National Library of Energy BETA

Sample records for mailing list telephone

  1. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  2. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  3. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  4. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  5. Directory Listings | Department of Energy

    Broader source: (indexed) [DOE]

    employees including their telephone number, routing symbol, and location (buildingroom number) A listing of Headquarters staff by organization including their telephone...

  6. Telephone Service | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Telephone Service Forward your telephone calls to an alternate number and access your voice mail from off-site. Host a Conference Call All employees can use BlueJeans to host conference calls. You can also request a conference call setup by submitting an online request to the phone operators at least 1 hour before the conference start time. Requests are processed and confirmations are sent during normal business hours. You will also need to supply an Argonne cost code. Submit a Teleconference

  7. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  8. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  9. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  10. Email Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Lists Email Lists When you get a NERSC user account, an email alias is created for you of the form is an email alias that will forward mail to your delivery email address. The NERSC Information Management (NIM) accounting interface will display your delivery address under the Contact Info tab (select My Contact Info from the My Stuff pull-down in the NIM main menu). Please keep your contact information in NIM up-to-date. Announcements of interest to

  11. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  12. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  13. List of SME Contacts to Notify of Important Issues, April 2014

    Energy Savers [EERE]

    List of SME Contacts to Notify of Important Issues Anyone identifying names that should be changed are encouraged to provide the update information to Sharon Brown (AU-23) at 202-586-6377. April 2014 Subject Matter Area Name Telephone E-mail Address Office of Aviation Management Ferrin Moore 202-586-6171 Chemical Safety Topical Committee Joe Hopkins 301-903-5619 Chemical Safety Topical Committee Dave Weitzman 301-903-5401

  14. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  15. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  16. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  17. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  18. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  19. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  20. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  1. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Last edited: 2016-04-29 11:34:28

  2. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  3. All Software List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Compilers Programming Models Version Control Tools Programming Libraries Performance and Debugging Tools Grid Software and Services NERSC Software Downloads Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting

  4. I/O Library List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ROOT I/O Library List Databases Best Practices Data Analytics Data Transfer Workflow Tools Science Gateways Data Visualization Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support

  5. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  6. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  7. Alaska Power Telephone Company | Open Energy Information

    Open Energy Info (EERE)

    search Name: Alaska Power Telephone Company Address: 193 Otto Street PO Box 3222 Place: Port Townsend Zip: 98368 Region: United States Sector: Marine and Hydrokinetic Phone Number:...

  8. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  9. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  10. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  11. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Here is a list of those in attendance in table order: 1. Ricky Kendall, Ames laboratory 2. Mike Minkoff, ANL 3. Brian Hingerty, ORNL 4. Doug Rotman, LLNL 5. David J. Dean, ORNL 6. Don Spong, ORNL 7. Viktok K. Decyk, UCLA 8. Robert Ryne, LANL 9. Ji Qiang, LANL 10. Sandy Merola, LBNL 11. Doug Olson, LBNL 12. Jim Craw, NERSC/LBNL 13. Greg Butler, NERSC/LBNL 14. Tammy S. Welcome, NERSC/LBNL 15. David H. Bailey, NERSC/LBNL 16. Alex Zunger, NREL 17. Bruce Ross, NOAA 18. Tom


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    COMPLETE LISTING: DISPOSITION AUTHORITIES FROZEN UNDER THE EPIDEMIOLOGICAL MORATORIUM MARCH 2008 Listed below are all the disposition authorities which are under the moratorium on the destruction of health related records as of March 2008. All records scheduled under these authorities at Department of Energy (DOE) headquarters and field sites should be preserved past their normal retention periods unless an headquarters organization or a field site has obtained permission to remove records

  13. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List ERSUG - Attendees John Allen - NERSC Bas Braams - NYU Jack Byers - LLNL Bruce Curtis - NERSC David Feller - PNL Judith Giarrusso - PPPL Brent Gorda - NERSC Bruce Griffing - NERSC Bill Herrmannsfeldt - SLAC Brian Hingerty - ORNL Barry Howard - NERSC Stephen Jardin - PPPL Morris Jette - NERSC Bruce Kelly - NERSC Rick Kendall - PNL Tom Kitchens - DOE Dale Koelling - DOE Jean-Noel Leboeuf - ORNL Steve Louis - NERSC Maureen McCarthy - PNL Michel McCoy - NERSC William

  14. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  15. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  16. DOE - Office of Legacy Management -- Bell Telephone Laboratories...

    Office of Legacy Management (LM)

    Bell Telephone Laboratories - Murray Hill - NJ 0-04 FUSRAP Considered Sites Site: BELL TELEPHONE LABORATORIES - MURRAY HILL (NJ.0-04 ) Eliminated from consideration under FUSRAP...

  17. Trails List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    List Trails List Trail-specific access information and rules. It is your responsibility to understand the rules of a particular trail. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z Ancho Canyon Trail Closed Ancho Springs Trail Access: Open to the public Length: 1.78 miles Elevation change: 1027 feet Connecting trails:

  18. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List June 2004 NUG Meeting Participants Name Phone Email Organization Thursday Friday Benjamin A. Allan 925-294-2453 Sandia National Laboratories here Harsh Anand 510-486-5575 LBL grid Michael Banda 510-486-2837 LBNL here David Bernholdt 865-574-3147 ORNL grid Wes Bethel 510-486-7353 LBNL here here Greg Butler 510-486-8691 NERSC here Tina Butler 510-495-2379

  19. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Participants Registered for NUG Meeting, November 9, 2004 Name Phone Email Organization Number Attending Brandon Allgood 831-212-1802 UCSC 1 Matthew Andrews 510-872-7747 NERSC 1 Alan Aspuru-Guzik 510-642-2154 UC Berkeley 1 Michael Banda 510-495-2837 LBNL 1 David Bernholdt 865-574-3147 ORNL 1 Wes Bethel 510-486-7353 LBNL 1 to 3 Andrew Canning 510-495-2962

  20. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List June 12-13 NUG Meeting Registrants PPPL, On site 24 registered Name Affiliation Location Citizenship Days Monday Dinner? Matthew Andrews Berkeley Lab PPPL USA June 12-13 Yes Elena Belova PPPL PPPL Russian June 12-13 No Joshua Breslau PPPL PPPL U.S. June 12-13 Yes Jonathan Carter Berkeley Lab PPPL United Kingdom June 12-13 Yes Jin Chen PPPL PPPL Chinese June 12-13 No Jim Craw NERSC PPPL USA June 12 Yes Brent Draney NERSC PPPL USA June 12-13 Yes Stephane Ethier PPPL

  1. The Telephone: An Invention with Many Fathers

    ScienceCinema (OSTI)

    Brenni, Paolo [CNR-FST-IMSS, Florence, Italy


    The names of A.G. Bell, A. Meucci, P.Reis, E. Gray, just to mention the most important ones, are all connected with the invention of the telephone. Today, the Italian inventor A. Meucci is recognized as being the first to propose a working prototype of the electric telephone. However, for a series of reasons his strenuous efforts were not rewarded. I will not repeat here the endless and complex disputes about the ?real father? of the telephone. From an historical point of view it is more interesting to understand why so many individuals from different backgrounds conceived of a similar apparatus and why most of these devices were simply forgotten or just remained laboratory curiosities. The case of the development of the telephone is an emblematic and useful example for better understanding the intricate factors which are involved in the birth of an invention and reasons for its success and failure.

  2. Staff Listing - Office of Regulation and International Engagement, Division

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Natural Gas Regulation, Division of International Engagement | Department of Energy Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Office of Regulation and International Engagement Mailing Address: Office of Regulation and International Engagement Office of

  3. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Name Phone Email Monday Tuesday Wednesday Joonhee An 510-495-2990 X X X Alan Aspuru-Guzik 510-652-1671 X Polly Baker 317-278-8150 X John Bell 510-486-5391 X Wes Bethel 510-486-7353 X X Mark Brewer 510-666-0263 X Greg Butler 510-486-8691 X X Christopher Cantalupo 510-495-2967 X Jonathan Carter 510-486-7514

  4. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Attendees at NERSC: Onsite and Remote participation Tech-X, On-site 29 registered (29 for Oct. 7, 25 for Oct. 8) Name Affiliation Location Days Dinner? Katie Antypas NERSC InPerson Oct. 7-8 Yes Travis Austin Tech-X Corp InPerson Oct. 7 No Jon Bashor LBNL InPerson Oct. 7-8 Yes George Bell Tech-X Corp InPerson Oct. 7-8 No Jeff Broughton NERSC InPerson Oct. 7-8 Yes David Bruhwiler Tech-X Corp InPerson Oct. 7-8 No Eric Bylaska PNNL InPerson Oct. 7-8 Yes Scott Campbell


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OKLAHOMA SOUTHWESTERN POWER ADMIN POC Gary Bridges Telephone (918) 595-6671 Email gary.bridges@swpa...

  6. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  7. List based prefetch

    DOE Patents [OSTI]

    Boyle, Peter; Christ, Norman; Gara, Alan; Kim; ,Changhoan; Mawhinney, Robert; Ohmacht, Martin; Sugavanam, Krishnan


    A list prefetch engine improves a performance of a parallel computing system. The list prefetch engine receives a current cache miss address. The list prefetch engine evaluates whether the current cache miss address is valid. If the current cache miss address is valid, the list prefetch engine compares the current cache miss address and a list address. A list address represents an address in a list. A list describes an arbitrary sequence of prior cache miss addresses. The prefetch engine prefetches data according to the list, if there is a match between the current cache miss address and the list address.

  8. List based prefetch

    DOE Patents [OSTI]

    Boyle, Peter; Christ, Norman; Gara, Alan; Kim, Changhoan; Mawhinney, Robert; Ohmacht, Martin; Sugavanam, Krishnan


    A list prefetch engine improves a performance of a parallel computing system. The list prefetch engine receives a current cache miss address. The list prefetch engine evaluates whether the current cache miss address is valid. If the current cache miss address is valid, the list prefetch engine compares the current cache miss address and a list address. A list address represents an address in a list. A list describes an arbitrary sequence of prior cache miss addresses. The prefetch engine prefetches data according to the list, if there is a match between the current cache miss address and the list address.

  9. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  10. DPC List - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DPC List by Patricia Greeson Headquarters and Associated Field/ Operations Offices and Contractors Directives Point of Contact Email Address Telephone AR Adam Goldstein 202-287-1061 AU Cecelia Kenney 202-586-4399 CF John Wall 202-586-5728 CI Daniel Woomer 202-586-9886 CTA/CNS Bud Danielson 301-903-2954 EA (Enterprise Assessment) Sharon Edge-Harley

  11. CAMD Cleanroom Chemical List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CAMD Cleanroom Chemical List Chemicals on this list are routine use chemicals in the CAMD ... Data Sheets and or Website. All chemical MSDS sheets are the hyperlink "(MSDS)" ...


    Energy Savers [EERE]

    UTILITIES COLORADO WESTERN POWER ADMIN POC Cheryl Drake Telephone (720) 962-7154 Email Electric Bulk Power Transmission and Control 221121 Electric Power Distribution 221122 GEORGIA SOUTHEASTERN POWER ADMIN POC Ann Craft Telephone (706) 213-3823 Email Electric Bulk Power Transmission and Control 221121 Electric Power Distribution 221122 OKLAHOMA SOUTHWESTERN POWER ADMIN POC Gary Bridges Telephone (918) 595-6671 Email Electric Bulk Power


    Energy Savers [EERE]

    EDUCATION CALIFORNIA LAWRENCE BERKELEY LAB POC David Chen Telephone (510) 486-4506 Email Computer Training 611420 Professional and Management Development Training 611430 LAWRENCE LIVERMORE LAB POC Jill Swanson Telephone (925) 423-4535 Email Computer Training 611420 Professional and Management Development Training 611430 COLORADO GOLDEN FIELD OFFICE POC Karen Downs Telephone (720) 356-1269 Email Computer Training 611420 Professional and


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... All Other Professional, Scientific, and Technical Services 541990 NEVADA NEVADA SITE OFFICE POC Anita Ross Telephone (702) 295-5690 Email Other Accounting ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FORESTRY COLORADO WESTERN POWER ADMIN POC Cheryl Drake Telephone (720) 962-7154 Email Timber tract operations 113110 Cutting and transporting timber 113310 GEORGIA ...

