National Library of Energy BETA

Sample records for mailing services mailing

  1. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  2. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  3. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  4. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  5. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  6. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  7. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  8. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  9. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  10. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  11. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  12. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  13. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  14. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  15. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  16. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  17. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  18. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  19. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  20. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  1. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  2. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  3. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  4. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  5. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  6. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  7. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  8. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  9. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  14. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  17. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  18. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  19. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  20. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  1. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  2. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  3. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  4. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  5. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  6. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  7. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  9. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  10. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  11. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  12. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  13. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  14. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  15. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  16. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...

  17. Transfer Service (contracts/rd)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    issues regarding Transfer Service. Questions on this program can be sent to Garry Thompson at grthompson@bpa.gov or Connie Howard at cmhoward@bpa.gov. Comments can be e-mailed...

  18. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Author Guidelines User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address

  19. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected from

  20. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected from

  1. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected from

  2. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected

  3. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contacts for Users User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address

  4. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected from

  5. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected

  6. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected

  7. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected

  8. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Services Print General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Tel: 510-486-7745 (dial last four numbers from on-site phones) Location: Building 6 mezzanine, Room 6-2212 Office hours: Monday-Friday 8am - 5pm (new users should arrive before 4pm) Address: Advanced Light Source, Berkeley Lab, MS 6-2100, Berkeley, CA 94720 Group Leader User Services Sue Bailey Prospective users, Industry users This e-mail address is being protected

  9. Policy Memorandum #2 Excepted Service Hiring Policy | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Policy Memorandum 2, Excepted Service Hiring Policy.pdf Responsible Contacts Tiffany Wheeler Human Resources Specialist E-mail tiffany.wheeler@hq.doe.gov Phone (202) ...

  10. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  11. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  12. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  13. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  15. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  16. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  18. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  19. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  20. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  1. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  2. Strategic Ground Delivery Services | Department of Energy

    Energy Savers [EERE]

    Ground Delivery Services Strategic Ground Delivery Services PDF icon Use of New Strategically Source Agreement UPS.pdf.pdf More Documents & Publications Minutes from the Print and Mail Managers Exchange Forum Teleconferences Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - propertyfallnewsletter.doc

  3. U.S. Postal Service BlueEarth Program - Personal Electronics Recycling

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program | Department of Energy U.S. Postal Service BlueEarth Program - Personal Electronics Recycling Program U.S. Postal Service BlueEarth Program - Personal Electronics Recycling Program June 26, 2015 - 1:02pm Addthis Department of Energy (DOE) employees may use the U.S. Postal Service's BlueEarth program to mail-in their personally owned electronics and accessories for free recycling. Department of Energy (DOE) employees may use the U.S. Postal Service's BlueEarth program to mail-in their

  4. Excepted Service EJ and EK Desk Reference | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Excepted Service EJ and EK Desk Reference Excepted Service EJ and EK Desk Reference The Excepted Service EJ and EK Desk Reference is designed to provide the framework, in conjunction, with the DOE O 329.1 (Excepted Service Authorities for EJ and EK Pay Plans). Specifically, the desk reference addresses the requirements for the Excepted Service EJ and EK positions. PDF icon Excepted Service EJ and EK Desk Reference Responsible Contacts Antoinette Moultrie HUMAN RESOURCES SPECIALIST E-mail

  5. Alternative Fuels Data Center: Choice Environmental Services Chooses

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Natural Gas Choice Environmental Services Chooses Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Choice Environmental Services Chooses Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Choice Environmental Services Chooses Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Choice Environmental Services Chooses Natural Gas on Google Bookmark Alternative Fuels Data Center: Choice Environmental Services Chooses Natural Gas on Delicious Rank

  6. Alternative Fuels Data Center: Schwan's Home Service Delivers With

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Propane-Powered Trucks Schwan's Home Service Delivers With Propane-Powered Trucks to someone by E-mail Share Alternative Fuels Data Center: Schwan's Home Service Delivers With Propane-Powered Trucks on Facebook Tweet about Alternative Fuels Data Center: Schwan's Home Service Delivers With Propane-Powered Trucks on Twitter Bookmark Alternative Fuels Data Center: Schwan's Home Service Delivers With Propane-Powered Trucks on Google Bookmark Alternative Fuels Data Center: Schwan's Home Service

  7. Alternative Fuels Data Center: Semi Service Outfits Replica Batmobile to

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Run on Natural Gas Semi Service Outfits Replica Batmobile to Run on Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Semi Service Outfits Replica Batmobile to Run on Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Semi Service Outfits Replica Batmobile to Run on Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Semi Service Outfits Replica Batmobile to Run on Natural Gas on Google Bookmark Alternative Fuels Data Center: Semi Service

  8. Alternative Fuels Data Center: Hydraulic Hybrid Pressed into Service in

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Refuse Collection Hydraulic Hybrid Pressed into Service in Refuse Collection to someone by E-mail Share Alternative Fuels Data Center: Hydraulic Hybrid Pressed into Service in Refuse Collection on Facebook Tweet about Alternative Fuels Data Center: Hydraulic Hybrid Pressed into Service in Refuse Collection on Twitter Bookmark Alternative Fuels Data Center: Hydraulic Hybrid Pressed into Service in Refuse Collection on Google Bookmark Alternative Fuels Data Center: Hydraulic Hybrid Pressed

  9. Subscribe Today to E-mail Alerts from GTO

    Broader source: Energy.gov [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  10. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  11. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  12. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Interactions.org Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  13. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  14. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  15. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  16. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  17. Telephone Service | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Telephone Service Forward your telephone calls to an alternate number and access your voice mail from off-site. Host a Conference Call All employees can use BlueJeans to host conference calls. You can also request a conference call setup by submitting an online request to the phone operators at least 1 hour before the conference start time. Requests are processed and confirmations are sent during normal business hours. You will also need to supply an Argonne cost code. Submit a Teleconference

  18. Graphics Services Work Request | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Graphics Services Work Request Please fill in the form below. Graphic Designer Grant Luhmann will contact you to discuss your project needs in more detail. Name * Phone Number * E-mail Address * Account to Charge * Request * Needed by * Month Month Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Day Day 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 Year Year 2014 2015 2016 2017 2018 Open popup calendar File Upload Files must be less than 2 MB. Allowed file

  19. National Service Activation Checklist | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Bruce Murray HR Policy Advisor E-mail bruce.murray@hq.doe.gov Phone 202-586-3372 More Documents & Publications The Reemployment Checklist (USERRA) THE ...

  20. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  1. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  2. CERTIFIED MAIL RETURN RECEIPT REQUESTED Dr. Chi-Chang Kao Laboratory...

    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  3. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  4. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  5. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  6. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  7. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  8. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  9. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  10. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones

    2012-12-01

    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  11. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  12. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  13. Alert Services | OSTI, US Dept of Energy, Office of Scientific...

    Office of Scientific and Technical Information (OSTI)

    E-Print Network E-print Network Alerts Searchable gateway to over 5 million e-print documents and over 32,000 websites and databases worldwide. OSTIblog E-mail notifications ...

  14. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah

  15. Lisa Gerhardt NERSC User Services"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    o r eserve f or y our j ob * How l ong t o r eserve t hose n odes * OpBonal: w hat t o n ame S TDOUT fi les, w hat a ccount t o c harge, whether t o n oBfy y ou b y e mail w hen y...

  16. Services

    Broader source: Energy.gov [DOE]

    The Office of Management provides many of the services that keep the Department of Energy Headquarters offices operational. Other Program Offices also provide services to the employees at...

  17. DOE - Fossil Energy:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEWSALERT - Keep Up to date with e-mail alerts from the Office of Fossil Energy Fossil Energy NEWSALERT is a free, e-mail notification service of the U.S. Department of Energy's ...

  18. Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services Engineering Services The Network OSCARS Fasterdata IPv6 Network Network Performance Tools The ESnet Engineering Team Contact Us Technical Assistance: 1 800-33-ESnet (Inside US) 1 800-333-7638 (Inside US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network Problems: trouble@es.net Provide Web Site Feedback: info@es.net Engineering Services ESnet provides interoperable, effective, reliable, and high performance network communications infrastructure, and certain

  19. Services

    Broader source: Energy.gov [DOE]

    The Human Capital Office offers benefit, new employee orientation and some learning & development related services to all DOE employees. Additionally the Office supplies employee and labor...

  20. Services

    Broader source: Energy.gov [DOE]

    The ultimate objective of DOE's Project Management System is to deliver capital asset projects within the original performance baseline, on schedule, within budget, and fully capable of meeting mission requirements. The Resource Center consolidates and provides access to key tools and services for accomplishing this objective. The target audience is DOE’s Federal and Contractor Project Management community.

  1. Internal Revenue Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5-9651 06/01/2006 541990 ROSALIND TORRENCE 003 01/01/2014 LOS ALAMOS NATIONAL SECURITY, LLC LANS DEFINED BENEFIT PENSION PLAN 20-3104541 PO BOX 1663 MAIL STOP P280 LOS ALAMOS, NM 87545 10/09/2015 Filed with authorized/valid electronic signature. X Form 5500 (2014) Page 2 3a Plan administrator's name and address XSame as Plan Sponsor ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI c/o ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI 123456789 ABCDEFGHI

  2. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Address: country Phone Number: Fax Number: E-mail: 20111110100931 Evan J. Kaufman Robbins Geller Rudman &38; Dowd LLP 58 South Service Road, Suite 200 Melville, NY 11747...

  3. Fermilab Today - Troubleshooting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Today Fermilab Today is distributed via e-mail each morning by the same program. Internet service providers are aggressively filtering spam due to the proliferation of spam...

  4. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)

    2009-12-21

    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Silverstein, Eva (1) Smith, Kendrick M., E-mail: siavoshrezvan@gmail.com, E-mail: ... Mirbabayi, Mehrdad ; Senatore, Leonardo ; Smith, Kendrick M., E-mail: ...

  6. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Enhancement in magnetic properties of magnesium substituted bismuth ferrite nanoparticles Xu, Jianlong ; Xie, Dan, E-mail: xiedan@mail.tsinghua.edu.cn, E-mail: ...

  7. Netlib services and resources

    SciTech Connect (OSTI)

    Browne, S.V.; Green, S.C.; Moore, K.; Wade, R.C.; Dongarra, J.J. |; Rowan, T.H.

    1994-04-01

    The Netlib repository, maintained by the University of Tennessee and Oak Ridge National Laboratory, contains freely available software, documents, and databases of interest to the numerical, scientific computing, and other communities. This report includes both the Netlib User`s Guide and the Netlib System Manager`s Guide, and contains information about Netlib`s databases, interfaces, and system implementation. The Netlib repository`s databases include the Performance Database, the Conferences Database, and the NA-NET mail forwarding and Whitepages Databases. A variety of user interfaces enable users to access the Netlib repository in the manner most convenient and compatible with their networking capabilities. These interfaces include the Netlib email interface, the Xnetlib X Windows client, the netlibget command-line TCP/IP client, anonymous FTP, anonymous RCP, and gopher.

  8. Hyekyung Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hyekyung Kim Hyekyung Kim Postdoctoral Appointee E-mail clarisse

  9. Osman Eryilmaz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Osman Eryilmaz Principal Materials Scientist E-mail eryilmaz

  10. Balendra Sutharshan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Balendra Sutharshan Chief Operations Officer - EGS E-mail bsutharshan

  11. Ryne T. Willig | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryne T. Willig Safety Associate - EGS E-mail rwillig

  12. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ... macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ...

  13. DOE HQ F 1410.2 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 DOE HQ F 1410.2 Form used to confirm receipt of controlled mail parcel service items. PDF icon RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE More Documents & Publications DOE HQ F 1410.8 DOE F 1324.5 DOE HQ F 1410.4

  14. Better Buildings Neighborhood Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... * Contest held * Neighborhood meetings * Contest had participants * Social media * Direct mail * Social media applications * Direct mail resulted in applications * Telethon ...

  15. Desmond Toa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Desmond Toa Desmond Toa Desmond Toa Graduate Student E-mail: desmond.toa@mail.utoronto.ca Website: Princeton University

  16. Letter Temple

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 06/04/15 Note: Form must be filled out completely and signed prior to submittal to the following address: Nuclear Waste Partnership LLC PO Box 2078 GSA-207 Carlsbad, NM 88221 FAX: (575) 234-7050 Company Name: Address: Phone: City: State: Zip(+4): e-Mail: REMITTANCE ADDRESS (if different) Address: City: State: Zip(+4): e-Mail: Other: Address: City: State: Zip(+4): Country Code: COMPANY CONTACTS Manager Name: Sales Name: Phone: Cell: Phone: Cell: e-Mail e-Mail Service Name: Accounts Payable

  17. seca-core-tech-sofc-seal-meeting | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Conference Services Information Conference Services National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail: kimberly.yavorsky@netl.doe.gov...

