59:59.000Z

    Experiments using an electron beam produced by laser-wakefield acceleration have shown that varying the overall beam-plasma interaction length results in current filamentation at lengths that exceed the laser depletion length in the plasma. Three-dimensional simulations show this to be a combination of hosing, beam erosion, and filamentation of the decelerated beam. This work suggests the ability to perform scaled experiments of astrophysical instabilities. Additionally, understanding the processes involved with electron beam propagation is essential to the development of wakefield accelerator applications.

  8. Current experiments in elementary particle physics. Revised

    SciTech Connect (OSTI)

    Galic, H. [Stanford Univ., CA (United States). Stanford Linear Accelerator Center; Wohl, C.G.; Armstrong, B. [Lawrence Berkeley Lab., CA (United States); Dodder, D.C. [Los Alamos National Lab., NM (United States); Klyukhin, V.I.; Ryabov, Yu.G. [Inst. for High Energy Physics, Serpukhov (Russian Federation); Illarionova, N.S. [Inst. of Theoretical and Experimental Physics, Moscow (Russian Federation); Lehar, F. [CEN Saclay, Gif-sur-Yvette (France); Oyanagi, Y. [Univ. of Tokyo (Japan). Faculty of Sciences; Olin, A. [TRIUMF, Vancouver, BC (Canada); Frosch, R. [Paul Scherrer Inst., Villigen (Switzerland)

    1992-06-01T23:59:59.000Z

    This report contains summaries of 584 current and recent experiments in elementary particle physics. Experiments that finished taking data before 1986 are excluded. Included are experiments at Brookhaven, CERN, CESR, DESY, Fermilab, Tokyo Institute of Nuclear Studies, Moscow Institute of Theoretical and Experimental Physics, KEK, LAMPF, Novosibirsk, Paul Scherrer Institut (PSI), Saclay, Serpukhov, SLAC, SSCL, and TRIUMF, and also several underground and underwater experiments. Instructions are given for remote searching of the computer database (maintained under the SLAC/SPIRES system) that contains the summaries.

  9. Current experiments in elementary particle physics

    SciTech Connect (OSTI)

    Wohl, C.G.; Armstrong, F.E.; Trippe, T.G.; Yost, G.P. (Lawrence Berkeley Lab., CA (USA)); Oyanagi, Y. (Tsukuba Univ., Ibaraki (Japan)); Dodder, D.C. (Los Alamos National Lab., NM (USA)); Ryabov, Yu.G.; Slabospitsky, S.R. (Gosudarstvennyj Komitet po Ispol'zovaniyu Atomnoj Ehnergii SSSR, Serpukhov (USSR). Inst. Fiziki Vysokikh Ehnergij); Frosch, R. (Swiss Inst. for Nuclear Research, Villigen (Switzerla

    1989-09-01T23:59:59.000Z

    This report contains summaries of 736 current and recent experiments in elementary particle physics (experiments that finished taking data before 1982 are excluded). Included are experiments at Brookhaven, CERN, CESR, DESY, Fermilab, Tokyo Institute of Nuclear Studies, Moscow Institute of Theoretical and Experimental Physics, Joint Institute for Nuclear Research (Dubna), KEK, LAMPF, Novosibirsk, PSI/SIN, Saclay, Serpukhov, SLAC, and TRIUMF, and also several underground experiments. Also given are instructions for searching online the computer database (maintained under the SLAC/SPIRES system) that contains the summaries. Properties of the fixed-target beams at most of the laboratories are summarized.

  10. Current experiments in elementary particle physics

    SciTech Connect (OSTI)

    Wohl, C.G.; Armstrong, F.E., Oyanagi, Y.; Dodder, D.C.; Ryabov, Yu.G.; Frosch, R.; Olin, A.; Lehar, F.; Moskalev, A.N.; Barkov, B.P.

    1987-03-01T23:59:59.000Z

    This report contains summaries of 720 recent and current experiments in elementary particle physics (experiments that finished taking data before 1980 are excluded). Included are experiments at Brookhaven, CERN, CESR, DESY, Fermilab, Moscow Institute of Theoretical and Experimental Physics, Tokyo Institute of Nuclear Studies, KEK, LAMPF, Leningrad Nuclear Physics Institute, Saclay, Serpukhov, SIN, SLAC, and TRIUMF, and also experiments on proton decay. Instructions are given for searching online the computer database (maintained under the SLAC/SPIRES system) that contains the summaries. Properties of the fixed-target beams at most of the laboratories are summarized.