  16. SBOT TEXAS PANTEX PLANT POC Brad Beck Telephone

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PANTEX PLANT POC Brad Beck Telephone (806) 477-6192 Email ADMINISTATIVE WASTE REMEDIATION Facilities Support Services 561210 Executive Search Services 561312 ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SOUTH CAROLINA SAVANNAH RIVER LAB POC Sharon Campbell Telephone (800) 888-7986 Email EDUCATION Professional and Management Development Training 611430 ...

  18. UF Access List | Stanford Synchrotron Radiation Lightsource

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UF Access List Palceholder

  19. Systems configured to distribute a telephone call, communication systems, communication methods and methods of routing a telephone call to a service representative

    DOE Patents [OSTI]

    Harris, Scott H.; Johnson, Joel A.; Neiswanger, Jeffery R.; Twitchell, Kevin E.


    The present invention includes systems configured to distribute a telephone call, communication systems, communication methods and methods of routing a telephone call to a customer service representative. In one embodiment of the invention, a system configured to distribute a telephone call within a network includes a distributor adapted to connect with a telephone system, the distributor being configured to connect a telephone call using the telephone system and output the telephone call and associated data of the telephone call; and a plurality of customer service representative terminals connected with the distributor and a selected customer service representative terminal being configured to receive the telephone call and the associated data, the distributor and the selected customer service representative terminal being configured to synchronize, application of the telephone call and associated data from the distributor to the selected customer service representative terminal.

  20. Acronym master list

    SciTech Connect (OSTI)


    This document is a master list of acronyms and other abbreviations that are used by or could be useful to, the personnel at Los Alamos National Laboratory. Many specialized and well-known abbreviations are not included in this list.

  1. List of Math Libraries

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Libraries List List of Math Libraries Package Platform Version Module Install Date Date Made Default A Fortran interface to the GNU Scientific Library (GSL) edison 1.0.0 fgsl1.0.0 ...

  2. List mode multichannel analyzer

    DOE Patents [OSTI]

    Archer, Daniel E.; Luke, S. John; Mauger, G. Joseph; Riot, Vincent J.; Knapp, David A.


    A digital list mode multichannel analyzer (MCA) built around a programmable FPGA device for onboard data analysis and on-the-fly modification of system detection/operating parameters, and capable of collecting and processing data in very small time bins (<1 millisecond) when used in histogramming mode, or in list mode as a list mode MCA.

  3. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  4. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  5. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  6. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  7. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  8. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  9. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  10. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  11. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  12. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  13. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  14. Geothermal publications list for Geopowering the West States

    SciTech Connect (OSTI)


    A list of geothermal publications is provided for each of the states under the ''GeoPowering the West'' program. They are provided to assist the various states in developing their geothermal resources for direct-use and electric power applications. Each state publication list includes the following: (1) General papers on various direct-uses and electric power generation available from the Geo-Heat Center either by mail or on-line at: (2) General Geo-Heat Center Quarterly Bulletin articles related to various geothermal uses--also available either by mail or on-line; (3) Publications from other web sites such as:; NREL, EGI, GEO and others ; and (4) Geothermal Resources Council citations, which are available from their web site:


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Long-Distance 484230 WESTERN POWER ADMIN POC Cheryl Drake Telephone (720) 962-7154 Email General Freight Trucking, Local 484110 General Freight Trucking, Long-Di...

  16. Fire Hazards Listing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hazards Listing Fire Hazards Listing Focusing on fire prevention and protection. Contact Fire Management Officer Manuel J. L'Esperance Emergency Management (505) 667-1692 Email Currently reported fire hazards Below are the currently reported fire hazards. The list is updated each day by the close of business. Current fire hazards Hazard Description Date Submitted Status No hazards currently reported. Legend: R=Resolved, P=Pending, NAR=No Action Required

  17. Listing of United States companies that supply goods and services for geothermal explorers, developers and producers internationally

    SciTech Connect (OSTI)

    Not Available


    This List is composed solely of US companies with major offices within the United States. All of the companies listed are involved in selling geothermally related goods and services internationally, or have the proven capability to do so. Each specific listing includes the company name, the name or title of the key contact person, address, telephone and if available a facsimile machine or telex number.

  18. LEDP - New Listings

    Office of Scientific and Technical Information (OSTI)

    ...www.osti.govledp The listing of new equipment available through the LEDP Grant Program. 89726661250046W - TEMPERATURE TRANSMITTER http:www.osti.govledpdetails.jsp?...

  19. Associative list processing unit

    DOE Patents [OSTI]

    Hemmert, Karl Scott; Underwood, Keith D.


    An associative list processing unit and method comprising employing a plurality of prioritized cell blocks and permitting inserts to occur in a single clock cycle if all of the cell blocks are not full. Also, an associative list processing unit and method comprising employing a plurality of prioritized cell blocks and using a tree of prioritized multiplexers descending from the plurality of cell blocks.

  20. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  1. Associative list processing unit

    DOE Patents [OSTI]

    Hemmert, Karl Scott; Underwood, Keith D


    An associative list processing unit and method comprising employing a plurality of prioritized cell blocks and permitting inserts to occur in a single clock cycle if all of the cell blocks are not full.

  2. ARM - Topic List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TeachersTopic List Outreach Home Room News Publications Traditional Knowledge Kiosks Barrow, Alaska Tropical Western Pacific Site Tours Contacts Students Study Hall About ARM Global Warming FAQ Just for Fun Meet our Friends Cool Sites Teachers Teachers' Toolbox Lesson Plans Topic List Atmosphere Atmospheric Heat Budget Atmospheric Pressure Composition of the Atmosphere Evolution of the Atmosphere Mesosphere Stratosphere Thermosphere Troposphere Oceans Oceans Sea Surface and Sea Level Weather and

  3. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  4. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  5. Stratified random sampling plan for an irrigation customer telephone survey

    SciTech Connect (OSTI)

    Johnston, J.W.; Davis, L.J.


    This report describes the procedures used to design and select a sample for a telephone survey of individuals who use electricity in irrigating agricultural cropland in the Pacific Northwest. The survey is intended to gather information on the irrigated agricultural sector that will be useful for conservation assessment, load forecasting, rate design, and other regional power planning activities.


    Energy Savers [EERE]

    PROFESSIONAL / SCIENTIFIC / TECHNICAL CALIFORNIA LAWRENCE BERKELEY LAB POC David Chen Telephone (510) 486-4506 Email Engineering Services 541330 Drafting Services 541340 Geophysical Surveying and Mapping Services 541360 Testing Laboratories 541380 Custom Computer Programming Services 541511 Computer Systems Design Services 541512 Other Computer Related Services 541519 Administrative Management and General Management Consulting Services 541611 Other Scientific and Technical

  7. check list for those with one abnormal BeLPT

    Energy Savers [EERE]

    CHECK LIST FOR THOSE WHO HAVE HAD, OR WHO IN THE FUTURE HAVE, ONE ABNORMAL BeLPT _____ Fill out the EE-1 and EE-3 and include a copy of any abnormal BeLPT results that you have; review the EE-7 form. _____ Make a copy of the completed forms (one to keep for yourself). _____ Take the original copy of your forms (or mail them) to your nearest EEOICPA Resource Center. If you have already filed these forms, please do not fill them out again, just skip to the next item, below. _____ After you are

  8. List of Programming Tools

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Programming Tools List List of Programming Tools Package Platform Version Module Install Date Date Made Default 7zip genepool 9.20.1 7zip/9.20.1 2013-01-14 2013-01-14 7zip phoebe 9.20.1 7zip/9.20.1 2013-01-14 2013-06-26 ABINIT cori 7.10.4 abinit/7.10.4 2015-09-24 2015-09-24 ABINIT edison 7.0.5 abinit/7.0.5 2013-03-12 2013-03-12 ABINIT edison 7.10.2 abinit/7.10.2 2015-01-27 ABINIT edison 7.10.4 abinit/7.10.4 2015-07-31 ABINIT edison 7.4.2 abinit/7.4.2 2014-06-26 2014-06-26 ABINIT edison 7.6.4

  9. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1/6/14 Contact: Janet Lambert Reviewed: 3/5/14 Page 1 of 17 The National Energy Technology Laboratory (NETL) Focused Standards List is primarily derived from standard references contained in the requirements section of NETL's environment, safety, security, and health (ESS&H) and cyber security directives. All standards shall reference the most current edition/version of that standard. 1. DEPARTMENT OF ENERGY (DOE) AND OTHER GOVERNMENT STANDARDS AND REQUIREMENTS a. DOE Directives The

  10. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  11. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4/4/12 Contact: Janet Lambert Reviewed: 4/4/12 Page 1 of 17 This Focused Standards List has been primarily derived from selected standard references contained in NETL issued directives. All standards shall reference the most current edition/ version of that standard. DOE and other Government Standards and Requirements DOE DIRECTIVES Note: The following DOE directives can be found at DOE Policy 141.1, DOE Management of Cultural Resources DOE Order 142.1, Classified

  12. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6/12 Contact: Janet Lambert Reviewed: 10/4/12 Page 1 of 17 This Focused Standards List has been primarily derived from selected standard references contained in NETL issued directives. All standards shall reference the most current edition/ version of that standard. DOE and other Government Standards and Requirements DOE DIRECTIVES Note: The following DOE directives can be found at DOE Policy 141.1, DOE Management of Cultural Resources DOE Order 142.1, Classified

  13. Approaches to Approved Contractor Lists

    Broader source: [DOE]

    Better Buildings Neighborhood Program Workforce / Business Partners Peer Exchange Call: Approaches to Approved Contractor Lists, Call Slides and Summary, April 25, 2013. This workforce/business partners peer exchange call discussed approaches to approved contractor lists.

  14. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  15. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  16. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  17. Safety equipment list

    SciTech Connect (OSTI)

    Lavender, J.C.; Roe, N.A.


    This analysis assigns preliminary safety class (SC) designations to major systems and structures associated with the Multi-Function Waste Tank Facility (MWTF) project in accordance with the Multi-Function QAPP, W-236A (Hall 1994). Also included are SC assignments for those subsystems and major components of the major systems discussed in this document (see Appendices A and B). Component safety classifications have been completed through inspection (using engineering judgement) for simple systems, and through use of logic models (i.e., fault trees) for complicated systems. This analysis is intended to augment the SC systems list supplied in Chapter 9 of the MWTF Preliminary Safety Analysis Report (WHC 1994). Whereas WHC (1994) only addresses select systems, this analysis addresses the SC ramifications of all MWTF systems and structures as identified in the Title 1 design media. This document provides additional analyses of the system safety classifications assignments, and classifies systems not addressed in WHC (1994). This analysis specifically describes the safety functions) that must be performed by each MWTF system.

  18. PHYSICAL INVENTORY LISTING | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PHYSICAL INVENTORY LISTING PHYSICAL INVENTORY LISTING Form supports nuclear materials control and accountability. PDF icon PHYSICAL INVENTORY LISTING More Documents & Publications ...

  19. IA Experts Listing 2014 | Department of Energy

    Energy Savers [EERE]

    IA Experts Listing 2014 IA Experts Listing 2014 PDF icon IA Experts Listing January 2014 More Documents & Publications Office of International Affairs Organization Chart PI...

  20. TPA Project Manager's Lists - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TPA Project Manager's Lists Tri-Party Agreement The Agreement Announcements List of Approved Changes TPA Project Manager's Lists Modifications for Public Comment Data Management...