  18. seca-model-simul-team-integration-mtg | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Conference Services Information Conference Services National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail: kimberly.yavorsky@netl.doe.gov...

  19. Undergraduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Undergraduate Students Undergraduate Students Ingrid Archibald Undergraduate Student E-mail: ingridarchibald@wustl.edu Divya Babbula Undergraduate Student E-mail: divya.babbula@wustl.edu Stephanie Botkin E-mail: stephanie.botkin@wustl.edu Kyle Cepeda Undergraduate Student E-mail: kcepeda@wustl.edu Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Ryan Farhat-Sabet Undergraduate Student E-mail: r.farhat-sabet@wustl.edu Caroline Focht Undergraduate Student E-mail:

  20. Service Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Service Characteristics by Activity... Service Service buildings are those in which some type of service is provided, other than food service or retail sales of goods. Basic...

  1. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  2. Kenneth Venuto | Department of Energy

    Energy Savers [EERE]

    Kenneth Venuto Kenneth Venuto Room 4F-084 E-mail kenneth.venuto@hq.doe.gov Description Human Capital Management programs, policies, services Last Name Venuto First Name Kenneth Title Director, Office of Human Capital Management

  3. afe | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Presentation NETL Conference Services Information National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail: kimberly.yavorsky@netl.doe.gov Disclaimer...

  4. Energy Citations Database (ECD) - Availability

    Office of Scientific and Technical Information (OSTI)

    vente des publications des Communautes Europeenes 37, rue Glesener-Luxembourg. FD U.S. Fish and Wildlife Service, 18th and C Streets, N.W., Mail Stop 1111, Arlington Square Bldg.,...

  5. North Carolina Geological Survey | Open Energy Information

    Open Energy Info (EERE)

    Address: 1612 Mail Service Center Place: North Carolina Zip: 27699-1612 Website: www.geology.enr.state.nc.us Coordinates: 35.67, -78.66 Show Map Loading map......

  6. Link Alpha M

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    S T U V W Y Z Macintosh User Group (LBNL-MUG) Mail Services (Facilities Dep't.) MalwareVirus Protection and Prevention Mammary: Human Mammary Epithelial Cell (HMEC) Map: Berkeley...

  7. Yunjie Liu

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yunjie Liu Yunjie Liu Yunjie Liu Computer System Engineer (Climate Data Analyst) Data & Analytics Services yunjieliu@lbl.gov 1 Cyclotron Road Mail Stop 59-4010A Berkeley, CA 94720 ...

  8. Business Alert Notification System | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Business Alert Notification System FedBizOpps, FedConnect, and Grants.gov provide e-mail notification services to interested parties who want to receive information about the...

  9. Evaluation of the exothermicity of the chemi-ionization reaction...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cox, Richard M ; Kim, JungSoo ; Armentrout, P. B., E-mail: armentrout@chem.utah.edu, E-mail: mheaven@emory.edu, E-mail: albert.viggiano@us.af.mil 1 ; Bartlett, Joshua ; ...

  10. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to pf-lepd@osti.gov. Need to change OPMO contact (i.e., e-mail, name, telephone ...

  11. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)

    None

    2012-12-31

    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  12. EERE Publication and Product Library

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Requests You have not requested any products. You can request that products and publications be mailed to you by clicking on the "Request by Mail" link in the publication...

  13. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* Non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 Non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Contact Information General Inquiries New

  14. Persons Who Received the DC PSC's Emergency Petition and Complaint via

    Energy Savers [EERE]

    E-mail on August 24, 2005 | Department of Energy Persons Who Received the DC PSC's Emergency Petition and Complaint via E-mail on August 24, 2005 Persons Who Received the DC PSC's Emergency Petition and Complaint via E-mail on August 24, 2005 Docket No. EO-05-01: In response to your August 29, 2005 letter, attached please find a list of all entities and organizations to whom we served the District of Columbia Public Service Commission's (HOC PSC") Petition and Complaint filed on August

  15. Register for Fossil Energy NewsAlerts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Register for Fossil Energy NewsAlerts Register for Fossil Energy NewsAlerts newsalert.jpg Fossil Energy NewsAlerts is a free, e-mail notification service of the U.S. Department of Energy's Office of Fossil Energy. Each time we update our web site in your area of interest, we will send you a brief e-mail alerting you to the new posting and providing you with a link to additional information. Subscribe to our mailing list * indicates required Email Address * First Name Last Name Send me

  16. My Account | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    My Account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  17. User account | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User account User account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  18. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  19. Bryan Fry | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bryan Fry Bryan Fry Bryan Fry Graduate Student E-mail: bryanfry@mail.med.upenn.edu Website: University of Pennsylvania Graduate...

  20. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Anzai, Jun, E-mail: anzaijun@kaken.co.jp Pharmacology Department, Central Research ... Asano, Taiji, E-mail: asanotaiji@kaken.co.jp Pharmacology Department, Central Research ...

  1. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  2. Research and Technical Associates | Photosynthetic Antenna Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    placeholder image Amy LaFountain Research Affiliate Technical Assocaite E-mail: amy.lafountain@uconn.edu Graham Leggett Graham Leggett Professor E-mail:...

  3. PNNL - News Center - Subscribe to PNNL Press Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News and Information Notification Service If you wish to receive an electronic "reminder" each time new information becomes available online, please fill out the form below. New Subscriber Information E-Mail address: Verify E-Mail: First Name: Last Name: Organization: Subscribe to Topics: Awards and Honors Computational Science EMSL Energy Environment Fundamental Science National Security Operations Technology Transfer and Commercialization Submit

  4. Service Levels

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Service Levels Service Levels NERSC Supported Services Model NERSC supports various services at various levels of support. This document outlines the different levels of support that can be expected for a given service. Production Services All production services at NERSC have the following characteristics: Monitored by NERSC Operations with automated tools (Nagios). Outages are announced on the MOTD and must follow the rules defined in System Outages document. User facing documentation

  5. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services shutterstock_106609430_jpg.jpg

  6. Eric Rask | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rask Eric Rask Principal Research Engineer E-mail erask@anl.gov

  7. Eugene Stewart | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technician Sr. Eugene Stewart Telephone 630.252.4466 E-mail estewart

  8. Jared Ross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jared Ross Jared Ross Jared Ross Undergraduate Student E-mail: jbross

  9. Hussein S. Khalil | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hussein S. Khalil Nuclear Energy and Security Program Leader - EGS E-mail hkhalil

  10. Todd E. Combs | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd E. Combs Interim Associate Laboratory Director - EGS E-mail tcombs

  11. Peter Fuesz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Associate Peter Fuesz Telephone 630.252.7151 E-mail fuesz

  12. William Brocker | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    William Brocker ESH/QA Coordinator - EGS E-mail wbrocker

  13. Youngjin Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Youngjin Kim Postdoctoral Appointee E-mail kimy@anl.gov Projects Distribution Automation

  14. Nicholaos Demas | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Nick Demas Nicholaos Demas Assistant Materials Scientist E-mail ndemas@anl.gov

  15. Edward J. Daniels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward J. Daniels Sr. Energy Systems Scientist Telephone (630) 252-5279 E-mail edaniels

  16. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  17. Ron Tollner | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ron Tollner Manager, Building & Systems Operations Telephone 630.252.4457 E-mail tollner

  18. Nathan Soulier | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nathan Soulier Nathan Soulier Nathan Soulier Graduate Student E-mail: nts116

  19. Susan R. Podoba | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Susan R. Podoba Executive Secretary to the Associate Laboratory Director - EGS E-mail spodoba

  20. A. Scott Dunlop | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Scott Dunlop National Security Facility Director - EGS E-mail adunlop

  1. Renee M. Nault | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Renee M. Nault Senior Manager, Business Development - EGS E-mail rmnault

  2. Mary A. McIntyre | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. McIntyre Business Strategist - EGS E-mail mmcintyre

  3. Mary Ellen Hennebry | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ellen Hennebry Assistant to the Associate Laboratory Director - EGS E-mail mehennebry

  4. Scott Goldsborough | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Goldsborough Principal Mechanical Engineer E-mail sgoldsborough@anl.gov Projects Fuel Kinetics

  5. Sharon Nykolyshyn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sharon Nykolyshyn Executive Secretary - EGS Telephone 630-252-3739 E-mail snykolyshyn

  6. David Eckstein | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eckstein Principal Application Developer Telephone 630.252.7918 E-mail deckstein@anl.gov

  7. Denise M. Voss | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Denise M. Voss Executive Secretary to the Chief Operations Officer - EGS E-mail dvoss

  8. Aaron Greco | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Greco Principal Materials Scientist E-mail agreco@anl.gov Website Argonne Experts

  9. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Martinson Telephone (630) 252-7520 E-mail martinson

  10. User Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Home Contact User Services Print The User Services Group is available to aid ALS users before they arrive, while they are here, and after they leave. User Office Experiment...

  11. Graduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    People / Graduate Students Graduate Students Sam Barnett Graduate Student E-mail: sbarnett1@sheffield.ac.uk Hui-Yuan Chen Graduate Student E-mail: chen.hui-yuan@wustl.edu Kaitlyn Faries Kaitlyn Faries Graduate Student E-mail: kaitlyn.faries@wustl.edu Phone: 314.935.6566 Kirsty Hacking Graduate Student E-mail: k.hacking.1@research.gla.ac.uk Ming-Yang Ho Graduate Student E-mail: mxh504@psu.edu Don Hood Graduate Student E-mail: dhood@wustl.edu Xia Huang Graduate Student E-mail:

  12. March 2016 APM newsletter | Department of Energy

    Energy Savers [EERE]

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  13. Scientific Advisory Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Advisory Committee Scientific Advisory Committee Gary Brudvig Scientific Advisory Committee Member E-mail: gary.brudvig@yale.edu J. Clark Lagarias Scientific Advisory Committee Member E-mail: jclagarias@ucdavis.edu Thomas Moore Thomas Moore Scientific Advisory Committee Chair E-mail: tom.moore@asu.edu Phone: 480.965.3308 Jennifer Ogilvie Scientific Advisory Committee Member E-mail: jogilvie@umich.edu Marion Thurnauer Marion Thurnauer Scientific Advisory Committee Member E-mail:

  14. LACED Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services LACED Services The expertise, capabilities, and facilities at Los Alamos enable use to provide a full suite of services that caters to countering explosive threats. v At LACED, we believe that technological knowhow is best leveraged through top-tier industrial partners, federal agencies, and academic institutions. LACED offers a variety of partnering mechanisms that enable access to federally developed technologies and R&D capabilities. If you have a complex problem related to

  15. Service Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Service Forms Beamtime Request Form Deposition Request Form Exposure Request Form - pdf Fly Cutting Request Form Hot Embossing Request Form Metrology Request Form

  16. Cognos Reporting & Self Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reporting & Self Service

  17. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technical Information Alert Services Get weekly e-mail notification of new information about your specific area(s) of interest. Simply register for the service on one or all of the OSTI products described below and then sign up for topic(s) which will be matched automatically against each new weekly update. E-Print Network E-print Network Alerts Searchable gateway to over 5 million e-print documents and over 32,000 websites and databases worldwide. OSTIblog E-mail notifications OSTIblog

  18. Transmission Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Transmission Services BPA Clarifications on the DSO216 1 Document updated on 2242015 at 3:29:25 PM B O N N E V I L L E P O W E R A D M I N I S T R A T I O N BPA Clarifications on...

  19. Service Center

    Energy Savers [EERE]

    ASSIGNMENTS Pamela Arias-Ortega - Administrative and judicial litigation; and personnel law and workforce discipline mailto:parias-ortega@doeal.gov Celina Baca - Research and special projects for litigation and general law group mailto:cbaca@doeal.gov Dick Blakely - Designated Agency Ethics Advisor - Administrative litigation and mediation services; and ethics mailto:rblakely@doeal.gov Jonathan Buckner - Administrative review hearings; and administrative hearings before EEOC and MSPB

  20. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services The Office of Congressional and Intergovernmental Affairs offers a broad range of services to a variety of constituencies and stakeholder groups. Dedicated to ...

  1. Microsoft Word - NGP EIS scoping Comment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environ me ntal Imp act Statemen t for the Acquisition of a Natural Gas Pipeline and Natural Gas Utility Service at the Hanford Site U.S. Department of Energy Written Comment Form Must be received on or before February 22, 2012. Please use other side if more space is needed. Comment forms may be mailed to: Comment forms may be sent by electronic mail to: Mr. Douglas Chapin naturalgaseis@rl.gov NEPA Document Manager U.S. DOE/Richland Operations Office Box 550, MSIN A5-11 Richland, WA 99352

  2. Energy education resources: Kindergarten through 12th grade

    SciTech Connect (OSTI)

    1998-09-01

    Energy Education Resources: Kindergarten Through 12th Grade is published by the National Energy Information Center (NEIC) a service of the Energy Information Administration (EIA), to provide students, educators, and other information users, a list of generally available free or low-cost energy-related educational materials. Each entry includes the address, telephone number, and description of the organization and the energy-related materials available. Most of the entries also include Internet (Web) and electronic mail (E-Mail) addresses. Each entry is followed by a number, which is referenced in the subject index in the back of this book.