  11. Soft-commutated direct current motor

    DOE Patents [OSTI]

    Hsu, J.S.

    1999-07-27T23:59:59.000Z

    A method and circuit is disclosed for soft-commutation of a direct current (DC) motor. An attenuation circuit is connected through auxiliary brushes A, A[prime], B and B[prime] to the commutator (16) to drain circuit from successive armature coils (15) before the main brushes (27, 28) disconnects from each of the coils (15). This prevents the spark generation that normally occurs in conventional DC motors. The attenuation circuit may also be connected before energization of the coil (15) for a soft turning on operation. 13 figs.

  12. Quantum refrigerator driven by current noise

    E-Print Network [OSTI]

    Yi-Xin Chen; Sheng-Wen Li

    2011-04-13T23:59:59.000Z

    We proposed a scheme to implement a self-contained quantum refrigerator system composed of three rf-SQUID qubits, or rather, flux-biased phase qubits. The three qubits play the roles of the target, the refrigerator and the heat engine respectively. We provide different effective temperatures for the three qubits, by imposing external current noises of different strengths. The differences of effective temperatures give rise to the flow of free energy and that drives the refrigerator system to cool down the target. We also show that the efficiency of the system approaches the Carnot efficiency.

  13. Sensing Current and Forces with SPM

    SciTech Connect (OSTI)

    Park, Jeong Y.; Maier, Sabine; Hendriksen, Bas; Salmeron, Miquel

    2010-07-02T23:59:59.000Z

    Atomic force microscopy (AFM) and scanning tunneling microscopy (STM) are well established techniques to image surfaces and to probe material properties at the atomic and molecular scale. In this review, we show hybrid combinations of AFM and STM that bring together the best of two worlds: the simultaneous detection of atomic scale forces and conduction properties. We illustrate with several examples how the detection of forces during STM and the detection of currents during AFM can give valuable additional information of the nanoscale material properties.

  14. Efficiency and Current in a correlated ratchet

    E-Print Network [OSTI]

    Bao-Quan Ai; Xian-Ju Wang; Guo-Tao Liu; De-Hua Wen; Wei Chen; Liang-Gang Liu

    2007-09-15T23:59:59.000Z

    We present a detailed study of the transport and the efficiency of a ratchet system in a periodic potential in the presence of correlated noises. The current and the efficiency of the system are investigated. It is found that, when the potential is spatially symmetric, the correlation between the two noises can induce a net transport. The efficiency shows many interesting features as a function of the applied force, the noise intensity, the external load, etc. The efficiency can be maximized as a function of noise intensity (or temperature), which shows that the thermal fluctuation can facilitate the efficiency of energy transformation.

  15. Eddy current measurement of tube element spacing

    DOE Patents [OSTI]

    Latham, Wayne Meredith (Forest, VA); Hancock, Jimmy Wade (Lynchburg, VA); Grut, Jayne Marie (Madison Heights, VA)

    1998-01-01T23:59:59.000Z

    A method of electromagnetically measuring the distance between adjacent tube elements in a heat exchanger. A cylindrical, high magnetic permeability ferrite slug is placed in the tube adjacent the spacing to be measured. A bobbin or annular coil type probe operated in the absolute mode is inserted into a second tube adjacent the spacing to be measured. From prior calibrations on the response of the eddy current coil, the signals from the coil, when sensing the presence of the ferrite slug, are used to determine the spacing between the tubes.

  16. Current Communications Needs | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T, Inc.'sEnergyTexas1.SpaceFluorControlsEnergyRev.Curiosity MarsCurrent

  17. EM Current Project Performance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny:Revised FindingDepartmentDepartmentStatementEnergy EMEMofComplex WideCurrent

  18. Current Experiment Spokespeople and Fermilab Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current Experiment

  19. Current Job Openings | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900 Employment

  20. Current Long-Term Operating Schedule

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisitingContract Management Fermi Site OfficeCoursePublic Current900