  1. Advanced Biofuels Industry Roundtable - List of Participants...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Industry Roundtable - List of Participants Advanced Biofuels Industry Roundtable - List of Participants List of Participants from the May 18 Advanced Biofuels Industry ...

  2. EM Capital Asset Project List

    Broader source: [DOE]

    Read the EM Capital Asset Project List, which includes the project's name, site, current critical decision and current total project cost.

  3. Business Opportunities Forum Attendees List

    Office of Environmental Management (EM)

    CEO 6 Bowne, Johnny Energy Solutions Sales Director 7 Brandon, Lisa O. CDM Smith Client ... Forum Attendees List March 8, 2016 111 Smith, James Edgewater Technical Associates ...

  4. supplemental_lists.xls | Department of Energy

    Energy Savers [EERE]

    lists.xls supplemental_lists.xls Office spreadsheet icon supplemental_lists.xls More Documents & Publications updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013

  5. Quality Procedure- Approved Suppliers List

    Broader source: [DOE]

    This procedure establishes the responsibilities, process, and records for developing and maintaining the Approved Suppliers List (ASL) for EM Headquarters Office of Standards and Quality Assurance in accordance with EM-QA-001, Environmental Management Quality Assurance Program.

  6. List of SEP Reporting Metrics

    Broader source: [DOE]

    DOE State Energy Program List of Reporting Metrics, which was produced by the Office of Energy Efficiency and Renewable Energy Weatherization and Intergovernmental Program for SEP and the Energy Efficiency and Conservation Block Grants (EECBG) programs.

  7. Documentation of the status of international geothermal power plants and a list by country of selected geothermally active governmental and private sector entities

    SciTech Connect (OSTI)

    Not Available


    This report includes the printouts from the International Geothermal Power Plant Data Base and the Geothermally Active Entity Data Base. Also included are the explanation of the abbreviations used in the power plant data base, maps of geothermal installations by country, and data base questionnaires and mailing lists.

  8. Listing of Defense Nuclear Facilities

    Energy Savers [EERE]

    Listing of Defense Nuclear Facilities The facilities listed below are considered DOE defense nuclear facilities for purposes of Section 3161. Kansas City Plant Pinellas Plant Mound Facility Fernald Environmental Management Project Site Pantex Plant Rocky Flats Environmental Technology Site, including the Oxnard Facility Savannah River Site Los Alamos National Laboratory Sandia National Laboratory Lawrence Livermore National Laboratory Oak Ridge National Laboratory Nevada Test Site 1 Y-12 Plant


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  10. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  11. Final Participant List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Participant List Final Participant List List of the participants in the 2005 Workshop on Manufacturing for the Hydrogen Economy PDF icon mfg_wkshp_particpicants.pdf More Documents & Publications Roadmap on Manufacturing R&D for the Hydrogen Economy Transportation and Stationary Power Integration Workshop Attendees List DOE Fuel Cell Pre-Solicitiation Workshop Participants List

  12. Consensual Listening-in to or Recording Telephone/Radio Conversations (restricted)

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Order specifies the Department of Energy (DOE) policy regarding the consensual listening-in to or recording of conversations on radio and telephone systems. Canceled by DOE N 251.107.

  13. Acquisition Letter Archive listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Archive listing Acquisition Letter Archive listing PDF icon Acquisition Letter Archive listing More Documents & Publications Microsoft Word - LibraryofPriorRulemakings.doc Policy Flash Archive Search File Acquisition Letters Remaining In Effect

  14. Energy & Manufacturing Workforce Training Topics List - Version...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) View this searchable list of ...

  15. PMCDP Training Events Listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PMCDP Training Events Listing PMCDP Training Events Listing Calendar listing of all PMCDP Training Events. Advanced Risk Management (FQN 301), SRS May 24, 2016 8:00AM EDT to May ...

  16. Property Representatives Lists - HQ | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Property Representatives Lists - HQ Property Representatives Lists - HQ These are the current lists of Headquarters Property Representatives. If you have any questions please contact: Ellen Hall, Office of Logistics Operations, (301) 903-2613. PDF icon Authorized Property Pass Signers List and Accountable Property Representatives List, Effective April 1, 2016 More Documents & Publications Directory Listings AU Functional Area Points of Contact by Office Directors Headquarters Facilities

  17. CNM Scientific Contact List | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CNM Scientific Contact List A list of scientific contacts for the Center for Nanoscale Materials PDF icon CNM Scientific Contact sheet 915...

  18. Category:Lists | Open Energy Information

    Open Energy Info (EERE)

    pages. Subcategories This category has the following 3 subcategories, out of 3 total. L Lists for Companies 11 pages Lists for Incentive Types 64 pages ...

  19. Technology Deployment List | Open Energy Information

    Open Energy Info (EERE)

    technologiesmatrix.htmlcat OpenEI Keyword(s): EERE tool, Technology Deployment List Language: English References: Technology Deployment List1 Identify emerging-and...

  20. List of Approved Changes - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Changes Tri-Party Agreement The Agreement Announcements List of Approved Changes TPA Project Manager's Lists Modifications for Public Comment Data Management MP-14 WIDS...

  1. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  2. hud_doe_supplemental_list_of_eligible_properties_list_2.xls | Department of

    Energy Savers [EERE]

    Energy 2.xls hud_doe_supplemental_list_of_eligible_properties_list_2.xls Office spreadsheet icon hud_doe_supplemental_list_of_eligible_properties_list_2.xls More Documents & Publications hud_doe_supplemental_list_of_eligible_properties_list_2.xls list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls hud_list-1_07-01-11.xls

  3. Suspect Counterfeit SME List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SME List Suspect Counterfeit SME List April 2014 Suspect Counterfeit SME List. PDF icon Suspect Counterfeit SME List - April 2014 More Documents & Publications FAQS Sponsors and Recognized Experts AU Functional Area Points of Contact by Office Directors Project Registration Number Assignments (Active)

  4. hud_doe_supplemental_list_of_eligible_properties_list_1.xls | Department of

    Energy Savers [EERE]

    Energy 1.xls hud_doe_supplemental_list_of_eligible_properties_list_1.xls Office spreadsheet icon hud_doe_supplemental_list_of_eligible_properties_list_1.xls More Documents & Publications hud_doe_supplemental_list_of_eligible_properties_list_1.xls rd_mfh_low_and_very_low.xls List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii)

  5. Category:Lists for Companies | Open Energy Information

    Open Energy Info (EERE)

    in Buildings Sector List of Companies in Carbon Sector L cont. List of Companies in Efficiency Sector List of Companies in Geothermal Sector List of Companies in Hydrogen...

  6. DOE Employee Concerns Program (ECP) Contact List | Department...

    Energy Savers [EERE]

    DOE Employee Concerns Program (ECP) Contact List DOE Employee Concerns Program (ECP) Contact List DOE Employee Concerns Program (ECP) Contact List PDF icon ECP Contact List May...

  7. Category:Lists for Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives List of Doors Incentives List of DuctAir sealing Incentives List of Energy Mgmt. SystemsBuilding Controls Incentives List of Equipment Insulation Incentives...

  8. Equipment Listing | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Equipment Listing Crystal Preparation and Characterization Resistance Heated Bridgman Crystal Growth Systems Back-Reflection Laue X-ray System Electro-Discharge Machining High and Low speed Diamond Saws Arc Zone Melting Crystal Growth System Lapping Fixtures for Precise Orientation of Crystals (0.1°) Physical Properties Measurement Facilities - Hardness Testing Vickers and Rockwell Hardness Testing Brinell Hardness Instrument Wilson Tukon Micro Hardness Tester Forming and Characterization

  9. Policy Flash Archive Search Listing

    Energy Savers [EERE]

    Policy Flash Archive Search Listing 1 Filename Flash2001-01 Rewrite of Regulations Governing Management and Operating Contracts Flash2001-02 Satellite Broadcast - Training Session on the DEAR Rewrite of Regulations Governing Management and Operating Contracts Flash2001-03 Federal Small Business Developments Flash2001-04 Notice of Proposed Rulemaking: Electronic and Information Technology Accessibility Flash2001-05 Contract Legal Management Requirements Flash2001-06 Notice of Proposed Rulemaking:

  10. Microsoft Word - BPD Priority List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Priority Data Fields for the Building Performance Database (Updated 2014-12) Below is list of data fields ranked as the the priority fields in data collection for the purposes of BPD. These field names use the the Building Energy Data Exchange Specification 1.0 terms in order to clearly communicate the content of the fields and to facilitate easier data transfer. These fields have been determined to provide enough information to compare building energy performance. Mandatory fields are

  11. Registration List - WCI-III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WCI-III Registration List Sandro Barlini, INFN - Laboratori Nazionali di Legnaro Wolfgang Bauer, Michigan State Aldo Bonasera, Laboratorio Nazionale del Sud, INFN Alexander Botvina, Institute for Nuclear Research RAS, Moscow Kyrill Bugaev, Lawrence Berkeley National Laboratory Xavier Campi, LPTMS Abdou Chbihi, GANIL Philippe Chomaz, GANIL Marco Cinausero, INFN Laboratori Nazionali di Legnaro Gianluca Colo', Dipartimento di Fisica Romualdo deSouza, Indiana University/IUCF Massimo Di Toro,

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  13. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  14. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  15. Site maps and facilities listings

    SciTech Connect (OSTI)

    Not Available


    In September 1989, a Memorandum of Agreement among DOE offices regarding the environmental management of DOE facilities was signed by appropriate Assistant Secretaries and Directors. This Memorandum of Agreement established the criteria for EM line responsibility. It stated that EM would be responsible for all DOE facilities, operations, or sites (1) that have been assigned to DOE for environmental restoration and serve or will serve no future production need; (2) that are used for the storage, treatment, or disposal of hazardous, radioactive, and mixed hazardous waste materials that have been properly characterized, packaged, and labelled, but are not used for production; (3) that have been formally transferred to EM by another DOE office for the purpose of environmental restoration and the eventual return to service as a DOE production facility; or (4) that are used exclusively for long-term storage of DOE waste material and are not actively used for production, with the exception of facilities, operations, or sites under the direction of the DOE Office of Civilian Radioactive Waste Management. As part of the implementation of the Memorandum of Agreement, Field Offices within DOE submitted their listings of facilities, systems, operation, and sites for which EM would have line responsibility. It is intended that EM facility listings will be revised on a yearly basis so that managers at all levels will have a valid reference for the planning, programming, budgeting and execution of EM activities.

  16. Critical Materials Workshop Final Participant List

    Broader source: [DOE]

    List of participants who attended the Critical Materials Workshop held on April 3, 2012 in Arlington, VA

  17. DOE Qualified List of Energy Service Companies

    Broader source: [DOE]

    Document contains the latest list of U.S. Department of Energy (DOE) qualified energy service companies (ESCOs).

  18. Technical Standards Managers Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Standards Managers Contact List Technical Standards Managers Contact List May 2016 Contact list for Technical Standards Managers in DOE, Field offices and National ...

  19. List of International Projects for FY 2012 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Communication & Engagement International Programs List of International Projects for FY 2012 List of International Projects for FY 2012 List of International ...

  20. 2014 DOE Project Management Workshop Attendees List | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Project Management Workshop Attendees List 2014 DOE Project Management Workshop Attendees List PDF icon 2014 PM Workshop Attendees ListName & Office.pdf More Documents &...

  1. Battery and Electric Drive Awardee List from American Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Awardee List from American Recovery and Reinvestment Act funding Battery and Electric Drive Awardee List from American Recovery and Reinvestment Act funding This is a list of the ...

  2. Completed Sites Listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cleanup Sites » Completed Sites » Completed Sites Listing Completed Sites Listing As of fiscal year 2012, EM (and its predecessor organization UMTRA) completed cleanup and closed 91 sites in 24 states. PDF icon Completed Sites Listing More Documents & Publications EM's Cleanup Mission: 16 Sites in 11 States Remaining EA-1406: Final Environmental Assessment Electronic Docket Room (e-Docket Room) Active Sites Active Sites Additional Information Completed Sites

  3. PowerSaver Approved Lenders List

    Broader source: [DOE]

    This document describes the 2014 approved PowerSaver lender list with contact information for the various states across the United States.