  3. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... E-mail comments must be sent to emilyslistrepeal@fec.gov. If e- mail comments include an attachment, the attachment must be in either Adobe Acrobat (.pdf) or Microsoft Word (.doc) ...

  4. How is a Document Containing OUO Marked? | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with "Document(s) transmitted contain(s) OUO information". (DOE M 471.3-1, Admin Chg 1, Chapter I, 3f.) Marking e-mail: If the e-mail contains OUO information, the first line of ...

  5. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: michele.altieri@go.doe.gov Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...

  6. Magnetohydrodynamics and deep mixing in evolved stars. I. Two...

    Office of Scientific and Technical Information (OSTI)

    Authors: Nucci, M. C. 1 ; Busso, M., E-mail: mariaclara.nucci@unipg.it, E-mail: busso@fisica.unipg.it 2 + Show Author Affiliations Department of Mathematics and Informatics, ...

  7. Contacts | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    information to contact the State and Local Solution Center by mail or email: U.S. Department of Energy State and Local Solution Center Mail Stop EE-5W 1000 Independence Ave., SW...

  8. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  9. Research Affiliates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engel Gregory Engel Research Affiliate E-mail: gsengel@uchicago.edu Phone: 773.834.0818 Harry Frank Harry Frank Research Affiliate E-mail: harry.frank@uconn.edu Phone: 860.486.2844...

  10. Microsoft Word - Document3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...nancy@mail.house.gov; americanvoices@mail.house.gov; comments@whitehouse.gov; ... THE DESTRUCTION OF MUCH OF THE GULF OF MEXICO. DOE IS SCUM BUSHCHENEY COUNTRY AND HAS ...

  11. People | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Associate Professor, Schulich Faculty of Chemistry Research Affiliate E-mail: nadir@tx.technion.ac.il Phone: 972.4.829.2141 Dan Allen Dan Allen Multimedia Specialist E-mail: ...

  12. Operations Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manager, Research Administration and Operations E-mail: kmosley@wustl.edu Phone: 314-935-3168 Dan Allen Dan Allen Multimedia Specialist E-mail: danallen@wustl.edu Phone: ...

  13. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Fornasini, Maria L., E-mail: cfmet@chimica.unige.i (1) Fornasini, Maria Luisa (1) Manfrinetti, Pietro (1) Manfrinetti, Pietro, E-mail: chimfis@chimica.unige.i (1) ...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Manfrinetti, P. (2) Fornasini, Maria L., E-mail: cfmet@chimica.unige.i ... Perrone 24, 16152 Genova ; Fornasini, Maria L., E-mail: cfmet@chimica.unige.i Phases ...

  15. Hopping conduction in p-type MoS{sub 2} near the critical regime...

    Office of Scientific and Technical Information (OSTI)

    ; Park, Joonsuk 4 ; Lin, Der-Yuh 5 ; Huang, Ying-Sheng 6 ; Choi, Heon-Jin 7 ; Chang, Joonyeon, E-mail: cujang@kist.re.kr, E-mail: presto@kist.re.kr 1 ; Department of ...

  16. Novel short antibacterial and antifungal peptides with low cytotoxicit...

    Office of Scientific and Technical Information (OSTI)

    Ning Chen, Wei ; Ming Li, Chang ; Xu, Rong 1 ; Lamrani, Mouad 3 ; Mu, Yuguang, E-mail: ygmu@ntu.edu.sg 2 ; Leong, Susanna Su Jan 1 ; Wook Chang, Matthew, E-mail: ...

  17. ALS Beamlines Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0.05-1.2 eV This e-mail address is being protected from spambots. You need JavaScript enabled to view it (510) 495-2231 This e-mail address is being protected from...

  18. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read more... Contact: This e-mail address is being protected from spambots. You need JavaScript enabled to view it and This e-mail address is being protected from spambots. You...

  19. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Proposals: This e-mail address is being protected from spambots....

  20. Postdoctoral Associates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alastair Gardiner Research Associate E-mail: alastair.gardiner@glasgow.ac.uk Phil Jackson Phil Jackson Postdoctoral Research Associate E-mail: p.j.jackson@sheffield.ac.uk...

  1. Dr.James J.Spivey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doctoral Researcher Dr. Nitin Kumar E-mail: nkumar2@tigers.lsu.edu Ph.D, 2011, Louisiana State University, Baton Rouge Current Graduate Students Khietlethanh Mai E-mail:...

  2. Subscribe to Energy-Efficient Product Procurement Updates

    Broader source: Energy.gov [DOE]

    FEMP offers e-mail updates covering energy-efficient product procurement requirements, guidance, and assistance. Enter your e-mail address below to begin the registration process. After you...

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... E-mail: jabbari@theory.ipm.ac.ir, E-mail: shiu@physics.wisc.edu The inflationary cosmology paradigm is very successful in explaining the CMB anisotropy to the percent level. ...

  4. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... HISTORY OF THE INTERGALACTIC MEDIUM Cen Renyue ; Chisari, Nora Elisa, E-mail: cen@astro.princeton.edu, E-mail: nchisari@astro.princeton.edu Using the state-of-the-art ...

  5. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: alexander.melkozernov@asu.edu Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  6. BPA-2011-01724-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the following: * An e-mail dated April 5, 2011 from Scott Bettin, BPA biologist, to Philip Key, BPA attorney. This e-mail is referred to in footnote 219 on page 77 of the...

  7. TITLE AUTHORS SUBJECT SUBJECT RELATED DESCRIPTION PUBLISHER AVAILABILI...

    Office of Scientific and Technical Information (OSTI)

    solar neighborhood XXXV Distances to M dwarf systems within PC in the southern sky Winters Jennifer G Jao Wei Chun Dieterich Sergio B E mail winters astro gsu edu E mail jao astro...

  8. BPA-2014-00787-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - D-1 Subject: FW: FOIA COE SL-003 BPA JOURNAL MAILING List Kalispell MOA 3-28-2014 Hi Christy and Kim, Pursuant to the FOIA, I request a copy of: 1) The BPA Journal Mailing...

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Chen, Shyan-Shiou, E-mail: sschen@ntnu.edu.tw Department of Mathematics, National Taiwan Normal University, Taipei 11677, Taiwan (China) (2) Chen, Yi-Chiuan, E-mail: YCChen@math....

  10. CONTRACT EMPLOYEES

    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  11. Acknowledgements of Federal Support | U.S. DOE Office of Science...

    Office of Science (SC) Website

    Peer Reviewed Articles and Technical Papers News Releases, Public-Facing Web, Mailing, and ... Back to Top Back to Top News Releases, Public-Facing Web, Mailing, and Social Media For ...

  12. s-processing in AGB stars revisited. I. Does the main component...

    Office of Scientific and Technical Information (OSTI)

    Authors: Trippella, O. ; Busso, M. 1 ; Maiorca, E. 2 ; Kppeler, F. 3 ; Palmerini, S., E-mail: oscar.trippella@fisica.unipg.it, E-mail: maurizio.busso@fisica.unipg.it 4 + ...

  13. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and e-mails to EIA analysts. In fact, last year an e-mail was circulating around the Internet telling which oil companies imported the most crude oil from Persian Gulf countries...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Flanagan, anna ., E-mail: sb933@cornell.edu, E-mail: eef3@cornell.edu (1) Save Results Save this search to My Library Excel (limit 2000) CSV (limit 5000) XML (limit 5000) Have ...

  15. Microsoft Word - 4500lnc.dot

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unless changed by holiday. Mail to: Dept. 3651, MS 0165 Fax to: 844-0645 Email: In your Word document, click on FileSend ToMailRecipientclassads@sandia.gov and click on "send."...

  16. GCPCC home

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prospective users can contact us via e-mail at hbellamyatlsudotedu or call Henry Bellamy at (225) 578- 9342. We continue to offer mail-in crystallography to both...

  17. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Lomaev, Mikhail I. (3) Shao, Tao, E-mail: st@mail.iee.ac.cn (3) Tarasenko, Victor F. (3) ... bimolecular recombination in polymer solar cells Venkatesan, Swaminathan ; Chen, ...

  18. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... All Solution-Processed Lead Halide Perovskite-BiVO 4 Tandem Assembly for Photolytic Solar ... ; Wei, Candong, E-mail: weicando@ipbcams.ac.cn ; Jin, Qi, E-mail: zdsys@vip.sina.com ...

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Mawr, Pennsylvania 19010-2899 ; Mallory, Frank B. ; Rheingold, Arnold L. ; Rotkina, Lolita ; Wang, Xianlong, E-mail: pbeckman@brynmawr.edu, E-mail: wangxianlong@uestc.edu.cn We ...

  20. Power Services (pbl/about)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Power Services > About Power Services Power Services Home Page Other Related Web Sites Power Services Organization Power Services Financial Information Tribal Affairs Office...

  1. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts

  2. C:\Forms\HQ F 1410.8.cdr

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Notification of Incoming Mail Receipt for Incoming Personal Mail Sender Name: Date Processed: Processed by: (Signature and Date of Person Picking up Mail) Employee Name: Routing Symbol: Room Number: Date Received: HQ F 1410.8 (8-84) HQ F 1410.8 (8-84) Date Contacted: MESSAGE To Sender: Mail must be picked up by: or item will be returned to sender. Part 1 Part 2

  3. Link Alpha G

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (EESA) Geophysics Department (EESA) GERT - General Employee Radiological Training (English) Gift Acceptance Information Glenn T. Seaborg Center Gmail (Google Mail)...

  4. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  5. Jag Kottapalli | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jag Kottapalli Jag Kottapalli Jag Kottapalli Undergraduate Student E-mail: jkottapalli@wustl.edu Website: Washington University Undergraduate Students

  6. Ning Kang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ning Kang Eng Systems Modeling-Simulation-Analysis 2 E-mail nkang@anl.gov Projects Distribution Automation

  7. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  8. Cvetelin Vasilev | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Postdoctoral Associate E-mail: c.vasilev@sheffield.ac.uk...

  9. Matthew Cuneo | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cuneo Matthew Cuneo Matthew Cuneo Instrument Scientist E-mail: cuneomj@ornl.gov Website: Oak Ridge National Lab...

  10. Jeremy King | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeremy King Jeremy King Jeremy King Graduate Student E-mail: jdking@wustl.edu Website: Washington University Graduate

  11. Joshua Auld | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Auld Joshua Auld Principal Computational Transportation Engineer E-mail jauld@anl.gov Website Profile

  12. Joshua Mancini | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Mancini Joshua Mancini Joshua Mancini Graduate Student E-mail: joshuamancini07@gmail.com Website: University of Pennsylvania

  13. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  14. Kent Bostick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Kent Bostick Kent Bostick Deputy Director of National and Global Security Programs - EGS E-mail kbostick

  15. Khem Acharya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Khem Acharya Khem Acharya Khem Acharya Alumnus E-mail: khem@k-state.edu Website: Kansas State University

  16. H. Larry Collins | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    H. Larry Collins Director, Intelligence Analysis Division E-mail lcollins@anl.gov Projects Counterintelligence National Security Facility...

  17. Nestor J. Zaluzec | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nestor J. Zaluzec Senior Materials Scientist Telephone 630.252.4798 E-mail zaluzec@aaem.amc

  18. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  19. Christine Meyer | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meyer Christine Meyer Christine Meyer Undergraduate Student E-mail: christinemeyer@wustl.edu Website: Washington University Undergraduate Students

  20. Daniel Oblinsky | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Oblinsky Daniel Oblinsky Daniel Oblinsky Graduate Student E-mail: doblinsky@gmail.com Website: Princeton University Graduate Students...

  1. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  2. Ravindra Singh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ravindra Singh Eng Systems Modeling-Simulation-Analysis 3 E-mail ravindra.singh@anl.gov Projects Distribution Automation

  3. Stuart Feinberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ES&H/QA Coordinator Stuart Feinberg Telephone 630.252.4673 E-mail sfeinberg@anl.gov

  4. Scott Massow | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Massow Assistant Facility Manager Telephone 630.252.4620 E-mail smassow@anl.gov

  5. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  6. Daniel Weisz | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Weisz Daniel Weisz Daniel Weisz Graduate Student E-mail: daweisz@wustl.edu Website: Washington University in St. Louis

  7. Webmaster

    Broader source: Energy.gov [DOE]

    The Bioenergy Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email.