  4. ARM - Firearm Training and Authorization List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AlaskaFirearm Training and Authorization List NSA Related Links Facilities and Instruments Barrow Atqasuk Oliktok Point (AMF3) ES&H Guidance Statement Operations Science Field...

  5. TTO Phone List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    File TTO Phone List Revised 04-02-14.docx More Documents & Publications Technology Transfer Reporting Form DOE Hoisting and Rigging Technical Advisory Committee - Membership...

  6. Teaming Partner List for BENEFIT FOA Released

    Broader source: [DOE]

    Energy Efficiency and Renewable Energy (EERE) is compiling a Teaming Partner List to facilitate the formation of new project teams for the anticipated Buildings Energy Efficiency Frontiers &...

  7. List of Hydrogen Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives Jump to: navigation, search The following contains the list of 61 Hydrogen Incentives. CSV (rows 1 - 61) Incentive Incentive Type Place Applicable Sector Eligible...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ENVIRONMENTAL MONITORING & RESEARCH CENTER NEW MEXICO STATE UNIVERSITY TELEPHONE (575) 887-2759 1400 UNIVERSITY DRIVE, CARLSBAD, NEW MEXICO 88220 FAX NUMBER (575) 887-3051 An Update on CEMRC radiological results from air and surface water sampling activities following the February 14 th , 2014 radiation detection event The Carlsbad Environmental Monitoring and Research Center (CEMRC), an entity of New Mexico State University, continues to conduct radiological separation and analyses on a

  9. CITSS Configurable Item List: COTS Software | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Configurable Item List: COTS Software CITSS Configurable Item List: COTS Software CITSS Configurable Item List: COTS Software PDF icon CITSS Configurable Item List: COTS Software More Documents & Publications CITSS Project Plan CITSS Project Plan Software Configuration Management Plan

  10. Privacy Act Officers Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Privacy Act Officers Contact List Privacy Act Officers Contact List File Privacy Act Officers Contact List.docx More Documents & Publications Technical Standards Managers Contact List DOE-TSL-2-2002 VPP POINTS OF CONTACT

  11. Rulemaking List for Public List Serve May 2016 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Rulemaking List for Public List Serve May 2016 Rulemaking List for Public List Serve May 2016 PDF icon Acquisition & Financial Assistance Rules Status_May_2016.pdf More Documents & Publications Acquisition & Financial Assistance Rules Status Department of Energy Acquisition Regulation (DEAR) Final Rule for changes to Parts 908, 945, 952, and 970 regarding Government Property Department of Energy Acquisition Regulation (DEAR) Final Rule for Subchapters A, B, and C

  12. Capital Asset Project List.xls

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by DOE Order 413.3B, Program and Project Management for the Acquisition of Capital Assets. ... Start of Operations or Project Completion Capital Asset Project List 4112016 1 of 1

  13. Systems Analysis Workshop List of Attendees

    Broader source: [DOE]

    List of Attendees from DOE Systems Analysis Workshop held in Washington, D.C. July 28-29, 2004 to discuss and define role of systems analysis in DOE Hydrogen Program.

  14. Firearms Modifications List- June 13, 2012

    Broader source: [DOE]

    This document contains the currently-approved protective force "Firearms Modification List" referred to in Department of Energy Order 473.3, Protection Program Operations. This supersedes any previous versions of this document

  15. Staff Listing - Office of Regulation and International Engagement...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DC 20585 Director of the Office of Regulation and International Engagement John A. Anderson, Director Room 3E-052 Telephone (202) 586-0521 FAX (202) 586-6050 Division of...

  16. Summer of Applied Geophysical Experience Reading List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geophysical Experience Reading List Summer of Applied Geophysical Experience Reading List A National Science Foundation Research Experiences for Undergraduates program Contacts Institute Director Reinhard Friedel-Los Alamos SAGE Co-Director W. Scott Baldridge-Los Alamos SAGE Co-Director Larry Braile-Purdue University Professional Staff Assistant Georgia Sanchez (505) 665-0855 Keller, R., Khan, M. A., Morgan, P., et al., 1991, A Comparative Study of the Rio Grande and Kenya rifts, Tectonophys.,

  17. DOE - NNSA/NFO -- Acronyms List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    List of Acronyms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office List of Acronyms used on this website Acronym Definition AEC Atomic Energy Commission AMSI Advanced Monitoring Systems Initiative ARL/SORD Air Resources Laboratory, Special Operations and Research Division BEEF Big Explosives Experimental Facility BN Bechtel Nevada CAB Community Advisory Board CEF Criticality Experiments Facility CEMP Community Environmental Monitoring Program CRADA Cooperative Research and

  18. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  19. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  20. Record Liaison Officers (RLO) Distribution List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Record Liaison Officers (RLO) Distribution List Record Liaison Officers (RLO) Distribution List Distribution List of Record Liaison Officers PDF icon Record Liaison Officers (RLO) Distribution List More Documents & Publications Property Representatives Lists - HQ Collateral Duties for Records Liaison Officer (RLO) PROCEDURE FOR PREPARING RECORDS INVENTORY AND DISPOSITION SCHEDULES (RIDS)

  1. DOE Radiation Records Contacts List | Department of Energy

    Energy Savers [EERE]

    Radiation Records Contacts List DOE Radiation Records Contacts List March 2, 2016 DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site. PDF icon DOE Radiation Records Contacts List More Documents & Publications A Basic Overview of the Energy Employees Occupational Illness Compensation Program DOE-STD-1095-2011 Privacy Act Officers Contact List

  2. Technology Forum Map and List of Awardees' Posters and Exhibits...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Forum Map and List of Awardees' Posters and Exhibits Technology Forum Map and List of Awardees' Posters and Exhibits Technology Forum map and list of exhibits.pdf More...

  3. Tank waste remediation system risk management list

    SciTech Connect (OSTI)

    Collard, L.B.


    The Tank Waste Remedation System (TWRS) Risk Management List and it`s subset of critical risks, the Critical Risk Management List, provide a tool to senior RL and WHC management (Level-1 and -2) to manage programmatic risks that may significantly impact the TWRS program. The programmatic risks include cost, schedule, and performance risks. Performance risk includes technical risk, supportability risk (such as maintainability and availability), and external risk (i.e., beyond program control, for example, changes in regulations). The risk information includes a description, its impacts, as evaluation of the likelihood, consequences and risk value, possible mitigating actions, and responsible RL and WHC managers. The issues that typically form the basis for the risks are presented in a separate table and the affected functions are provided on the management lists.

  4. Listing of Defense Nuclear Facilities | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Listing of Defense Nuclear Facilities PDF icon Attachment 1 - Listing of Defense Nuclear Facilities More Documents & Publications Draft Policy and Planning Guidance for Community ...

  5. DOE Privacy Program Contact Listing as of September 21, 2010...

    Broader source: (indexed) [DOE]

    DOE Privacy Program Contact Listing as of September 21, 2010 DOE Privacy Program Contact Listing as of September 21, 2010 More Documents & Publications Privacy Act Officers Contact...

  6. EV Everywhere Grand Challenge - Battery Workshop attendees list...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EV Everywhere Grand Challenge - Battery Workshop attendees list Attendance list for the EV Everywhere Grand Challenge: Battery Workshop on July 26, 2012 held at the Doubletree ...

  7. Public Meeting Attendee List: Sustainable Design Standards for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings This document is ...

  8. List of Topics for Interagency Performance & Risk Assessment...

    Energy Savers [EERE]

    List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of ...

  9. List of Solar Pool Heating Incentives | Open Energy Information

    Open Energy Info (EERE)

    List of Solar Pool Heating Incentives Jump to: navigation, search The following contains the list of 117 Solar Pool Heating Incentives. CSV (rows 1 - 117) Incentive Incentive Type...

  10. List of Solar Thermal Process Heat Incentives | Open Energy Informatio...

    Open Energy Info (EERE)

    List of Solar Thermal Process Heat Incentives Jump to: navigation, search The following contains the list of 211 Solar Thermal Process Heat Incentives. CSV (rows 1 - 211) Incentive...

  11. Staff Listing - Office of Regulation and International Engagement...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Staff Listing - Office of Regulation and ...

  12. DOE Fuel Cell Pre-Solicitiation Workshop Participants List |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Fuel Cell Pre-Solicitiation Workshop Participants List Participants List for DOE Fuel Cell Pre-Solicitiation Workshop - Sheraton Denver West Hotel, 360 Union Boulevard, ...

  13. Policy Flash Search Listing (2001-2014) | Department of Energy

    Energy Savers [EERE]

    Policy Flash Search Listing (2001-2014) Policy Flash Search Listing (2001-2014) Use your browser search function and keywords to search for a particular policy flash. PDF icon Policy Flash Listing 2001-2014 More Documents & Publications Department of Energy Acquisition Letter Archive listing Department of Energy (DOE) Acquisition Guide

  14. Fire Safety Committee Membership List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fire Safety Committee Membership List Fire Safety Committee Membership List List of members representing DOE, NNSA and Contractors on the Fire Safety Committee. PDF icon Fire Safety Committee Membership List More Documents & Publications DOE Hoisting and Rigging Technical Advisory Committee - Membership Roster FAQS Sponsors and Recognized Experts FTCP Members

  15. EECBG SEP Attachment 1 - Process metric list | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SEP Attachment 1 - Process metric list EECBG SEP Attachment 1 - Process metric list Reporting Guidance Process Metric List PDF icon eecbg_10_07b_sep__10_006a_attachment1_process_metric_list.pdf More Documents & Publications EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List EECBG Program Notice 10-07A DOE Recovery Act Reporting Requirements for the State Energy Program

  16. EECBG SEP Attachment 1 - Process metric list

    Energy Savers [EERE]

    EECBG 10-07B/SEP 10-006A Attachment 1: Process Metrics List Metric Area Metric Primary or Optional Metric Item(s) to Report On 1. Building Retrofits 1a. Buildings retrofitted, by sector Number of buildings retrofitted Square footage of buildings retrofitted 1b. Energy management systems installed, by sector Number of energy management systems installed Square footage of buildings under management 1c. Building roofs retrofitted, by sector Number of building roofs retrofitted Square footage of

  17. WIPP TRU TeamWorks - Acronym List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Acronym List AK Acceptable Knowledge ANL-E Argonne National Laboratory - East (Analytical Laboratory) BLM Bureau of Land Management C of C Certificate of Compliance CAST Colorado All State Transportation, Inc. CBFO Carlsbad Field Office (DOE) CCA Compliance Certification Application CCP Central Characterization Project CH-TRU Contact-Handled Transuranic (waste) CMR Central Monitoring Room CTAC Carlsbad Field Office Technical Assistance Contractor DOE United States Department of Energy DOE-CBFO

  18. Eugene Stewart | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technician Sr. Eugene Stewart Telephone 630.252.4466 E-mail estewart

  19. Peter Fuesz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Associate Peter Fuesz Telephone 630.252.7151 E-mail fuesz

  20. Edward J. Daniels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward J. Daniels Sr. Energy Systems Scientist Telephone (630) 252-5279 E-mail edaniels

  1. Ron Tollner | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ron Tollner Manager, Building & Systems Operations Telephone 630.252.4457 E-mail tollner

  2. Sharon Nykolyshyn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sharon Nykolyshyn Executive Secretary - EGS Telephone 630-252-3739 E-mail snykolyshyn

  3. David Eckstein | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eckstein Principal Application Developer Telephone 630.252.7918 E-mail

  4. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Martinson Telephone (630) 252-7520 E-mail martinson

  5. Listed waste determination report. Environmental characterization

    SciTech Connect (OSTI)

    Not Available


    On September 23, 1988, the US Environmental Protection Agency (EPA) published a notice clarifying interim status requirements for the management of radioactive mixed waste thereby subjecting the Idaho National Engineering Laboratory (INEL) and other applicable Department of Energy (DOE) sites to regulation under the Resource Conservation and Recovery Act (RCRA). Therefore, the DOE was required to submit a Part A Permit application for each treatment, storage, and disposal (TSD) unit within the INEL, defining the waste codes and processes to be regulated under RCRA. The September 1990 revised Part A Permit application, that was approved by the State of Idaho identified 101 potential acute and toxic hazardous waste codes (F-, P-, and U- listed wastes according to 40 CFR 261.31 and 40 CFR 261.33) for some TSD units at the Idaho Chemical Processing Plant. Most of these waste were assumed to have been introduced into the High-level Liquid Waste TSD units via laboratory drains connected to the Process Equipment Waste (PEW) evaporator (PEW system). At that time, a detailed and systematic evaluation of hazardous chemical use and disposal practices had not been conducted to determine if F-, P-, or Unlisted waste had been disposed to the PEW system. The purpose of this investigation was to perform a systematic and detailed evaluation of the use and disposal of the 101 F-, P-, and Unlisted chemicals found in the approved September 1990 Part A Permit application. This investigation was aimed at determining which listed wastes, as defined in 40 CFR 261.31 (F-listed) and 261.33 (P & Unlisted) were discharged to the PEW system. Results of this investigation will be used to support revisions to the RCRA Part A Permit application.

  6. Minnesota Member Lists the Twin Cities' First Energy Fit Certified...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minnesota Member Lists the Twin Cities' First Energy Fit Certified Home Minnesota Member Lists the Twin Cities' First Energy Fit Certified Home Photo of a small house from the ...

  7. File:OperatingPermitCheckList.pdf | Open Energy Information

    Open Energy Info (EERE)

    OperatingPermitCheckList.pdf Jump to: navigation, search File File history File usage File:OperatingPermitCheckList.pdf Size of this preview: 463 599 pixels. Other resolution:...

  8. List of Solar Thermal Electric Incentives | Open Energy Information

    Open Energy Info (EERE)

    List of Solar Thermal Electric Incentives Jump to: navigation, search The following contains the list of 562 Solar Thermal Electric Incentives. CSV (rows 1-500) CSV (rows 501-562)...

  9. RFI Released to Compile Teaming Partner List for Upcoming BENEFIT...

    Energy Savers [EERE]

    RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA September 29, 2015 - 10:43am Addthis...

  10. Utah Sensitive Species List Webpage | Open Energy Information

    Open Energy Info (EERE)

    Species List Webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Utah Sensitive Species List Webpage Abstract Provides access to Utah Sensitive...

  11. CCC Federal License and Permit List | Open Energy Information

    Open Energy Info (EERE)

    CCC Federal License and Permit List Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: CCC Federal License and Permit ListLegal Abstract...

  12. Telephone Flat Geothermal Development Project Environmental Impact Statement Environmental Impact Report. Final: Comments and Responses to Comments

    SciTech Connect (OSTI)


    This document is the Comments and Responses to Comments volume of the Final Environmental Impact Statement and Environmental Impact Report prepared for the proposed Telephone Flat Geothermal Development Project (Final EIS/EIR). This volume of the Final EIS/EIR provides copies of the written comments received on the Draft EIS/EIR and the leady agency responses to those comments in conformance with the requirements of the National Environmental Policy Act (NEPA) and the California Environmental Quality Act (CEQA).

  13. DOE Employee Concerns Program Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Employee Concerns Program Contact List DOE Employee Concerns Program Contact List March 21 2016 Employee Concerns Program contact list/information for DOE HQ, field offices and program offices. PDF icon DOE Employee Concerns Program Contact List More Documents & Publications One Year Anniversary, Office of the Ombudsman WBA-15-0001 - In the Matter of Robert J. Schumacher The Role of Ombudsmen in Dispute Resolution


    National Nuclear Security Administration (NNSA)

    B, Page 1 SECTION L ATTACHMENT B LISTING OF KEY PERSONNEL TITLE NAME Note: Addremove extra rows if needed...

  15. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    Distribution List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page G-3 Except for individual stakeholders, this distribution list is composed of people representing organizations, which have expressed interest in site activities. When individual turnover occurs in these positions, DOE will revise the list to reflect the current holder of these positions. This type of revision is considered minor and not subject to review. All individuals on this list

  16. Announcing the "Top 10" List of Green Utility Leaders

    Office of Energy Efficiency and Renewable Energy (EERE)

    Find out if your utility made the National Renewable Energy Laboratory's list of top green power programs.

  17. Symbiosis Conference Speaker and Attendee List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference Speaker and Attendee List Symbiosis Conference Speaker and Attendee List This list outlines the session topics, speakers, and attendees for the Bioenergy Technologies Office's Symbiosis Conference. PDF icon symbiosis_conference_speaker_agenda.pdf More Documents & Publications Symbiosis Biofeedstock Conference: Expanding Commercialization of Mutualistic Microbes to Increase Feedstock Production Symbiosis Conference: Expanding Commercialization of Mutualistic Microbes to Increase

  18. Comment Listing Response to Draft REEE Solicitation FINAL | Department of

    Energy Savers [EERE]

    Energy Comment Listing Response to Draft REEE Solicitation FINAL Comment Listing Response to Draft REEE Solicitation FINAL PDF icon Comment ListingResponse_REEE Solicitation_final.pdf More Documents & Publications Draft Advanced Fossil Energy Projects Solicitation Public Comments Draft Advanced Nuclear Energy Solicitation Public Meeting Presentation DOE-LPO_Email-Update_001_Through_11

  19. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  20. UMTRA project list of reportable occurrences

    SciTech Connect (OSTI)

    Not Available


    This UMTRA Project List of Reportable occurrences is provided to facilitate efficient categorization of reportable occurrences. These guidelines have been established in compliance with DOE minimum reporting requirements under DOE Order 5000.3B. Occurrences are arranged into nine groups relating to US Department of Energy (DOE) Uranium Mill Tailings Remedial Action (UMTRA) Project operations for active sites. These nine groupings are provided for reference to determined whether an occurrence meets reporting requirement criteria in accordance with the minimum reporting requirements. Event groups and significance categories that cannot or will not occur, and that do not apply to UMTRA Project operations, are omitted. Occurrence categorization shall be as follows: Group 1. Facility Condition; Group 2. Environmental; Group 3. Personnel Safety; Group 4. Personnel Radiation Protection; Group 5. Safeguards and Security; Group 6. Transportation; Group 7. Value Basis Reporting; Group 8. Facility Status; and Group 9. Cross-Category Items.

  1. Computerized Instrumented Residential Audit (CIRA) source listings

    SciTech Connect (OSTI)

    Not Available


    CIRA is a set of computer programs to predict the energy consumption of small buildings. It can also provide an optimized list of improvements which reduce energy use. A 30 page booklet (Pub-425 Revised) explaining CIRA inputs, outputs, and calculation methods is available at no cost through the Technical Information Department, Lawrence Berkeley Laboratory, University of California, Berkeley, CA 94720. It includes an order form for disk copies of the program and for the CIRA Reference Manual. The source code in BASIC contained in this document is provided to help a user adapt the program to a particular application, or to see details of the calculation algorithms. (The engineering basis of the algorithms may be found in the CIRA Reference Manual). The programs are written in Microsoft BASIC-80, and for the version of CIRA normally distributed they are compiled on the Microsoft BASIC-80 compiler version 5.30. They are designed to run with the CP/M operating system, version 2.2.

  2. Teaming Partner List Available for the Innovative Composites Institute FOA

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Teaming Partner List Available for the Innovative Composites Institute FOA Teaming Partner List Available for the Innovative Composites Institute FOA March 26, 2014 - 12:34pm Addthis AMO is compiling a Teaming Partner List to facilitate the formation of new project teams for the Funding Opportunity Announcement (FOA) for the Advanced Composites Manufacturing Innovation Institute. This opportunity is focused on low-cost, energy efficient manufacturing and recycling of


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Occupational Medical Services at Hanford J-2-1 Section J Attachment J-2 LIST OF APPLICABLE DOE DIRECTIVES - LIST B The DOE Directives listed below contain requirements relevant to the scope of work under this contract. In most cases, the requirements applicable to the Contractor are contained in the Contractor Requirement Document attached to the DOE directive. These directives are applicable, in whole or in part, in accordance with Section I Clause entitled "DEAR 970.5204-2 LAWS,


    National Nuclear Security Administration (NNSA)

    Page 130 PART III - LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J LIST OF APPENDICES - TABLE OF CONTENTS Appendix A Statement of Work Appendix B Award Fee Plan Appendix C Transition Plan Appendix D Sensitive Foreign Nations Control Appendix E Performance Guarantee Agreement(s) Appendix F List of Applicable Directives Appendix G Personnel Appendix Appendix H Key Personnel Appendix I Small Business Subcontracting Plan Appendix J Diversity Plan Guidance Appendix K Program Management

  5. List of Major Information Systems,National Nuclear Security Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ADaPT Networked: | Department of Energy List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems, Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear

  6. Hanford Advisory Board and Committee Lists - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HAB and Committee Lists Hanford Advisory Board Convening Report SSAB Guidance Memorandum of Understanding Membership Nomination and Appointment Process Operating Ground Rules Calendars Advice and Responses Full Board Meeting Information Committee Meeting Information Outgoing Board Correspondence Key Board Products and Special Reports HAB Annual Report HAB and Committee Lists Points of Contact Related Links Hanford Advisory Board and Committee Lists Email Email Page | Print Print Page |Text

  7. Speaker List for EE Forum Breakout Sessions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Speaker List for EE Forum Breakout Sessions Speaker List for EE Forum Breakout Sessions The document contains a full itinerary of the EE Forum Breakout Sessions that includes full lists of speakers and their topics. The document covers Session 1 and Session 2. Each session includes the Buildings & Appliances Track, Codes & Standards Track, Industry Track, and Financing & ESCOs Track. Each session includes three separate forums taking place in either the Boiler Room, Crystal Ballroom,

  8. NNSA Computers Lead Global List | National Nuclear Security Administra...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Computers Lead Global List | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering...

  9. Bio Yankuang Hong Kong Listed | Open Energy Information

    Open Energy Info (EERE)

    Yankuang Hong Kong Listed Place: China Product: Joint Venture for the manufacturing, marketing, deployment and participation in the operation of at least 1,300 of Biosphere...

  10. Notice of Availability of a Preliminary List of Standby Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Testing Guidelines, Federal Register, 66 FR 67517, December 31, 2001 Notice of Availability of a Preliminary List of Standby Power Products and Testing Guidelines, Federal ...

  11. LEDSGP/contacts/AFOLU List Serve | Open Energy Information

    Open Energy Info (EERE)

    LEDSGPcontactsAFOLU List Serve < LEDSGP Jump to: navigation, search LEDS AFOLU Working Group @ Global Environment Centre, 2nd Floor, Wisma Hing, 78, Jalan SS272, 47300 Petaling...

  12. LEDS Collaboration in Action Workshop Attendee List | Open Energy...

    Open Energy Info (EERE)

    LEDS Collaboration in Action Workshop Attendee List (Redirected from LEDS Collaboration in Action Workshop Participating Countries) Jump to: navigation, search Low Emission...

  13. DOE/NSF Nuclear Science Advisory Committee2015 Membership List...

    Office of Science (SC) Website

    DOENSF Nuclear Science Advisory Committee 2015 Membership List Nuclear Science Advisory Committee (NSAC) NSAC Home Meetings NSAC Members ChargesReports Charter .pdf file (78KB) ...

  14. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 Revised "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2006 Revised Under Title I of the Public Utility Regulatory...