  8. Gaozhong Shen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gaozhong Shen Gaozhong Shen Gaozhong Shen Senior Research Associate E-mail: gxs22@psu.edu Website: Pennsylvania State

  9. Guy Mayneord | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guy Mayneord Guy Mayneord Guy Mayneord Graduate Student E-mail: gemayneord@sheffield.ac.uk Website: University of Sheffield

  10. Vijaya Subramanian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vijaya Subramanian Vijaya Subramanian placeholder image Vijaya Subramanian Postdoctoral Associate E-mail: vijaya65@hotmail.com Postdoctoral Associates

  11. Audit Report: IG-0463 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    software, including electronic mail, word processing, spreadsheet, database management, application development, statistical analysis, presentation, security and virus protection. ...

  12. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: Energy.gov [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  13. Microsoft Word - Current Contact Information2.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information: Name: Date: Z Number: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Mailing Address: Street or PO Box Apt...

  14. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  15. Amgad Elgowainy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amgad Elgowainy Team Leader/Principal Energy Systems Analyst E-mail aelgowainy@anl.gov Projects Models and Tools

  16. Amit Mandal | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amit Mandal Amit Mandal Amit Mandal Postdoctoral Research Associate E-mail: mandala@wustl.edu Website: Washington University Postdoctoral

  17. Andrew Ells | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ells Andrew Ells Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Website: Washington University

  18. Andrew Novick | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Novick Andrew Novick Andrew Novick Undergraduate Student E-mail: novick@wustl.edu Website: Washington University in St. Louis

  19. Anthony Avarca | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anthony Avarca Systems Administrator Sr. Telephone 630.252.4940 E-mail aavarca@anl.gov

  20. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail: zhien@agnes.gsfc.nasa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Study: Environmental Benefits of LEDs Greater Than CFLs Study: Environmental Benefits of LEDs Greater Than CFLs December 9, 2013 - 4:13pm Addthis A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic

  1. DOE HQ F 1410.8 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DOE HQ F 1410.8 Form used to notify mail recipients that they have mail to be picked up. PDF icon Notification of Incoming Mail More Documents & Publications DOE HQ F 1410.2 Headquarters Facilities Master Security Plan - Chapter 5, Classified Matter Protection and Control DOE F 1500.4

  2. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Che, Guang-Bo, E-mail: guangboche@jlnu.edu.cn (1) Chern, I-Liang, E-mail: chern@math.ntu.e... Sciences ; Chern, I-Liang, E-mail: chern@math.ntu.edu.tw ; Department of Mathematics, ...

  3. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues

  4. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Postdoctoral Program Lead Kristene (Tina) Henne Phone: 630.252.2907 E-mail: khenne@anl.gov Administrative Support Kathy Eggers Phone: 630.252.6034 E-mail: eggers@anl.gov Mailing Address Argonne National Laboratory Postdoctoral Program Office Building 201, Room 151 9700 South Cass Avenue Argonne, Illinois 60439 U.S.A.

  5. ORISE: Health physics services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Health physics services Nuclear power plant The Oak Ridge Institute for Science and Education (ORISE) offers comprehensive health physics services in a number of technical areas ...

  6. Service-Poke

    Energy Science and Technology Software Center (OSTI)

    2012-02-10

    Service-Poke is a system which manages running services ensuring only one copy is running and potentially up to one more copy is marked for future execution.

  7. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services The Office of Indian Energy coordinates and manages the government-to-government and intertribal collaboration involved in carrying out all DOE tribal ...

  8. Air Charter Services

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    301-10.143) promulgated by the General Services Administration (GSA) which implements ... that allow federal funded transportation services for travel and cargo movements to use ...

  9. Dual Career Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Options Dual Career Services Dual Career Services Los Alamos Lab recruits the best minds on the planet and offers job search information and assistance to our dual career...

  10. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services The Oak Ridge Office of Environmental Management has numerous and diverse responsibilities. Our ultimate mission is to remove environmental contamination to ...

  11. POLICY MEMORANDUM #1 Policy and Operating Procedures for Senior Executive

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Service (SES) Performance Management System | Department of Energy MEMORANDUM #1 Policy and Operating Procedures for Senior Executive Service (SES) Performance Management System POLICY MEMORANDUM #1 Policy and Operating Procedures for Senior Executive Service (SES) Performance Management System PDF icon Policy Memo #1-SES Performance Policy and Operating Procedures Responsible Contacts Erin Moore Deputy Director, Office of Executive Resources E-mail Erin.Moore@hq.doe.gov Phone (202) 586-9558

  12. Document Delivery

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services » Document Delivery Document Delivery The Research Library can order journal articles, conference papers and book chapters not found in the Library collection for LANL staff. The service is provided by our vendor, Reprints Desk, who will mail the article to you as a PDF. Easily retrieved articles may be delivered the same day, while harder-to-find material can take several days/weeks. This service is limited to LANL employees with active Z numbers. Requesting Materials Use the Request

  13. Katie Antypas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Katie Antypas Katie Antypas setheight-Antypas.jpg Katie Antypas Scientific Computing and Data Services Department Head KAntypas@lbl.gov Phone: (510) 486-5575 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch As the department head of Scientific Computing and Data Services at the National Energy Research Scientific Computing (NERSC) Center, Katie has oversight of the Data Science Engagement, Data and Analytics Services, Storage Systems, and

  14. LANSCE Training Office Process Improvement Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Training Office Process Improvement Form You recently contacted our training service department. We want to assure that you're satisfied with our service. Please complete this short survey. Your feedback will be used to improve our service. How did you contact the TA-53 Training office for training? In Person Telephone E-Mail Response Time What was the reason for your request? Badge reader access Proctoring Training Report/Status Other______________ The Training Office handled my request

  15. Business Services | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Business Services Jefferson Lab spends approximately $73 million annually through procurements to a diverse group of large and small businesses for a broad range of products and services that support the lab's overall mission. Managing the lab's vendor process is the Procurement & Services Department. The department is dedicated to the highest standards of service, conduct and continuous improvement. To learn more about business opportunities with the lab, contact Procurement & Services.

  16. MOX Services Unclassified Information System PIA, National Nuclear Services

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administration | Department of Energy MOX Services Unclassified Information System PIA, National Nuclear Services Administration MOX Services Unclassified Information System PIA, National Nuclear Services Administration MOX Services Unclassified Information System PIA, National Nuclear Services Administration PDF icon MOX Services Unclassified Information System PIA, National Nuclear Services Administration More Documents & Publications TRAIN-PIA.pdf Occupational Medicine - Assistant

  17. Alumni | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alumni Alumni Khem Acharya Alumnus E-mail: khem@k-state.edu Peter Adams Alumnus Christine Ajinjeru Alumna Srinivasa Rao Allu Alumnus Woo-Jin An Woo-Jin An Alumnus E-mail: woojinan@wustl.edu Stephen Anthony Alumnus David Armstrong Alumnus Khuram Ashraf Khuram Ashraf Alumnus Angela Barragan Alumnus Hannah Behar Alumna Sasha Berger Alumna E-mail: sashaberger@wustl.edu David Bina David Bina Alumnus E-mail: david.bina@seznam.cz Pratim Biswas Pratim Biswas Alumnus E-mail: pratim.biswas@wustl.edu

  18. 6/17/10 11:48 AM

    Office of Environmental Management (EM)

    8 AM mail 2552×3320 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.3&disp=inline&realattid=f_gajudmr22&zw 6/17/10 11:50 AM mail 2552×3340 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.5&disp=inline&realattid=f_gajue1sa4&zw 6/17/10 11:50 AM mail 2548×3348 pixels Page 1 of 1

  19. NERSC FTP Upload Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NERSC FTP Upload Service The NERSC FTP Upload service is designed for external collaborators to be able to send data to NERSC staff and users. It allows you to create a...

  20. Food Service Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    was a food service building were only asked whether the building was a restaurant, bar, fast food chain, or cafeteria (all the same category) or some other type of food service...

  1. 503 Service Temporarily Unavailable

    Broader source: All U.S. Department of Energy (DOE) Office Webpages

    Service Temporarily Unavailable The server is temporarily unable to service your request due to maintenance downtime or capacity problems. Please try again later. Web Server at cen-efrc.org

  2. National Service Activation Checklist

    Energy Savers [EERE]

    Service Activation Checklist You have just received information that you are being activated for national service. Covered or Not Covered If you have received notice to report for active duty - Army, Navy, Marines, Air Force, National Guard, Public Health Service, or Coast Guard and you are a Federal employee, you have employment and reemployment rights under the Uniformed Services Employment and Reemployment Act of 1994 (USERRA). Basics - Telling People What is Happening 1. Have you told your

  3. Analytical Services - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contracting Wastren Advantage, Inc. Analytical Services Contracting ORP Contracts and Procurements RL Contracts and Procurements CH2M HILL Plateau Remediation Company Mission Support Alliance Washington Closure Hanford HPM Corporation (HPMC) Wastren Advantage, Inc. Analytical Services HASQARD Focus Group Bechtel National, Inc. Washington River Protection Solutions Analytical Services Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Analytical laboratory analyses

  4. Simple Lookup Service

    Energy Science and Technology Software Center (OSTI)

    2013-05-01

    Simple Lookup Service (sLS) is a REST/JSON based lookup service that allows users to publish information in the form of key-value pairs and search for the published information. The lookup service supports both pull and push model. This software can be used to create a distributed architecture/cloud.

  5. Product Service Codes @ Headquarters Description: Product Services...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... FABRICATED MATERIALS 21,300.00 1 T001 ARTSGRAPHICS SERVICES 20,700.00 1 AG11 R&D- ... T016 PHOTOMAPPRINTPUB LICATION- AUDIOVISUAL 15,444.60 2 6150 MISC ELECTRIC POWER & ...

  6. Service and Repair Work

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Service and Repair Work Whenever on-site service or repair work needs to be done, a Procurement Work Sheet (PWS) must be completed, and possibly an IWS, authorized and released. PWS is required for service work even if there are no apparent hazards. PWS is required for work in Jupiter Laser Facility even if you have a PWS for service/repairs in another location. To complete a PWS for service work in Jupiter Laser Facility, please contact Sean Holte (2-3905, pager #05312). Notify Brent Stuart and

  7. Printing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Printing The Printing Team is the liaison between the U.S. Government Printing Office and the Department of Energy. It consists of an expert group of printing specialists who offer a full range of services from assistance in developing your printing requirements to the final printing, distribution and mailing of products. The printed products range from black and white to full color items. These Services are available through the Working Capital Fund. The Printing Office produces a

  8. DOE HQ F 1420.7 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    20.7 DOE HQ F 1420.7 Form used to track graphics work requests by asking for information regarding materials furnished, services requested, details of graphics and/or photography, printing and/or copying, and distribution and/or mailing. PDF icon Print Requisition More Documents & Publications Customer Services Handbook, 2010, Office of Administration DOE F 1340.3A DOE F 1340.3

  9. Prabhat

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prabhat Prabhat prabhat.jpg Prabhat Group Leader Data & Analytics Services Prabhat@lbl.gov Phone: (510) 486-7752 1 Cyclotron Road Mail Stop 50F1650 Berkeley, CA 94720 US Biographical Sketch Prabhat leads the Data and Analytics Services team at NERSC. His current research interests include scientific data management, parallel I/O, high performance computing and scientific visualization. He is also interested in applied statistics, machine learning, computer graphics and computer vision.

  10. Marine Services | Open Energy Information

    Open Energy Info (EERE)

    Marine Services Place: Florida Sector: Services Product: Marine Services is planning tidal energy projects off the coasts of California and Florida. References: Marine...

  11. Dabbrook Services | Open Energy Information

    Open Energy Info (EERE)

    Services Jump to: navigation, search Name: Dabbrook Services Place: Great Yarmouth, United Kingdom Zip: NR31 6PT Sector: Services Product: Provides design and engineering...

  12. BNL Technical Services Awarded Service-Disabled Veteran-Owned...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BNL Technical Services Awarded Service-Disabled Veteran-Owned Small Business of the Year BNL Technical Services Awarded Service-Disabled Veteran-Owned Small Business of the Year ...

  13. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services Image courtesy of Dennis Schroeder, NREL 24505 Image courtesy of Dennis Schroeder, NREL 24505 The Office of Energy Efficiency and Renewable Energy (EERE) leads DOE efforts to build a strong, clean energy economy, a strategy that is aimed at reducing our reliance on foreign oil, saving families and businesses money, creating middle-class jobs, and reducing pollution. EERE offers the following resources and services: Key Topics: Energy Basics States and Local Communities Jobs,

  14. Web Service Interface (API)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Service Interface (API) Engineering Services The Network OSCARS How It Works Who's Using OSCARS? OSCARS and Future Tech OSCARS Standard and Open Grid Forum OSCARS Developers Community Web Browser Interface (WBUI) Web Service Interface (API) Read More... Fasterdata IPv6 Network Network Performance Tools The ESnet Engineering Team Contact Us Technical Assistance: 1 800-33-ESnet (Inside US) 1 800-333-7638 (Inside US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network Problems:

  15. Customer Service Plan

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Customer Service Plan Department of Energy Customer Service Plan - 2011 1 A Message from the Secretary Over the past two and a half years, the Obama Administration and the Department of Energy have worked to make the federal government more open for the American public and its own employees. Through these efforts, we have significantly expanded the amount and breadth of information available online about our programs and services. We have also transformed the way we communicate with the public

  16. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services SERVICES OF THE OFFICE OF THE GENERAL COUNSEL The Office of the General Counsel is responsible for providing legal advice, counsel, and support to the Secretary, Deputy Secretary, and all Departmental elements, except the National Nuclear Security Administration and the Federal Energy Regulatory Commission. This Office assures that the Department operates in compliance with all pertinent laws and regulations. The Immediate Office of the General Counsel directs, manages, and

  17. Procurable Products, Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    printed wiring boards (PWB) using performance and design specifications. Commercial products and services procurement The following items are purchased through Just-In-Time...

  18. Grid Software and Services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    management, file transfer and distributed computing workflows through the Globus Toolkit. Web based Science Gateways can be built on the foundation provided by those services....

  19. BPA Power Services (PBL)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executives Hydro Power 2010 Modified Streamflows BPA Fuel Mix Site Map Other Related Web Sites: BPA Energy Efficiency (EE) BPA Transmission Services BPA Environment, Fish, &...

  20. General Service LED Lamps

    Broader source: Energy.gov [DOE]

    A U.S. DOE SSL technology fact sheet that compares general service LED light bulbs with incandescent and CFL bulbs.

  1. Energy Service Companies

    Broader source: Energy.gov [DOE]

    Energy service companies (ESCOs) develop, design, build, and fund projects that save energy, reduce energy costs, decrease operations and maintenance costs at their customers' facilities.

  2. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services The Office of International Affairs supports the Secretary of Energy and other Departmental elements with a range of expertise on international energy activities. Among ...

  3. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services The Energy Saver Guide: Tips on Saving Energy and Money at Home is one service offered by Energy Saver. The guide is offered in English and Spanish and is available for ordering, download, and as an e-book. The Energy Saver Guide: Tips on Saving Energy and Money at Home is one service offered by Energy Saver. The guide is offered in English and Spanish and is available for ordering, download, and as an e-book. Energy Saver provides consumers and homeowners with information on

  4. Service | Open Energy Information

    Open Energy Info (EERE)

    Building Types 1 References EIA CBECS Building Types U.S. Energy Information Administration (Oct 2008) Retrieved from "http:en.openei.orgwindex.php?titleService&oldid27...

  5. Web Service Interface (API)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    How It Works Who's Using OSCARS? OSCARS and Future Tech OSCARS Standard and Open Grid Forum OSCARS Developers Community Web Browser Interface (WBUI) Web Service Interface (API) ...

  6. Internal Revenue Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ode X SCHEDULE A (Form 5500) Department of the Treasury Internal Revenue Service Department of Labor Employee Benefits Security Administration Pension Benefit...

  7. General Service LED Lamps

    SciTech Connect (OSTI)

    2012-04-01

    Solid-state lighting program technology fact sheet that compares general service incandescent lamps—i.e., light bulbs—to LED and CFL alternatives.

  8. Products, Services: Not Procurable

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Furrier Physicians Amusements Gaming Produce ArtArtists Gift Shops Public Relations Art Galleries Glass Company Recreation Arts & Crafts GrocersGroceries Relocation Services...

  9. An investigation of DUA caching strategies for public key certificates

    SciTech Connect (OSTI)

    Cheung, T.C.

    1993-11-01

    Internet Privacy Enhanced Mail (PEM) provides security services to users of Internet electronic mail. PEM is designed with the intention that it will eventually obtain public key certificates from the X.500 directory service. However, such a capability is not present in most PEM implementations today. While the prevalent PEM implementation uses a public key certificate-based strategy, certificates are mostly distributed via e-mail exchanges, which raises several security and performance issues. In this thesis research, we changed the reference PEM implementation to make use of the X.500 directory service instead of local databases for public key certificate management. The thesis discusses some problems with using the X.500 directory service, explores the relevant issues, and develops an approach to address them. The approach makes use of a memory cache to store public key certificates. We implemented a centralized cache server and addressed the denial-of-service security problem that is present in the server. In designing the cache, we investigated several cache management strategies. One result of our study is that the use of a cache significantly improves performance. Our research also indicates that security incurs extra performance cost. Different cache replacement algorithms do not seem to yield significant performance differences, while delaying dirty-writes to the backing store does improve performance over immediate writes.

  10. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services The Office of Hearings and Appeals (OHA) is the quasi-judicial arm of the DOE that provides a variety of key services to DOE and the public. OHA has five core functions: 1.) Freedom of Information Act (FOIA) Appeals. The FOIA is one of the principal ways that members of the public can learn about what is happening inside their government. Individuals file more than 2,000 FOIA requests with the DOE each year. When a DOE office denies a FOIA request in whole or in part, the FOIA

  11. Utility Service Renovations

    Broader source: Energy.gov [DOE]

    Any upgrade to utility service provides an opportunity to revisit a Federal building's electrical loads and costs, but it also may provide an economic way to bundle the upgrade with an onsite renewable electricity project during renovation. Upgrading utility service to the site may involve improving or adding a transformer, upgrading utility meters, or otherwise modifying the interconnection equipment or services with the utility. In some cases, the upgrade may change the tariff structure for the facility and may qualify the property for a different structure with lower overall costs. In all cases, the implementation of renewable energy technologies should be identified during the design phase.

  12. Web Feature Service Validator

    Energy Science and Technology Software Center (OSTI)

    2013-08-01

    This site allows state data contributors to validate their WFS services against a specified schema for tier 3 data. The application uses the USGIN models API at https://github.com/usgin/usginmodels.

  13. Web service performance script

    Energy Science and Technology Software Center (OSTI)

    2009-08-01

    This python script, available from ESRI and modified here, checks a server at specified intervals to ensure that web services remain up and running. If any are found to be off, they are automatically turned back on.

  14. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services Secretary Ernest Moniz takes a holistic view to diversity, recognizing that the goal of ensuring equal access to participation in the Department's programs and policies comes through in our workforce, our partners, our research, our policies, our education efforts, and our work with the general public. We invite you to browse our website to learn more about the ways we'd like to work with you to support the mission of the Energy Department. Minority Business and Economic

  15. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services Office of Inspector General Hotline: The Office of Inspector General (OIG) maintains a Hotline to facilitate the reporting of allegations of fraud, waste, abuse, or mismanagement in U.S. Department of Energy (DOE) programs or operations. If you wish to report such allegations, you may call, send a letter, or email the OIG Hotline as identified at the right. Allegations may be reported by DOE employees, DOE contractors, or the general public. The OIG Hotline can intake

  16. In-Office Services:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office Services: Meet with an experienced attorney who can advise and represent you. Attorney Services include: * Reviewing and preparing documents * Making follow-up calls and writing letters * Providing legal advice and consultation * Representation in court Comprehensive Coverage protects you from costly legal fees. Most covered legal matters are 100% paid-in-full when you work with a Network Attorney. (See reverse side of flyer for details.) Reduced Fee Benefits are available for matters not

  17. ORISE: Health physics services

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Health physics services Nuclear power plant The Oak Ridge Institute for Science and Education (ORISE) offers comprehensive health physics services in a number of technical areas for the U.S. Department of Energy (DOE) and U.S. Nuclear Regulatory Commission (NRC), as well as other federal and state agencies. From radiological facility audits and reviews to dose modeling and technical evaluations, ORISE is nationally-recognized for its health physics support to decontamination and decommissioning

  18. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services Expert Evaluations of Management Performance in DOE Health, Safety and Security The U.S. Department of Energy's (DOE) Office of Enterprise Assessments (EA) provides expert evaluations of management performance in safety, security and other areas by seasoned experts who are independent of line management and will ensure that training reflects the most current Departmental policy on safety and security issues. EA serves as an important check-and-balance that meets the

  19. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services Waste Management Waste Management EM is dedicated to safely disposing of waste and seeks cost effective and environmentally responsible project execution methods. Read more Site & Facility Restoration Site & Facility Restoration EM provides integration, planning and analysis for all soil and groundwater remediation, deactivation and decommissioning (D&D) and facility engineering. This work includes sustainability projects to ensure that these activities are

  20. Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Services CD-0 Approval of Mission Need CD-1 Approval of Alternative CD-4 Approval of Project Completion CD-3 Approval to Start Construction CD-2 Approval of Performance Baseline Financial Closeout Complete CD-0 CD-1 CD-4 CD-3 CD-2 INITIATION DEFINITION EXECUTION CLOSEOUT Resource Center The ultimate objective of DOE's Project Management System is to deliver capital asset projects within the original performance baseline, on schedule, within budget, and fully capable of meeting mission

  1. Service Academies Research Associates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Internships » SARA » SARA /collaboration/internships/service-academy-research-associates/_assets/images/banner-img.png Service Academies Research Associates (SARA) The academies come to Los Alamos for a summer of science. Contact Jonathan S. Ventura Email application Program 2015-2016 Application Your Name Date of Birth Home Address Phone Email Address at the Academy Academy Approver's Name Academy Approver's Phone Academy Approver's Email GPA (requires minimum 3.0) Academy Major Foreign

  2. Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services Initiatives Services Initiatives The Transportation Team Uses Alternative Fueled Vehicles in HQ Fleet 81% of HQ Fleet is alternative fueled (FY 2014). HQ utilizes biodiesel (B20) fueled shuttle buses, a domestic renewable fuel derived from natural oils like soybean oil. Recycled Paper for Copiers and Printers DOE Headquarters purchases a combination of 30% and 100% post-consumer recycled content paper for use in its staffed copy centers, walk-up copiers, and dedicated office printers

  3. Test Circuit Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Test Circuit Service Network R&D Software-Defined Networking (SDN) Experimental Network Testbeds 100G SDN Testbed Dark Fiber Testbed Test Circuit Service Testbed Results Current Testbed Research Previous Testbed Research Performance (perfSONAR) Software & Tools Development Data for Researchers Partnerships Publications Workshops Contact Us Technical Assistance: 1 800-33-ESnet (Inside US) 1 800-333-7638 (Inside US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network

  4. Mr. Robert C, Smith Federal Acquisition Service General Services...

    Energy Savers [EERE]

    Robert C, Smith Federal Acquisition Service General Services Administration 2200 Crystal Drive, Suite 300 Arlington, VA 20406 Dear Mr. Smith: The Department of Energy (DOE) will ...

  5. United States Forest Service - Forest Service Environmental Appeals...

    Open Energy Info (EERE)

    Responses Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: United States Forest Service - Forest Service Environmental Appeals Responses Abstract...

  6. United States Forest Service - Forest Service Schedule of Proposed...

    Open Energy Info (EERE)

    Actions Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: United States Forest Service - Forest Service Schedule of Proposed Actions Abstract The...

  7. Eastern Power Customer Services Manager

    Broader source: Energy.gov [DOE]

    This position is located in the Eastern Power Services organization (PSE) of Northwest Requirements Marketing, Power Services, and Bonneville Power Administration (BPA). Northwest (NW) Requirements...

  8. Western Power Customer Services Manager

    Broader source: Energy.gov [DOE]

    This position is located in the Western Power Services organization (PSW) of Northwest Requirements Marketing, Power Services, and Bonneville Power Administration (BPA). Northwest (NW) Requirements...

  9. Scotoil Services | Open Energy Information

    Open Energy Info (EERE)

    Services Product: Division of the Scotoil Group that delivers the group's suite of environmental services. Coordinates: 46.975867, -123.81598 Show Map Loading map......

  10. PPPO Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PPPO Services PPPO Services PPPO provides oversight to ensure safe and compliant cleanup. PPPO provides oversight to ensure safe and compliant cleanup. Read more PPPO develops ...