  15. Sequoia ranked third in TOP500 list | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    according to the industry-standard Top500 list. Sequoia, which recently completed its transition to classified computing in support of NNSA's Stockpile Stewardship Program,...


    National Nuclear Security Administration (NNSA)

    B, Page 1 SECTION L ATTACHMENT B LISTING OF KEY PERSONNEL TITLE NAME [Note: Add/remove extra rows if needed]

  17. ORIS: the Oak Ridge Imaging System program listings. [Nuclear...

    Office of Scientific and Technical Information (OSTI)

    program listings. Nuclear medicine imaging with rectilinear scanner and gamma camera Citation Details In-Document Search Title: ORIS: the Oak Ridge Imaging System program...

  18. ORIS: the Oak Ridge Imaging System program listings. [Nuclear...

    Office of Scientific and Technical Information (OSTI)

    program listings. Nuclear medicine imaging with rectilinear scanner and gamma camera Bell, P. R.; Dougherty, J. M. 62 RADIOLOGY AND NUCLEAR MEDICINE; 46 INSTRUMENTATION RELATED...

  19. List of Passive Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    Solar Space Heat Incentives Jump to: navigation, search The following contains the list of 282 Passive Solar Space Heat Incentives. CSV (rows 1 - 282) Incentive Incentive Type...

  20. DOE Fuel Cell Pre-Solicitiation Workshop Participants List

    Broader source: [DOE]

    Participants List for DOE Fuel Cell Pre-Solicitiation Workshop - Sheraton Denver West Hotel, 360 Union Boulevard, Lakewood, CO - March 16-17, 2010

  1. List of Publications from the Energy for Development and Poverty...

    Open Energy Info (EERE)

    Publications from the Energy for Development and Poverty Reduction Website Jump to: navigation, search Tool Summary LAUNCH TOOL Name: List of Publications from the Energy for...

  2. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2009 Under Title I, Sec. 102(c) of the Public Utility Regulatory Policies ...

  3. New Mexico Air Operating Permit List of Trivial Activities |...

    Open Energy Info (EERE)

    Operating Permit List of Trivial Activities Author New Mexico Environment Department - Air Quality Bureau Published New Mexico Environment Department - Air Quality Bureau, 2008...

  4. Oregon State Endangered Species List | Open Energy Information

    Open Energy Info (EERE)

    to library Web Site: Oregon State Endangered Species List Author Oregon Department of Fish and Wildlife Published State of Oregon, Date Not Provided DOI Not Provided Check for...

  5. Washington State Species of Concern Lists | Open Energy Information

    Open Energy Info (EERE)

    Web Site: Washington State Species of Concern Lists Author Washington Department of Fish & Wildlife Published State of Washington, Date Not Provided DOI Not Provided Check for...

  6. Plutonium Certified Reference Materials Price List | U.S. DOE...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Plutonium Certified Reference Materials Price List Print Text ...

  7. BLM - Western BLM Bird Species of Conservation Concern List ...

    Open Energy Info (EERE)

    BLM - Western BLM Bird Species of Conservation Concern List Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - Checklist: BLM -...

  8. Part VII: Section J - List of Documents, Exhibits, and Other...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    III SECTION J LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS TABLE OF CONTENTS ......... 55 Attachment J Performance Evaluation And Measurement Plan ...

  9. About the Oil and Gas Field Code Master List

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Information Administration | About the Oil and Gas Field Code Master List 4 Island Harrison Bay 103 Point Hope 205 For State and Federal offshore areas, the following county ...

  10. California Endangered Species Act Species List | Open Energy...

    Open Energy Info (EERE)

    California Endangered Species Act Species List Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: California Endangered Species Act...

  11. Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings

    Broader source: [DOE]

    This document is an attendee list for the public meeting to discuss sustainable design standards for Federal buildings held on July 28, 2010.

  12. Headmark List of Suspect Counterfeit Fasteners 1992 | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Headmark List of Suspect Counterfeit Fasteners 1992 More Documents & Publications SuspectCounterfeit Items Awareness Training Manual National Historic Preservation Act ...

  13. BLM Lists 2011 Priority Renewable Energy Projects | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    priority projects for developing onshore renewable energy on national public lands. The priority list includes nine solar projects, five wind projects, and five geothermal ...

  14. combined_supplemental_hud_multifamily_weatherization_list_3-2...

    Broader source: (indexed) [DOE]

    lihtc.xls More Documents & Publications list2eligiblemultifamilybuildings10-cfr-440-22b4ii.xls rdmfhlowandverylow.xls hudlist-1...

  15. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  16. DOE employee listed among area’s rising leaders

    Broader source: [DOE]

    Earlier this year, the Greater Knoxville Business Journal compiled a list of East Tennessee’s top rising business and community leaders under the age of 40. The 2014 listing featured Heather Cloar, a contacting officer with the Energy Department in Oak Ridge.

  17. Upcoming H2USA Workshop: Hydrogen Fueling Station Component Listings

    Broader source: [DOE]

    H2USA will host an online workshop about hydrogen fueling station component listings on April 22 from 2 to 3:30 p.m. Eastern Daylight Time. This workshop will focus on the need for components for hydrogen fueling stations to be listed by Nationally Recognized Testing Laboratories (NRTLs).

  18. Oil and Gas Field Code Master List - Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    Oil and Gas Field Code Master List With Data for 2015 | Release Date: February 24, 2016 | Next Release Date: February 2017 Previous Issues Year: 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 2004 2003 2002 2001 2000 1998 1997 1996 1995 Go Comprehensive listing of U.S. oil and gas field names. Oil and Gas Field Code Master List 2015 Definition of a Field A field is defined as "an area consisting of a single reservoir or multiple reservoirs all grouped on, or related to, the same

  19. Creating a word list for technical and clerical personnel

    SciTech Connect (OSTI)

    Hammond, J S


    The Savannah River Plant and Laboratory employ more than 16,000 people. When the separate Publications Divisions of the Plant and Laboratory were combined it was determined that a single source of information for using terms was needed, and that the source would take the form of a word list. The Word List was issued to more than 5000 employees onsite. In addition, the Word List is being added to the site computer network as a reference document and as an online spelling checker where more than 2000 employees will have access to it through their personal computers.

  20. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  1. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  2. OpenEI API listing | OpenEI Community

    Open Energy Info (EERE)

    strategy conversation just this week, and we spoke somewhat indirectly about a list of energy APIs on OpenEI. We have the Energy Hackathon Resource page, but I want to draw energy...

  3. Widget:EiJoinList | Open Energy Information

    Open Energy Info (EERE)

    EiJoinList Jump to: navigation, search Description This widget creates a join form on a page. Visitors can fill in the short form and the request will be sent to openei.orgapp...

  4. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2008 Under Title I of the Public Utility Regulatory Policies Act of 1978...

  5. List of Solar Energy Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives Jump to: navigation, search The following contains the list of 1794 Solar Energy Incentives. CSV (rows 1-500) CSV (rows 501-1000) CSV (rows 1001-1500) CSV (rows...

  6. List of Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heat Incentives Jump to: navigation, search The following contains the list of 512 Solar Space Heat Incentives. CSV (rows 1-500) CSV (rows 501-512) Incentive Incentive Type...

  7. List of Companies in Biofuels Sector | Open Energy Information

    Open Energy Info (EERE)

    List of Companies in Biofuels Sector Jump to: navigation, search BiomassImage.JPG Companies in the Biofuels sector: Add a Company Download CSV (rows 1-256) Map of Biofuels...

  8. Title 40 CFR 261 Identification and Listing of Hazardous Waste...

    Open Energy Info (EERE)

    1 Identification and Listing of Hazardous Waste Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Federal RegulationFederal Regulation: Title 40...

  9. Capital Asset Project List_rev1.xls

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by DOE Order 413.3B, Program and Project Management for the Acquisition of Capital Assets. ... Start of Operations or Project Completion Capital Asset Project List 1152016 1 of 1

  10. List of Water Heaters Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heaters Incentives Jump to: navigation, search The following contains the list of 975 Water Heaters Incentives. CSV (rows 1-500) CSV (rows 501-975) Incentive Incentive Type Place...

  11. Fuel Cell Product Certification/Listing Lessons Learned | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Product Certification/Listing Lessons Learned Fuel Cell Product Certification/Listing Lessons Learned Slides from the U.S. Department of Energy Hydrogen Component and System Qualification Workshop held November 4, 2010 in Livermore, CA. PDF icon csqw_radley.pdf More Documents & Publications Component and System Qualification Workshop Proceedings The Fuel Cell Mobile Light Project - A DOE Market Transformation Activity CSA International Certification Discussion Hydrogen Technology

  12. Top 500 List Recognizes Fastest Supercomputers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    00 List Recognizes Fastest Supercomputers Top 500 List Recognizes Fastest Supercomputers June 30, 2014 - 5:25pm Addthis Titan 1 of 4 Titan Oak Ridge National Laboratory's Titan has a theoretical peak performance of more than 27 petaflops, or more than 27 quadrillion calculations per second. This enables researchers across the scientific arena, from materials to climate change to astrophysics, to acquire unparalleled accuracy in their simulations and achieve research breakthroughs more rapidly

  13. Oil and gas field code master list, 1993

    SciTech Connect (OSTI)

    Not Available


    This document contains data collected through October 1993 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. Other Federal and State government agencies, as well as industry, use the EIA Oil and Gas Field Code Master List as the standard for field identification. A machine-readable version of the Oil and Gas Field Code Master List is available from the National Technical Information Service.

  14. POLICY GUIDANCE MEMORANDUM #13 Reemployment Priority List Selections |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Reemployment Priority List Selections POLICY GUIDANCE MEMORANDUM #13 Reemployment Priority List Selections The Department's RPL is designed to provide priority consideration to employees who have lost their jobs through reduction in force, or who have fully recovered from a compensable injury after more than 1 year. Employees may only receive priority consideration for positions that they are well-qualified for and that are in the local commuting area from which

  15. Workshop on Biofuels Projections in AEO Attendance List

    Gasoline and Diesel Fuel Update (EIA)

    Attendance List 1 March 2013 Workshop on Biofuels Projections in AEO Attendee list In person attendees Mia Adelberg Abengoa Bioenergy Michael Bredehoeft EIA Tom Capehart USDA Terry Carter Biofuels Center of North Carolina Adam Christensen Johns Hopkins University Michael Cole EIA John Conti EIA Lauren Cooper Center for Climate and Energy Solutions Mindi Farber-DeAnda EIA Denise Gerber Fiberight Steve Gerber Fiberight Ryan Graf Policy Navigation Group David L. Greene Oak Ridge National Laboratory

  16. HUD Multifamily Property Listings Eligible for Weatherization Assistance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy HUD Multifamily Property Listings Eligible for Weatherization Assistance HUD Multifamily Property Listings Eligible for Weatherization Assistance February 23, 2016 - 4:29pm Addthis Housing and Urban Development (HUD) multifamily properties eligible for weatherization assistance. On January 25, 2010, the Department of Energy (DOE) implemented rule 71-CFR-3847 for its Weatherization Assistance Program (WAP). Under the rule, if a public housing, assisted multi-family or Low

  17. BPA-2011-01001-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    record, telephone messages, voice-mails or other sound recordings, notes of personal conferences, telephone conversations or personal meetings. It also includes...

  18. updated_supplemental_lists_1e-2e_20110803.xls | Department of Energy

    Energy Savers [EERE]

    e-2e_20110803.xls updated_supplemental_lists_1e-2e_20110803.xls Office spreadsheet icon updated_supplemental_lists_1e-2e_20110803.xls More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx supplemental_lists.xls

  19. Oil and gas field code master list 1997

    SciTech Connect (OSTI)


    The Oil and Gas Field Code Master List 1997 is the sixteenth annual listing of all identified oil and gas fields in the US. It is updated with field information collected through October 1997. The purpose of this publication is to provide unique, standardized codes for identification of domestic fields. Use of these field codes fosters consistency of field identification by government and industry. As a result of their widespread adoption they have in effect become a national standard. The use of field names and codes listed in this publication is required on survey forms and other reports regarding field-specific data collected by EIA. There are 58,366 field records in this year`s FCML, 437 more than last year. The FCML includes: field records for each State and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides; field records for each alias field name (definition of alias is listed); fields crossing State boundaries that may be assigned different names by the respective State naming authorities. This report also contains an Invalid Field Record List of 4 records that have been removed from the FCML since last year`s report. These records were found to be either technically incorrect or to represent field names which were never recognized by State naming authorities.

  20. ORISE Contract, SECTION J - List of Documents, Exhibits, and Other Attachments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PART III LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J - LIST OF ATTACHMENTS J.1 LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS (MAY 1997)...................................................................................................................... 3 ATTACHMENT A - REPORTING REQUIREMENTS............................................. 5 ATTACHMENT B - GOVERNMENT FURNISHED AND ACQUIRED PROPERTY

  1. List 1: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(i)

    Broader source: [DOE]

    HUD list of multifamily housing units eligible for weatherization that have three or more years remaining on HUD housing contracts.  As of December 2014. List 1 consists of three sub-lists:

  2. DOE-STD-1104-2014 Master Acronym List | Department of Energy

    Energy Savers [EERE]

    Master Acronym List DOE-STD-1104-2014 Master Acronym List February 4, 2015 DOE-STD-1104 Master Acronyms List. This document provides a Master Acronyms List of terms used in DOE-STD-1104. PDF icon DOE-STD-1104-2014 Master Acronym List More Documents & Publications DOE-STD-1104-2014 Training Requirements Crosswalk of DOE-STD-1104-2014 Master Acronym List for DOE-STD-3009-2014

  3. Oil and Gas Field Code Master List 1990

    SciTech Connect (OSTI)

    Not Available


    This is the ninth annual edition of the Energy Information Administration's (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1990 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. There are 54,963 field records in this year's Oil and Gas Field Code Master List (FCML). This amounts to 467 more than in last year's report. As it is maintained by EIA, the Master List includes: Field records for each state and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides;field records for each alias field name; fields crossing state boundaries that may be assigned different names by the respective state naming authorities.

  4. Oil and gas field code master list 1994

    SciTech Connect (OSTI)

    Not Available


    This is the thirteenth annual edition of the Energy Information Administration`s (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1994 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. The master field name spellings and codes are to be used by respondents when filing the following Department of Energy (DOE) forms: Form EIA-23, {open_quotes}Annual Survey of Domestic Oil and Gas Reserves,{close_quotes} filed by oil and gas well operators (field codes are required from larger operators only); Forms FERC 8 and EIA-191, {open_quotes}Underground Gas Storage Report,{close_quotes} filed by natural gas producers and distributors who operate underground natural gas storage facilities. Other Federal and State government agencies, as well as industry, use the EIA Oil and Gas Field Code Master List as the standard for field identification. A machine-readable version of the Oil and Gas Field Code Master List is available from the National Technical Information Service, 5285 Port Royal Road, Springfield, Virginia 22161, (703) 487-4650. In order for the Master List to be useful, it must be accurate and remain current. To accomplish this, EIA constantly reviews and revises this list. The EIA welcomes all comments, corrections, and additions to the Master List. All such information should be given to the EIA Field Code Coordinator at (214) 953-1858. EIA gratefully acknowledges the assistance provides by numerous State organizations and trade associations in verifying the existence of fields and their official nomenclature.

  5. WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings...

    Energy Savers [EERE]

    9: Updated Guidance on Eligible Multifamily Property Listings for Use in the Weatherization Assistance Program WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings...

  6. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 GOVERNMENT FURNISHED PROPERTY AND INFORMATION LIST * Government Furnished Property and Information List is subject to change prior to period of performance.

  7. Green your Back to School Shopping List! | Department of Energy

    Energy Savers [EERE]

    your Back to School Shopping List! Green your Back to School Shopping List! August 23, 2013 - 10:06am Addthis Save energy and money while buying school supplies this year. | Photo courtesy of ©iStockphoto/Ls9907 Save energy and money while buying school supplies this year. | Photo courtesy of ©iStockphoto/Ls9907 Agatha Wein Communications Specialist, State Energy Program How can I participate? You can save energy and money this fall by simply reducing, reusing, and recycling school supplies.

  8. DOE technical standards list: Department of Energy standards index

    SciTech Connect (OSTI)


    This technical standards list (TSL) was prepared for use by personnel involved in the selection and use of US DOE technical standards and other government and non-government standards. This TSL provides listings of current DOE technical standards, non-government standards that have been adopted by DOE, other government documents in which DOE has a recorded interest, and cancelled DOE technical standards. Standards are indexed by type in the appendices to this document. Definitions of and general guidance for the use of standards are also provided.

  9. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    Updated 9/30/15 to Mod 0588 Contract No. DE-AC04-94AL85000 Modification No. M202 Section J - Page 1 Part III - List of Documents, Exhibits, and Other Attachments Section J LIST OF ATTACHMENTS Document Appendix A - Personnel Appendix (Revised RAs 1-12 and Mods M0541, M0558) Appendix B - Statement of Work (Revised M244, M264) Appendix C - Special Bank Account Agreement (Revised M248, M271, M461, M497, M508) Appendix D - Key Personnel (Revised M216, M224, M227, M229, M233, M252, M257, M272, M275,

  10. Computerized Instrumented Residential Audit, version 1. 0: source listings

    SciTech Connect (OSTI)

    Not Available


    CIRA is a set of computer programs to predict the energy consumption of small buildings. It can also provide an optimized list of improvements which reduce energy use. The source code in BASIC is provided to help a user adapt the program to a particular application, or to see details of the calculation algorithms. (LEW)

  11. Implementation plan for HANDI 2000 TWRS master equipment list

    SciTech Connect (OSTI)



    This document presents the implementation plan for an additional deliverable of the HANDI 2000 Project. The PassPort Equipment Data module processes include those portions of the COTS PassPort system required to support tracking and management of the Master Equipment List for Lockheed Martin Hanford Company (LMHC) and custom software created to work with the COTS products.

  12. Oil and Gas field code master list 1995

    SciTech Connect (OSTI)


    This is the fourteenth annual edition of the Energy Information Administration`s (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1995 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the US. The Field Code Index, a listing of all field names and the States in which they occur, ordered by field code, has been removed from this year`s publications to reduce printing and postage costs. Complete copies (including the Field Code Index) will be available on the EIA CD-ROM and the EIA World-Wide Web Site. Future editions of the complete Master List will be available on CD-ROM and other electronic media. There are 57,400 field records in this year`s Oil and Gas Field Code Master List. As it is maintained by EIA, the Master List includes the following: field records for each State and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides; field records for each alias field name (see definition of alias below); and fields crossing State boundaries that may be assigned different names by the respective State naming authorities. Taking into consideration the double-counting of fields under such circumstances, EIA identifies 46,312 distinct fields in the US as of October 1995. This count includes fields that no longer produce oil or gas, and 383 fields used in whole or in part for oil or gas Storage. 11 figs., 6 tabs.

  13. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  14. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  15. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  16. Nestor J. Zaluzec | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nestor J. Zaluzec Senior Materials Scientist Telephone 630.252.4798 E-mail zaluzec@aaem.amc

  17. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  18. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  19. Stuart Feinberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ES&H/QA Coordinator Stuart Feinberg Telephone 630.252.4673 E-mail

  20. Scott Massow | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Massow Assistant Facility Manager Telephone 630.252.4620 E-mail

  1. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  2. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  3. Anthony Avarca | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anthony Avarca Systems Administrator Sr. Telephone 630.252.4940 E-mail

  4. combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls |

    Energy Savers [EERE]

    Department of Energy combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls Office spreadsheet icon combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls More Documents & Publications list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls rd_mfh_low_and_very_low.xls hud_list-1

  5. updated_supplemental_lists_1o_2o_3n_091812.xlsx | Department of Energy

    Energy Savers [EERE]

    o_2o_3n_091812.xlsx updated_supplemental_lists_1o_2o_3n_091812.xlsx File updated_supplemental_lists_1o_2o_3n_091812.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013

  6. updated_supplemental_lists_1p_2p_3o_04302013.xlsx | Department of Energy

    Energy Savers [EERE]

    p_2p_3o_04302013.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx File updated_supplemental_lists_1p_2p_3o_04302013.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011

  7. hud_list-1_07-01-11.xls | Department of Energy

    Energy Savers [EERE]

    1_07-01-11.xls hud_list-1_07-01-11.xls Office spreadsheet icon hud_list-1_07-01-11.xls More Documents & Publications hud_list-1_07-01-11.xls list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii)

  8. hud_list-2_07-01-11.xls | Department of Energy

    Energy Savers [EERE]

    2_07-01-11.xls hud_list-2_07-01-11.xls Office spreadsheet icon hud_list-2_07-01-11.xls More Documents & Publications hud_list-2_07-01-11.xls supplemental_lists_1d-2d-3c_06-24-2011.xls updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx

  9. DOE technical standards list: Department of Energy standards index

    SciTech Connect (OSTI)


    This Department of Energy (DOE) technical standards list (TSL) has been prepared by the Office of Nuclear Safety Policy and Standards (EH-31) on the basis of currently available technical information. Periodic updates of this TSL will be issued as additional information is received on standardization documents being issued, adopted, or canceled by DOE. This document was prepared for use by personnel involved in the selection and use of DOE technical standards and other Government and non-Government standards. This TSL provides listings of current DOE technical standards, non-Government standards that have been adopted by DOE, other standards-related documents in which DOE has a recorded interest, and canceled DOE technical standards. Information on new DOE technical standards projects, technical standards released for coordination, recently published DOE technical standards, and activities of non-Government standards bodies that may be of interest to DOE is published monthly in Standards Actions.


    National Nuclear Security Administration (NNSA)

    N, Page 1 SECTION J APPENDIX N LIST OF APPLICABLE DIRECTIVES 09/17/2014 Directive Directive Title 10 CFR 824, Current Rule Procedural Rules for the Assessment of Civil Penalties for Classified Information Security Violations 10 CFR 830 - Current Rule Nuclear Safety Management 10 CFR 851 - Current Rule Worker Safety and Health Program ANSI B30.11 Monorails and Underhung Hoists ANSI N323A Radiation Protection Instrumentation Test and Calibration Portable Survey Instrumentation, 1997 ANSI N43.2

  11. 309 Facility deactivation and decommisioning Criteria Completion Check Lists

    SciTech Connect (OSTI)

    Cornwell, B.C.


    To facilitate and track completion of the 309 Facility turnover criteria completion an Applicability Matrix and Criteria Completion Check Lists were prepared. The applicability matrix documents the required turnover criteria for a given area in the facility or scope of work. The applicable criteria is selected for 16 different areas. For each area a completion checklist is provided to document completion of a requirement by WHC and the Environmental Restoration Contractor.