  11. Policies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Job Logs & Statistics Application Performance Training & Tutorials Software Policies Acknowledge NERSC Allocation Eligibility Allocation Management Computer Security Computer Use Data Management Passwords Queue Scheduling Usage Charges System Outages Service Levels User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support

  12. Contact Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Us » Contact Us Contact Us To contact us by mail: Office of the Chief Human Capital Officer U.S. Department of Energy, Room 4E-084 1000 Independence Ave, SW Washington, DC 20585 By Phone: 202-586-1234 HC Points of Contact HR Contacts by Sub Agency Servicing Area HC Contacts by Functional Area Human Resource Directors (HRD) Secretarial Offices and Management & Performance Science and Energy

  13. Time-Off Awards Scale | Department of Energy

    Energy Savers [EERE]

    Time-Off Awards Scale Time-Off Awards Scale This chart is the departmental recommended time-off award scale and should be used unless another time-off award scale has been adopted by the servicing human resources office. PDF icon Time-Off Awards Scale Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail lorrenda.buckner@hq.doe.gov Phone 202-586-8451 More Documents & Publications Supervisory - Non-Supervisory Employee Performance Management and

  14. Microsoft Word - S06970_2010PC

    Office of Legacy Management (LM)

    and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada October 2010 Approved for public release; further dissemination unlimited LMS/CNT/S06970 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically

  15. Microsoft Word - S07053_PCMP

    Office of Legacy Management (LM)

    Monitoring and Inspection Plan for Amchitka Island Mud Pit Release Sites, Well Abandonment, and Infantry Road Repair Amchitka, Alaska March 2011 Approved for public release; further dissemination unlimited LMS/AMC/S07053 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx

  16. NREL Scientist Selected for Major Award by the American Chemical Society

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientist Selected for Major Award by the American Chemical Society For more information contact: e:mail: Public Affairs Golden, Colo., Aug. 26, 1999 — A research fellow at the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) will receive a major award for his extensive contributions to the advancement of surface chemistry. The 160,000-member American Chemical Society selected Dr. Alvin Czanderna for the Arthur W. Adamson Award for Distinguished Service in the Advancement

  17. NREL: Energy Analysis - Energy Analysis Newsletter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Decision Insight and Market Impacts Newsletter Unsubscribe Please enter your email address to unsubscribe from the Decision Insight and Market Impacts Newsletter. Complete E-mail Address: Unsubscribe If you have any questions about this online subscription service, please contact us. Printable Version Energy Analysis Home Capabilities & Expertise Key Activities Models & Tools Data & Resources Publications Partnerships Staff Working with Us Related Links News Did you find what you

  18. FAQ

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supported Systems FAQ Performance and Optimization Genepool Completed Jobs Genepool Training and Tutorials Websites, databases and cluster services Testbeds Retired Systems Storage & File Systems Data & Analytics Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours

  19. Genepool

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    File storage and I/O Data Management Supported Systems FAQ Performance and Optimization Genepool Completed Jobs Genepool Training and Tutorials Websites, databases and cluster services Testbeds Retired Systems Storage & File Systems Data & Analytics Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List

  20. 1

    Office of Legacy Management (LM)

    Natural Gas, Produced Water, and Hydrologic Sampling and Analysis Results for 2014 December 2014 Approved for public release; further dissemination unlimited LMS/GSB/S12349 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  1. 1

    Office of Legacy Management (LM)

    Monitoring Report Project Shoal Area Subsurface Corrective Action Unit 447 February 2014 Approved for public release; further dissemination unlimited LMS/SHL/S11217 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at http://www.osti.gov/scitech/

  2. 2014 Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada

    Office of Legacy Management (LM)

    Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada November 2015 Approved for public release; further dissemination unlimited LMS/SHL/S12297 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  3. 2015 Groundwater Monitoring Report Project Shoal Area Subsurface Corrective Action Unit 447

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Project Shoal Area: Subsurface Corrective Action Unit 447 April 2016 Approved for public release; further dissemination unlimited LMS/SHL/S13448 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  4. ORNL/LTR-2015/199 OAK RIDGE NATIONAL LABORATORY

    Office of Environmental Management (EM)

    OCC Pamphlet OCC Pamphlet Office of Chief Counsel Assignments and Points of Contact Pamphlet PDF icon OCC Pamphlet More Documents & Publications NNSA Service Center Chart Field Facilities Contacts for Printing and Mail 1998 Annual Facility Representative Workshop Attendees

    Chief of Staff Matt Nolan Chief Technology Officer/ Enterprise Architect VACANT Senior Advisor, Cyber Jen Silk Senior Advisor, Strategic Engagement & Communications Kathy Crouch Office of the Chief Information

  5. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  6. Joaquin Correa

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joaquin Correa Joaquin Correa Joaquin-Correa.jpg Joaquin Correa Computer Systems Engineer Data & Analytics Services JoaquinCorrea@lbl.gov Phone: (510) 463-4572 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 Biographical Sketch Joaquin Correa is a Solutions Architect, High Performance Computing Engineer and Pythonista in the Data Science Engagement team at NERSC. Currently, he is responsible for the development and integration of HPC solutions for Advanced Light Source (ALS), Linac

  7. All Software List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Compilers Programming Models Version Control Tools Programming Libraries Performance and Debugging Tools Grid Software and Services NERSC Software Downloads Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov

  8. Ankit Bhagatwala

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ankit Bhagatwala Ankit Bhagatwala 134c83d2 Ankit Bhagatwala , Ph.D. HPC Consultant Application Performance Specialist User Services abhagatwala@lbl.gov Phone: 510-486-4385 1 Cyclotron Rd Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Prior to joining NERSC, Ankit was a postdoc at Sandia National Laboratories working on large scale direct numerical simulations of turbulent combustion. He received his Ph.D. in Aeronautics and Astronautics from Stanford University where he developed a

  9. Annette Greiner

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Annette Greiner Annette Greiner Annette-Greiner-2 Annette M. Greiner Web Application Developer Data & Analytics Services AMGreiner@lbl.gov Phone: (510) 495-2935 Fax: (510) 486-4316 Web: http://annettegreiner.com/ 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Annette Greiner is a user interface designer and web developer with particular interest in interaction design and visualization. She earned a Master's in Information Management and Systems from UC Berkeley's

  10. Microsoft Word - FOI 2014-01694.final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2014 CERTIFIED MAIL Mr. Jake St. Arnold Visionary Integration Professionals 1421 Prince Street #210 Alexandria, Virginia 22314 Dear Mr. St. Arnold: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01694) This letter is in response to your electronic Freedom of Information Act (FOIA) request requesting the competitor's bids and evaluation materials in response to Request for Quote No. DE-SOL-0006812, for the Mission Oriented Business Integrated Services. Regarding your request for a copy of the

  11. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada December 2009 Approved for public release; further dissemination unlimited LMS/CNT/S05827 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  12. Microsoft Word - S07896_GW_MR

    Office of Legacy Management (LM)

    11 Groundwater Monitoring Report, Central Nevada Test Area, Subsurface Corrective Action Unit 443 April 2012 Approved for public release; further dissemination unlimited LMS/CNT/S07896 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  13. Microsoft Word - S10873_WCR.docx

    Office of Legacy Management (LM)

    3 Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada June 2014 Approved for public release; further dissemination unlimited LMS/CNT/S10873 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  14. Division Student Liaisons

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Student Liaisons 2015 OFFICE Division Student Liaison Work # Email MailStop DIRECTOR'S OFFICE Principal Associate Directors PADSTE, PADWP, PADGS, PADOPS, PADCAP Associate Directors ADCLES, ADE, ADEPS, ADTSC --- PADSTE ADPSM, ADW, ADX --- PADWP ADTIR ---PADGS ADBI, ADESH, ADNHHO, ADSS --- PADOPS ADEP, ADPM --- PADCAP Audits & Ethics (EA-DO) Tonie V. Baros 665-3104 barost@lanl.gov A249 Chief Prime Contracts (PCM-DO) None Comm. & Public. Affairs (CGA-DO) CPA-CAS: Comm. Arts & Services

  15. Configuration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supported Systems FAQ Performance and Optimization Genepool Completed Jobs Genepool Training and Tutorials Websites, databases and cluster services Testbeds Retired Systems Storage & File Systems Data & Analytics Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours

  16. Apr2003z

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April the Y-12 Care Package Project brought in more than $8,000 that will be used to purchase much-needed items for our troops. The Pentagon has sanctioned some creative ways to support our troops without unnecessarily adding to the mail congestion. Two major efforts that the military has encouraged are Operation Uplink and Operation United Service Organizations Care Package. Operation Uplink is a unique program that keeps military per- sonnel and hospitalized veterans in touch with their

  17. Technical Services Agreement

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TSA-AGMT.DOC (9/06/01) 04/14/13 Technical Services Agreement No. TSA- The National Renewable Energy Laboratory (hereinafter "NREL") Operating under Prime Contract No. DE-AC36-08GO28308 for the Department of Energy And <Sponsor>` (hereinafter "Sponsor") I. Parties to the Technical Services Agreement. The Alliance for Sustainable Energy, LLC as Management and Operating (M&O) Contractor for the National Renewable Energy Laboratory ("Contractor"), under U.S.

  18. Temporary Food Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Food Service The SLAC Café, auditorium and visitor center have been closed and will be replaced with a new Science and User Support Building (SUSB). During this construction (2013-2015), temporary food service will be provided by the Cardinal Chef Mobile Gourmet food trucks. On-Site The food trucks are located in front of Building 27. Hours of Operation Monday through Friday Breakfast: 7:30AM-9:30AM Lunch: 11:00AM-2:00PM Menu: http://www-project.slac.stanford.edu/foodtruckmenu/default.asp Local

  19. Office of Headquarters Procurement Services - Employee Customer Service

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Standards | Department of Energy Office of Headquarters Procurement Services - Employee Customer Service Standards Office of Headquarters Procurement Services - Employee Customer Service Standards CUSTOMER FOCUS The Office of Headquarters Procurement Services (MA-64) serves a variety of customers in the performance of its acquisition and financial assistance mission. Primary among its many customers is each of the Department of Energy Headquarters program offices. MA-64 continually seeks to

  20. Mr. Robert C, Smith Federal Acquisition Service General Services Administration

    Energy Savers [EERE]

    8,2010 Mr. Robert C, Smith Federal Acquisition Service General Services Administration 2200 Crystal Drive, Suite 300 Arlington, VA 20406 Dear Mr. Smith: The Department of Energy (DOE) will participate as an authorized user of the second generation General Services Administration (GSA) Blanket Purchase Agreement (BPA) Number GS-33F-BQV08 for Express and Ground Domestic Delivery Services (0052) in the continental United States, Alaska, Hawaii, and Puerto Rico. All existing United Parcel Service

  1. Power Services Site Map (pbl/help)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    | Contact Power Services | Help About Power Services Power Services Home Page Power Services Short Cuts Other Related Web Sites BPA Energy Efficiency Volunteer Energy...

  2. VT Nuclear Services ltd | Open Energy Information

    Open Energy Info (EERE)

    VT Nuclear Services ltd Jump to: navigation, search Name: VT Nuclear Services ltd Place: Warrington, United Kingdom Zip: WA4 4BP Sector: Services Product: VT Nuclear Services...

  3. Alternative Energy Services | Open Energy Information

    Open Energy Info (EERE)

    Services Jump to: navigation, search Logo: Alternative Energy Services Name: Alternative Energy Services Place: Florida Product: renewable energy products and services Phone...

  4. Service Contract Inventory

    Broader source: Energy.gov [DOE]

    The Department of Energy (DOE) approach will be performed in accordance with the criteria set out in Consolidated Appropriations Act, 2010, (Pub. L. No. 111-117, § 743 (2009)), Appendix D of the November 5, 2010 OMB Memorandum on Service Contract Inventories, OMB Memorandum dated November 25, 2014, and will ultimately identify contracts for a more in-depth review.

  5. Analytical Services Management System

    Energy Science and Technology Software Center (OSTI)

    2005-03-30

    Analytical Services Management System (ASMS) provides sample management services. Sample management includes sample planning for analytical requests, sample tracking for shipping and receiving by the laboratory, receipt of the analytical data deliverable, processing the deliverable and payment of the laboratory conducting the analyses. ASMS is a web based application that provides the ability to manage these activities at multiple locations for different customers. ASMS provides for the assignment of single to multiple samples for standardmore » chemical and radiochemical analyses. ASMS is a flexible system which allows the users to request analyses by line item code. Line item codes are selected based on the Basic Ordering Agreement (BOA) format for contracting with participating laboratories. ASMS also allows contracting with non-BOA laboratories using a similar line item code contracting format for their services. ASMS allows sample and analysis tracking from sample planning and collection in the field through sample shipment, laboratory sample receipt, laboratory analysis and submittal of the requested analyses, electronic data transfer, and payment of the laboratories for the completed analyses. The software when in operation contains business sensitive material that is used as a principal portion of the Kaiser Analytical Management Services business model. The software version provided is the most recent version, however the copy of the application does not contain business sensitive data from the associated Oracle tables such as contract information or price per line item code.« less

  6. MATRIX AND VECTOR SERVICES

    Energy Science and Technology Software Center (OSTI)

    2001-10-18

    PETRA V2 provides matrix and vector services and the ability construct, query, and use matrix and vector objects that are used and computed by TRILINOS solvers. It provides all basic matr5ix and vector operations for solvers in TRILINOS.

  7. Solar Newsletters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletters Solar Newsletters The SunShot Initiative offers e-newsletters to provide up-to-date information about our latest activities and upcoming funding opportunities. The SunShot newsletter provides weekly e-mail updates on solar office activities, events, funding opportunities, and publications. The SunShot concentrating solar power newsletter provides quarterly e-mail updates specific to the CSP industry. Update your subscriptions, modify your password or e-mail address, or stop

  8. Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contacts Contacts U.S. Department of Energy SunShot Initiative Phone: 202-287-1862 Email: solar@ee.doe.gov Mailing Address: 1000 Independence Avenue, SW Washington, DC, 20585 Additional information about visiting our offices. EPA Green Power Partnership Phone: 202-343-9859 Email: James Critchfield, GPP Program Manager critchfield.james@epa.gov Mailing address: U.S. Environmental Protection Agency 1200 Pennsylvania Ave., NW Mail Code 6202J Washington, DC 20460

  9. Health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  10. ESnet LHCONE Service for Universities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LHCONE Service for Universities Version January 28 2015 Date Edited By Change 13-Jan-2015 J Metzger Created 15-Jan-2015 J Metzger Minor updates 16-Jan-2015 P Giuntoli, J Metzger Improved Clarity & Focus, added Appendix 2. 22-Jan-2015 Dorn Readability improvements; consistency of terms (especially ESnet LHCONE Service and global LHCONE VRF network) 28-Jan-2015 J Metzger Entered Experiment Site Coordinator Names. Overview Service Description Service Design Demarcation Point Service Policies

  11. Experimental tests of paleoclassical transport

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Livermore National Laboratory, Livermore, CA 94551-0808, USA 11 Georgia Tech, Atlanta, GA 30332, USA 12 Johns Hopkins University, Baltimore, MD 21218, USA E-mail: ...

  12. Marianne Mintz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Marianne Mintz Marianne Mintz Team Leader - Energy Systems Analysis E-mail mmintz@anl.gov Projects Economic and Infrastructure Analysis Transportation Systems and Market Assessment...

  13. Search...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Agencies can also send job announcements via mass e- mails to students with disabilities ... or no usable vision, beyond light perception) 23- Inability to read ordinary size ...

  14. Henning Lohse-Busch | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Henning Lohse-Busch Section Manager - Vehicle Systems Research E-mail hlb@anl.gov Projects Vehicle Thermal Management Vehicle and Component Benchmarking...

  15. Locations of Industrial Assessment Centers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers (IACs) Locations of Industrial Assessment Centers ... John Gardner Phone: (208) 426-5702 E-mail: jgardner@boisestate.edu Address: CAES Energy ...

  16. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Akai, Tomoko, E-mail: t-akai@aist.go.jp Advanced Glass Group, Research Institute for Ubiquitous Energy Devices, National Institute of Advanced Industrial Science and Technology ...

  17. CCEI REU Program Application | University of Delaware

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Street: City: State: Zip: Contact Information: Cell Phone: Email: Demographics Gender: Male Female Housing: Will you need campus housing? Yes No Citizenship:...

  18. Essam M. El-Hannouny | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Essam El-Hannouny Essam M. El-Hannouny Mechanical Engineer Telephone (630) 252-4976 E-mail essam@anl.gov

  19. Contact Us | Center for Energy Efficient Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Center for Energy Efficient Materials University of California Santa Barbara, CA 93106-9560 Location: Center for Energy Efficient Materials Phelps 2300 University ...

  20. EIA-Voluntary Reporting of Greenhouse Gases Program - Contact

    U.S. Energy Information Administration (EIA) Indexed Site

    Contact Voluntary Reporting of Greenhouse Gases Program Contact For more information on the Voluntary Reporting of Greenhouse Gases Program, contact us via e-mail, phone, fax, or ...

  1. Jaclyn Murton | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jaclyn Murton Jaclyn Murton Jaclyn Murton Technologist E-mail: jkmurto@sandia.gov Website: Sandia National Laboratories Research and Technical Associates

  2. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts Document Actions...

  3. Matthew Johnson | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Johnson Matthew Johnson Matthew Johnson Assistant Professor E-mail: matt.johnson@sheffield.ac.uk Website: University of Sheffield Dr. Johnson is an Assistant Professor at the...

  4. Sam Barnett | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sam Barnett Sam Barnett Sam Barnett Graduate Student E-mail: sbarnett1@sheffield.ac.uk Website: University of Sheffield Graduate Students

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Interaction in Crystals for Emission of RADiation collaboration at Mainzer Mikrotron: Design, commissioning, and tests Lietti, D., E-mail: Daniela.Lietti@cern.ch ; Backe, H. ;...

  6. Timothy Allison | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Timothy Allison Timothy Allison Energy & Environmental Policy Scientist Telephone 630-252-3209 E-mail tallison@anl.gov

  7. Occupational Radiation Exposure | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Technical Support Contacts: REMS Project or any regulationspolicy issues: Nirmala Rao | (301) 903-2297 *E-mail Contact Preferred REMS System Support: Derek Hagemeyer | (865)...

  8. Solar Energy to Help Heat Major Commercial Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    For more information contact: e:mail: Public Affairs Golden, Colo., June 21, 1996 -- An innovative solar energy technology will have its first commercial application in Colorado at ...

  9. POLICY GUIDANCE MEMORANDUM #11A Approval Process for Dual Compensation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Ahtora Brooks Human Resource Specialists E-mail Ahtora.Brooks@Hq.Doe.Gov ... Phased Retirement Manager's Desk Reference on Human Capital Management Flexibilities

  10. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Health Division CERTIFIED MAIL- RETURN RECEIPT REQUESTED April30, 2014 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P. 0. Box 3090 Carlsbad,...

  11. Xia Huang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xia Huang Xia Huang Xia Huang Graduate Student E-mail: xhuang15@sheffield.ac.uk Website: University of Sheffield Graduate Students

  12. Xun Lu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xun Lu Xun Lu Xun Lu Postdoctoral Research Associate E-mail: lux1@ornl.gov Website: Oak Ridge National Laboratory Postdoctoral Associates

  13. Yan (Joann) Zhou | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joann Zhou Yan (Joann) Zhou Assistant Transportation Systems Analyst E-mail yzhou@anl.gov Projects Light Duty Electric Drive Vehicles Monthly Sales Updates The VISION Model

  14. Yaya Wang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yaya Wang Yaya Wang placeholder image Yaya Wang Research Affiliate Student E-mail: yaywang@clarku.edu Research Affiliate Associates &

  15. YoungHo Shin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YoungHo Shin YoungHo Shin Principal Process Development Engineer Telephone (630) 252-4861 E-mail yshin@anl.gov

  16. YuPo Lin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Yupo Lin YuPo Lin ElectroChemical and Bioprocessing Engineer E-mail yplin@anl.gov Projects Innovative Separations Resin Wafer Electrodeionization

  17. Yue Lu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yue Lu Yue Lu Yue Lu Graduate Student E-mail: luyue@wustl.edu Website: Washington University in St. Louis Graduate

  18. Fred Loebl

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Stop 100PGF Berkeley, CA 94720 US Biographical Sketch Fred has a master's degree in Biomedical Engineering from the University of Virginia. He has been administering and...

  19. Beamline 10.0.1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    electron systems using angle-resolved photoemission of solids Experimental techniques Angle-resolved photoemission from solids Local contactspokesperson This e-mail address is...

  20. Beamline 7.0.2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cooling Experimental techniques XPS, NEXAFS, imaging of areas up to 100 m across Local contact Spokesperson This e-mail address is being protected from spambots. You need...

  1. Storage Ring Parameters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    functions of the superbends and the insertion devices. For more precise information, contact Christoph Steier ( This e-mail address is being protected from spambots. You need...

  2. NREL: Energy Analysis - Tian Tian

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E-mail: Tian.Tian@nrel.gov Areas of expertise Energy policy and market analysis International stakeholder engagement Primary research interests Renewable energy...

  3. STUDYING LARGE- AND SMALL-SCALE ENVIRONMENTS OF ULTRAVIOLET LUMINOUS

    Office of Scientific and Technical Information (OSTI)

    CA 91101 (United States); Neff, Susan G. Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States), E-mail:...

  4. "Title","Creator/Author","Publication Date","OSTI Identifier...

    Office of Scientific and Technical Information (OSTI)

    CA 91101 (United States); Neff, Susan G. Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States), E-mail:...

  5. Article 29 Employee Awards | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cash Award. PDF icon Article 29 Employee Awards Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail lorrenda.buckner@hq.doe.go...

  6. POLICY GUIDANCE MEMORANDUM #29 Employment Offers Letters Performance...

    Broader source: Energy.gov (indexed) [DOE]

    29 Employment Offers Letters Performance Management Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail lorrenda.buckner@hq.doe.go...

  7. Benoit Roux | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benoit Roux Senior Scientist (Joint Appointment) & Professor, The University of Chicago Telephone 773.834.3557 E-mail roux@uchicago.edu

  8. Brandon Fisher | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineering Specialist Senior Brandon Fisher News Atomically Thin Metallic Boron Telephone 630.252.5324 Fax 630.252.4646 E-mail bfisher@anl.gov

  9. Subscribe

    Broader source: Energy.gov [DOE]

    Sign up to receive brief, periodic announcements by e-mail. These updates are "quick reads" and an excellent way to stay informed. Learn about the following topics:

  10. Payment Options - Combustion Energy Frontier Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Payment Options Payment Options Payment by Check: Pay To: The Trustees of Princeton University Mail Checks To: Princeton University Attn: Lilian Tsang EQUAD D334 Olden Street...

  11. Better Buildings Residential Network Data & Evaluation Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Analysis 9 Custom database tools * Forecast vs. actual-YTD and weekly * Direct mail ... * Workforce Data * Neighborhood and geographic data * Conversion rates 1 0 Forecast vs. ...

  12. Industrial Assessment Centers Identifying Energy Savings in Water...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    West Virginia University Director: Dr. B. Gopalakrishnan (304) 293-4607, 3709 Bhaskaran.Gopalakrishnan@ mail.wvu.edu DOE Headquarters Program Manager: John Smegal ...

  13. Jupiter Laser Facility Target Fab Request Requester: Date...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sketches: Jupiter Laser Facility Target Fab Request Requester: Date Requested: Phone or E-Mail: Date Required: Target Name: Reference : Laser System: Project: Task:

  14. Role of the antiferromagnetic pinning layer on spin wave properties...

    Office of Scientific and Technical Information (OSTI)

    Authors: Gubbiotti, G., E-mail: gubbiotti@fisica.unipg.it ; Tacchi, S. 1 ; Del Bianco, ... 4 ; Tamisari, M. 4 ; Dipartimento di Fisica e Geologia, Universit di Perugia, ...

  15. DOE-STD-4001-2000; Design Criteria Standard for Electronic Records...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... for documents that are received through electronic mail. (36 CFR 1234.2, reference 2.j) ... Records include all books, papers, maps, photographs, machine-readable materials, and ...

  16. Date centerdTimes New Roman

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by meeting with andor sending electronic mail messages to five prospective ... of all activity and associated fees and books for all attendees, was almost one-third ...

  17. Contact Us | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Our Teams User Advisory Council Careers Margaret Butler Fellowship Visiting Us Contact Us Contact Us Your name * Your e-mail address * Subject * Message * Verification *...

  18. Contact Us - SRSCRO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    contact Contact Us For further information concerning the SRS Community Reuse Organization, contact: Mailing Address: SRSCRO P. O. Box 696 Aiken, SC 29802 Physical Address: SRSCRO...

  19. National Security Science | Los National Alamos Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this Issue (pdf) In 2012 NSS received an NNSA Defense Programs AWARD OF EXCELLENCE National Security Science Mail Stop A142 Los Alamos National Laboratory Los Alamos, NM...

  20. Klaus Schulten | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Klaus Schulten Klaus Schulten Klaus Schulten Klaus Schulten Principal Investigator E-mail: schulten@illinois.edu Phone: 217.244.1604 Principal Investigator Dr. Schulten's research...

  1. Christine Pavia | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pavia Christine Pavia Christine Pavia Undergraduate Student E-mail: christine.pavia@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the...

  2. Gary Brudvig | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gary Brudvig Gary Brudvig Gary Brudvig Scientific Advisory Committee Member E-mail: gary.brudvig@yale.edu Website: Yale University Scientific Advisory Committee Member Dr....

  3. Mengran Liu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mengran Liu Mengran Liu placeholder image Mengran Liu Graduate Student E-mail: mliu5@ncsu.edu Website: North Carolina State University Graduate...

  4. Durgesh Rai | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Durgesh Rai Durgesh Rai Durgesh Rai Postdoctoral Research Associate E-mail: raidk@ornl.gov Website: Oak Ridge National Laboratory Postdoctoral Associates...

  5. Michal Gwizdala | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michal Gwizdala Michal Gwizdala Michal Gwizdala Postdoctoral Research Associate E-mail: m.s.gwizdala@vu.nl Website: Vrije Universiteit, Amsterdam Research Affiliate Associates &...

  6. Greg Scholes | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Scholes Greg Scholes Greg Scholes Principal Investigator E-mail: gscholes@princeton.edu Phone: (609) 258-0729 Website: Princeton University Principal Investigator (2014 -...

  7. Ingrid Archibald | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ingrid Archibald Ingrid Archibald Ingrid Archibald Undergraduate Student E-mail: ingridarchibald@wustl.edu Website: Washington University in St. Louis Undergraduate student...

  8. Amanda Brindley | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amanda Brindley Amanda Brindley Amanda Brindley Laboratory Technician E-mail: a.brindley@sheffield.ac.uk Website: University of Sheffield Research and Technical Associates...

  9. Channing Hunter | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Channing Hunter Channing Hunter Channing Hunter Undergraduate Student E-mail: channing.hunter@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled...

  10. Heiko Lokstein | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heiko Lokstein Heiko Lokstein Heiko Lokstein Research Associate E-mail: heiko.lokstein@glasgow.ac.uk Website: University of Glasgow Research and Technical Associates...

  11. Nesia Zurek | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nesia Zurek Nesia Zurek Nesia Zurek Postdoctoral Associate E-mail: nesia505@gmail.com Website: University of New Mexico Postdoctoral Associates...

  12. Elizabeth Martin | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth Martin Elizabeth Martin placeholder image Elizabeth Martin Laboratory Technician E-mail: e.martin@sheffield.ac.uk Website: University of Sheffield Research and Technical...

  13. Sasha Berger | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sasha Berger Sasha Berger Sasha Berger Undergraduate Student E-mail: sashaberger@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the PARC...

  14. Jack Chidgey | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jack Chidgey Jack Chidgey Jack Chidgey Graduate Student E-mail: j.chidgey@sheffield.ac.uk Website: University of Sheffield Graduate Students...

  15. Megan Kerstein | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Megan Kerstein Megan Kerstein Megan Kerstein Undergraduate Student E-mail: mkkerstein@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the...

  16. Chris Sherman | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chris Sherman Chris Sherman Chris Sherman Chris Sherman ResearchLab Assistant E-mail: shermanc@wustl.edu Research and Technical Associates...

  17. Caroline Focht | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Caroline Focht Caroline Focht Caroline Focht Undergraduate Student E-mail: caroline.focht@wustl.edu Website: Washington University Undergraduate student enrolled in the PARC...

  18. Michael Gross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michael Gross Michael Gross Michael Gross Principal Investigator E-mail: mgross@wustl.edu Phone: (314) 935-4814 Website: Washington University in St. Louis Principal Investigator...

  19. Margherita Maiuri | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Margherita Maiuri Margherita Maiuri Margherita Maiuri Postdoctoral Research Associate E-mail: mmaiuri@princeton.edu Website: Princeton University Postdoctoral Associates...

  20. Liron David | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liron David Liron David placeholder image Liron David Alumnus E-mail: liron.david@childrens.harvard.edu Website: Harvard University Formerly a student of PARC Research Affiliate...

  1. Maitrayee Bhattacharyya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Maitrayee Bhattacharyya Maitrayee Bhattacharyya Maitrayee Bhattacharyya Senior Research Associate E-mail: maitrayee@biology2.wustl.edu Website: Washington University in St. Louis...

  2. Don Hood | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Don Hood Don Hood Don Hood Graduate Student E-mail: dhood@wustl.edu Website: Washington University in St. Louis Graduate Students...

  3. Kyle Cepeda | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kyle Cepeda Kyle Cepeda Kyle Cepeda Undergraduate Student E-mail: kcepeda@wustl.edu Website: Washington University Undergraduate student enrolled in the PARCI-CARES Certificate of...

  4. Carrie Goodson | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carrie Goodson Carrie Goodson Carrie Goodson Research Technician E-mail: cgoodson@wustl.edu Website: Washington University Research and Technical Associates...

  5. David Swainsbury | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Swainsbury David Swainsbury David Swainsbury Postdoctoral Research Associate E-mail: d.swainsbury@sheffield.ac.uk Website: University of Sheffield Postdoctoral Associates...

  6. U.S. Department of Energy Interim E-QIP Procedures | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Energy Security Symposium OE Releases Second Issue of Energy Emergency Preparedness Quarterly (April 2012) V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets...

  7. Working Remotely | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    instant messages with Jabber Access your voice mail Collaboration Host a meeting with Blue Jeans Access your files on Box Argonne SharePoint Server (login required) Cyber...

  8. NREL: Energy Analysis - Kathleen Nawaz

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E-mail: kathleen.nawaz@nrel.gov Areas of expertise Global climate change and renewable energy Co-benefitsdevelopment impact analysis Low carbon transportation Primary research...

  9. Los Alamos National Laboratory Postdoctoral Career Fair 2015

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form August 25 - 27, 2015 Company Name Mailing Address City State Zip Code Contact Person: Name Telephone email Recruiter 1 Name Recruiter 2 Name Recruiter 3 Name Recruiter...

  10. Research Affiliate Associates & Students | Photosynthetic Antenna...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Affiliate Associates & Students Research Affiliate Associates & Students Michal Gwizdala Postdoctoral Research Associate E-mail: m.s.gwizdala@vu.nl Atsuko Kanazawa Research...

  11. George Waldmann | Department of Energy

    Energy Savers [EERE]

    George Waldmann George Waldmann Phone 202-586-9904 E-mail george.waldmann@hq.doe.gov Last Name Waldmann First Name George

  12. Ina Shaw | Department of Energy

    Energy Savers [EERE]

    Ina Shaw Ina Shaw Phone 202-586-8464 E-mail ina.shaw@hq.doe.gov Last Name Shaw First Name Ina Title HUMAN

  13. Jennifer Ackerman | Department of Energy

    Energy Savers [EERE]

    Ackerman Jennifer Ackerman Phone (202) 586-3860; E-mail jennifer.ackerman@hq.doe.gov Last Name Ackerman First Name Jennifer Title Director, Human Capital Policy

  14. Thomasina Mathews | Department of Energy

    Energy Savers [EERE]

    Thomasina Mathews Thomasina Mathews Phone 202-586-2657 E-mail thomasina.mathews@hq.doe.gov Last Name Mathews First Name Thomasina Title PROGRAM MANAGER

  15. Renewable energy generation sources...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Renewable Systems & Energy Infrastructure | Solar Programs For more information please contact: William Kolb E-mail: wjkolb@sandia.gov Phone (505) 844-1935 Website: ...

  16. NREL Offers Renewable Energy Award at International Competition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Offers Renewable Energy Award at International Competition For more information contact: e:mail: Public Affairs Golden, Colo., May 13, 1998 The National Renewable Energy ...

  17. Jeongwoo Han | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeongwoo Han Jeongwoo Han Assistant Energy Systems Analyst E-mail jhan@anl.gov Projects Novel Processing of Waste Streams for Fuels and Co-products

  18. Jonathan Kessler | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jonathan Kessler Jonathan Kessler Jonathan Kessler Research Affiliate Student E-mail: j.kessler@wustl.edu Website: Washington University in St. Louis Research Affiliate Associates & Students

  19. Jonathan Logan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Ian McNulty) Jonathan Logan Telephone 630.252.4874 Fax 630.252.5739 E-mail jmlogan

  20. Kirsty Hacking | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kirsty Hacking Kirsty Hacking Kirsty Hacking Graduate Student E-mail: k.hacking.1@research.gla.ac.uk Website: University of Glasgow Graduate

  1. Spin Seebeck devices using local on-chip heating (Journal Article...

    Office of Scientific and Technical Information (OSTI)

    measurements. Authors: Wu, Stephen M., E-mail: swu@anl.gov ; Fradin, Frank Y. ; Hoffman, Jason ; Hoffmann, Axel ; Bhattacharya, Anand 1 + Show Author Affiliations...

  2. Customized atomic force microscopy probe by focused-ion-beam...

    Office of Scientific and Technical Information (OSTI)

    Authors: Wang, Andrew ; Butte, Manish J., E-mail: manish.butte@stanford.edu 1 + Show Author Affiliations Department of Pediatrics, Division of Immunology, Allergy and ...

  3. The bgclang Compiler | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wrappers Mailing list and support General usage OpenMP Fast-math optimizations Vector (QPX) intrinsics and math functions Autovectorization Dynamic linking Memory bounds ...

  4. Disabled Veterans Affirmative Action Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guide for the Disabled Veterans' Affirmative Action Program (DVAAP) PDF icon FY16 DVAAP Plan.pdf Responsible Contacts Donna Friend HUMAN RESOURCES SPECIALIST E-mail ...

  5. Antoinette Moultrie | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Antoinette Moultrie Antoinette Moultrie Phone 202-586-9662 E-mail antoinette.moultrie@hq.doe.gov Last Name Moultrie First Name Antoinette Title HUMAN RESOURCES SPECIALIST

  6. Donna Friend | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Donna Friend Donna Friend Phone 202-586-5880 E-mail donna.friend@hq.doe.dov Last Name Friend First Name Donna Title HUMAN RESOURCES SPECIALIST

  7. Lynn Proctor | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Lynn Proctor Lynn Proctor Phone 202-586-9545 E-mail lynn.proctor@hq.doe.gov Last Name Proctor First Name Lynn Title HUMAN RESOURCES SPECIALIST

  8. Keidra Biddiex | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Keidra Biddiex Keidra Biddiex Phone (202) 586-7693 E-mail Keidra.Biddiex@hq.doe.gov Last Name Biddiex First Name Keidra Title Human Resources Specialist

  9. Savannah Fuqua | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Savannah Fuqua Savannah Fuqua Savannah Fuqua E-mail: savannah.fuqua@wustl.edu Website: Washington University Undergraduate student enrolled in the PARCI-CARES Certificate of ...

  10. Catharina Milostan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policy Scientist Telephone 630-252-6009 E-mail cmilostan@anl.gov Projects Acoustic Building Infiltration Measurement SystemSonic Leak Quantifier Commercial Upstream...

  11. INS-L-10-03

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    After a thorough review of the facts, including a review of e-mails, conducting a significant number of personal interviews, administering signedsworn statements, and making ...

  12. Ming-Yang Ho | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ming-Yang Ho Ming-Yang Ho Ming-Yang Ho Graduate Student E-mail: mxh504@psu.edu Website: Pennsylvania State University Graduate Students...

  13. Eunkyung Yang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eunkyung Yang Eunkyung Yang Eunkyung Yang Postdoctoral Research Associate E-mail: ekyang@wustl.edu Phone: 314.935.6530 Postdoctoral...

  14. Nepheline crystallization in boron-rich alumino-silicate glasses...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the range of compositions allowable for formulation while still avoiding nepheline Journal of Non-Crystalline Solids 409 (2015) 149-165 Corresponding author. E-mail...

  15. Electric field effects in graphene/LaAlO{sub 3}/SrTiO{sub 3}...

    Office of Scientific and Technical Information (OSTI)

    ; Levy, Jeremy, E-mail: jlevy@pitt.edu 1 ; Lee, Hyungwoo ; Ryu, Sangwoo ; Eom, Chang-Beom 2 ; Ghahari, Fereshte ; Ravichandran, Jayakanth ; Kim, Philip 3 + Show Author ...

  16. Mechanistic study of atomic layer deposition of Al{sub x}Si{sub...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cho, Jea ; Kim, Taeseung ; Seegmiller, Trevor ; Chang, Jane P., E-mail: jpchang@ucla.edu 1 + Show Author Affiliations Department of Chemical and Biomolecular ...

  17. HIGHLY VARIABLE OBJECTS IN THE PALOMAR-QUEST SURVEY: A BLAZAR...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne ; Baltay, Charles ; Coppi, Paolo ; Ellman, Nancy ; Glikman, Eilat ; ... Ashish ; Williams, Roy, E-mail: anne.bauer@usm.uni-muenchen.d 2 + Show Author ...

  18. THE MASS-RICHNESS RELATION OF MaxBCG CLUSTERS FROM QUASAR LENSING...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne H. 1 ; Baltay, Charles ; Ellman, Nancy ; Jerke, Jonathan ; Rabinowitz, David ; Scalzo, Richard, E-mail: bauer@ieec.uab.es 2 + Show Author Affiliations ...

  19. MEASURING LENSING MAGNIFICATION OF QUASARS BY LARGE SCALE STRUCTURE...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne H. 1 ; Seitz, Stella 2 ; Jerke, Jonathan ; Scalzo, Richard ; Rabinowitz, David ; Ellman, Nancy ; Baltay, Charles, E-mail: bauer@ieec.uab.es 3 + Show ...

  20. POLICY GUIDANCE MEMORANDUM #09A Direct Hire Authority for Acquisition...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Loretta Collier Director, Human Capital Policy Division E-mail loretta.robinson@hq.doe.gov Phone 202-586-9239 More Documents & Publications POLICY GUIDANCE ...