  12. Attachment 2 … List of Major Information Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exhibit 1 - List of Major Information Systems Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear Security Administration ADaPT Network Infrastructure: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. Advanced Simulation and

  13. National Nuclear Security Administration Supplemental Listing of Directives

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration Supplemental Listing of Directives Affecting Nuclear Safety Requirements Last Updated 06/2014 U.S. DEPARTMENT OF ENERGY National Nuclear Security Administration Office of the Chief of Defense Nuclear Safety AVAILABLE ONLINE AT: link to NNSA Policies/Supplemental Directives Updated 6/10/14 This Page Intentionally Blank. Concurrence on Exemptions or Exceptions Page 1 ADDITIONAL DIRECTIVES (LATEST VERSION) REQUIRING CENTRAL TECHNICAL


    National Nuclear Security Administration (NNSA)

    .I APPENDIXN DE-NA0000622 LIST OF APPLICABLE DIRECTIVES 09/17/2014 Directive Directive Title 10 CFR 824, Current Rule Procedural Rules for the Assessment of Civil Penalties for Classified Information Security Violations 1 O CFR 830 - Current Rule Nuclear Safety Management 1 O CFR 851 - Current Rule Worker Safety and Health Program ANSI B30.11 Monorails and Underhung Hoists ANSI N323A Radiation Protection Instrumentation Test and Calibration Portable Survey Instrumentation, 1997 ANSI N43.2

  15. Draft SPD Supplemental EIS Master Reference List | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Draft SPD Supplemental EIS Master Reference List References for Chapters 1 - 5 References for Appendix A References for Appendix B References for Appendix C References for Appendix D References for Appendix E References for Appendix F References for Appendix G References for Appendix H References for Appendix I References for Appendix J References for Summary Learn More SPD SEIS References for Appendix J SPD SEIS Summary References SPD SEIS References for Chapters 1 -

  16. EV Everywhere Grand Challenge - Battery Workshop attendees list |

    Broader source: (indexed) [DOE]

    Department of Energy Attendance list for the EV Everywhere Grand Challenge: Battery Workshop on July 26, 2012 held at the Doubletree OHare, Chicago, IL. PDF icon companies_in_attendance_b.pdf More Documents & Publications EV Everywhere Grand Challenge - Electric Drive (Power Electronics and Electric Machines) Workshop EV Everywhere Grand Challenge Overview EV Everywhere Grand Challenge Introduction for Electric Drive Workshop

  17. A Prescription for List-Mode Data Processing Conventions

    SciTech Connect (OSTI)

    Beddingfield, David H.; Swinhoe, Martyn Thomas; Huszti, Jozsef; Newell, Matthew R.


    There are a variety of algorithmic approaches available to process list-mode pulse streams to produce multiplicity histograms for subsequent analysis. In the development of the INCC v6.0 code to include the processing of this data format, we have noted inconsistencies in the “processed time” between the various approaches. The processed time, tp, is the time interval over which the recorded pulses are analyzed to construct multiplicity histograms. This is the time interval that is used to convert measured counts into count rates. The observed inconsistencies in tp impact the reported count rate information and the determination of the error-values associated with the derived singles, doubles, and triples counting rates. This issue is particularly important in low count-rate environments. In this report we will present a prescription for the processing of list-mode counting data that produces values that are both correct and consistent with traditional shift-register technologies. It is our objective to define conventions for list mode data processing to ensure that the results are physically valid and numerically aligned with the results from shift-register electronics.

  18. Automatic generation of stop word lists for information retrieval and analysis

    DOE Patents [OSTI]

    Rose, Stuart J


    Methods and systems for automatically generating lists of stop words for information retrieval and analysis. Generation of the stop words can include providing a corpus of documents and a plurality of keywords. From the corpus of documents, a term list of all terms is constructed and both a keyword adjacency frequency and a keyword frequency are determined. If a ratio of the keyword adjacency frequency to the keyword frequency for a particular term on the term list is less than a predetermined value, then that term is excluded from the term list. The resulting term list is truncated based on predetermined criteria to form a stop word list.

  19. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to Need to change OPMO contact (i.e., e-mail, name, telephone ...

  20. Hanford Site Chronic Beryllium Disease Prevention Program (CBDPP) Contact List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chronic Beryllium Disease Prevention Program (CBDPP) Contact List Page 1 of 2 Updated 12/09/15 Primary and Alternate Membership Organization Primary Office Number Cell Number Alternate Office Number Cell Number BAG Fisher, Mark N/A 539-5588 VACANT N/A CHPRC/HAMTC Spier, Tracy 373-1993 440-9118 Hollis, Chris 373-9973 (509) 701-1025 CHPRC Bean, Tonya 376-6503 (303) 709-3047 Robinson, Roby Seydel, Scott (509) 699-9307 373-4860 (509) 699-9307 430-0184 CWB&CTC Park, Rick 372-9941 492-6589 Legard,

  1. Attachment P … Listing of SWMUs and AOCs

    Office of Environmental Management (EM)

    LISTING OF SWMUS AND AOCS Los Alamos National Laboratory Hazardous Waste Permit February2014 Table K-1 SWMUs and AOCs Requiring Corrective Action Attachment K Page 2 Los Alamos National Laboratory Hazardous Waste Permit February 2014 Table K-1 SWMUs and AOCs Requiring Corrective Action SWMU/AOC Unit # Unit Type TA-0 SWMU 00-001 Sediment traps in Mortandad Canyon SWMU 00-011(a) Former Mortar impact area SWMU 00-011(c) Mortar impact area SWMU 00-011(d) Mortar impact area SWMU 00-011(e) Mortar

  2. DOE technical standards list. Department of Energy standards index

    SciTech Connect (OSTI)


    This document was prepared for use by personnel involved in the selection and use of DOE technical standards and other Government and non-Government standards. This TSL provides listing of current DOE technical standards, non-Government standards that have been adopted by DOE, other Government documents in which DOE has a recorded interest, and canceled DOE technical standards. Information on new DOE technical standards projects, technical standards released for coordination, recently published DOE technical standards, and activities of non-Government standards bodies that may be of interest to DOE is published monthly in Standards Actions.

  3. TPA PM List of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OPERABLE UNITS PROJECT MANAGERS LIST AS OF SEPTEMBER 30, 2015 Prepared By MSA TPA Integration TSD NO. Description Ecology PM DOE PM Assistant Manager Status Lead Regulatory Agency D-1-2 1301-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-1-2 1325-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-2-10 216-A-37-1 Crib Menard, N. Cline, M.W. Corey, R. J. Interim Ecology Lead D-2-11 Integrated Disposal Facility

  4. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    25 Page 2 of 2 Prime Contract Section J, Appendix G, List of Applicable Directives, is modified as follows: The following Directives are added: NUMBER DATE TITLE NNSA SD 452.2 11/17/14 Nuclear Explosive Safety Evaluation Processes DOE O 452.1E 01/26/15 Nuclear Explosive and Weapon Surety Program DOE O 452.2E 01/26/15 Nuclear Explosive Safety DOE O 474.2 Change 3 05/15/15 Nuclear Material Control and Accountability The following Directives are deleted: NUMBER DATE TITLE DOE M 452.2-2 04/14/09

  5. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    15 Page 2 of 2 Prime Contract Section J, Appendix G, List of Applicable Directives, is modified as follows: The following Directives are added: NUMBER DATE TITLE DOE O 458.1 Change 3 01/15/13 Radiation Protection of the Public and the Environment DOE O 470.5 06/02/14 Insider Threat DOE O 475.2B 10/03/14 Identifying Classified Information NNSA SD 1027 Change Notice 1 05/13/14 Guidance of Using Release Fraction and Modern Dosimetric Information Consistently with DOE STD 1027-92 The following

  6. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  7. Participant List for the 2010-2025 Scenario Analysis for Hydrogen...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Participant List for the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure Meeting on January 31, 2007 Participant List for the 2010-2025 Scenario ...

  8. Attendees list from the U.S. Department of Energy's High Throughput...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of ...

  9. Booklet, DOE Subject Area Indicators and Key Word List for RD...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 October ...

  10. DOE Refers Two ENERGY STAR Models to EPA for Potential De-Listing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Two ENERGY STAR Models to EPA for Potential De-Listing DOE Refers Two ENERGY STAR Models to EPA for Potential De-Listing January 11, 2012 - 11:00am Addthis U.S. Department of...

  11. File:Temporary storage plan review check list.pdf | Open Energy...

    Open Energy Info (EERE)

    Temporary storage plan review check list.pdf Jump to: navigation, search File File history File usage File:Temporary storage plan review check list.pdf Size of this preview: 463 ...

  12. hud_list-1_07-01-11.xls | Department of Energy

    Broader source: (indexed) [DOE]

    list-107-01-11.xls More Documents & Publications hudlist-107-01-11.xls list2eligiblemultifamilybuildings10-cfr-440-22b4ii.xls rdmfhlowandverylow...

  13. 2015 U.S. Department of Energy National Cleanup Workshop Registration List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy 5 U.S. Department of Energy National Cleanup Workshop Registration List 2015 U.S. Department of Energy National Cleanup Workshop Registration List List of registered attendees to the 2015 U.S. Department of Energy National Cleanup Workshop. PDF icon 2015 U.S. Department of Energy National Cleanup Workshop Registration List More Documents & Publications Business Opportunity Forum Attendees EM Major Contracts Awarded Since 2006 Contractor Earned Value Management

  14. Energy education resources: Kindergarten through 12th grade

    SciTech Connect (OSTI)


    Energy Education Resources: Kindergarten Through 12th Grade is published by the National Energy Information Center (NEIC) a service of the Energy Information Administration (EIA), to provide students, educators, and other information users, a list of generally available free or low-cost energy-related educational materials. Each entry includes the address, telephone number, and description of the organization and the energy-related materials available. Most of the entries also include Internet (Web) and electronic mail (E-Mail) addresses. Each entry is followed by a number, which is referenced in the subject index in the back of this book.

  15. TPA PM List of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Manager's List As of September 30, 2015 Prepared by MSA TPA Integration Milestone EPA PM Ecology PM DOE PM Assistant Manager Lead Regulatory Agency (See Footnote) Type Milestone Title M-015-00 Cameron, C.E. Menard, N. Cline, M.W. Corey, R. J. EPA//Ecology Dual Lead M Complete The RI/FS (Or RFI/CMS) Process For All Non-Tank Farm OUs M-015-110A Cameron, C.E. Goswami D. Cline, M.W. Corey, R. J. Ecology Lead I Submit RCRA FI/CMS & RI/FS Work Plan for 200-DV-1 OU M-015-110B Cameron, C.E.

  16. Explanation of Publication List V7[1][1][2]

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MI-648497 *This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344. Explanation o f L ist o f NIF & P S D irectorate R elated P ublications The list c ontains only r efereed j ournal a rticles t hat h ave a t l east o ne a uthor w ho i s a N IF & P S D irectorate T eam M ember. T eam M embers i nclude D irectorate s taff p lus collaborators who a re o n a l ist m aintained by the NIF User Office.

  17. Energy & Manufacturing Workforce Training Topics List - Version 1.7

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (02.11.14) | Department of Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) View this searchable list of the training programs in the areas of energy and/or manufacturing. Information provided in this list includes: the subjects being taught, grantee, project title, and state. In some cases the list also shows the certificates provided by the courses. File Energy and

  18. supplemental_lists_1d-2d-3c_06-24-2011.xls | Department of Energy

    Energy Savers [EERE]

    lists_1d-2d-3c_06-24-2011.xls supplemental_lists_1d-2d-3c_06-24-2011.xls Office spreadsheet icon supplemental_lists_1d-2d-3c_06-24-2011.xls More Documents & Publications hud_list-2_07-01-11.xls hud_list-2_07-01-11.xls updated_supplemental_lists_1g-2g-3f_10-6-2011

  19. Safety equipment list for the light duty utility arm system

    SciTech Connect (OSTI)

    Barnes, G.A.


    The initial issue (Revision 0) of this Safety Equipment List (SEL) for the Light Duty Utility Arm (LDUA) requires an explanation for both its existence and its being what it is. All LDUA documentation leading up to creation of this SEL, and the SEL itself, is predicated on the LDUA only being approved for use in waste tanks designated as Facility Group 3, i.e., it is not approved for use in Facility Group 1 or 2 waste tanks. Facility Group 3 tanks are those in which a spontaneous or induced hydrogen gas release would be small, localized, and would not exceed 25% of the LFL when mixed with the remaining air volume in the dome space; exceeding these parameters is considered unlikely. Thus, from a NFPA flammable gas environment perspective the waste tank interior is not classified as a hazardous location. Furthermore, a hazards identification and evaluation (HNF-SD-WM-HIE-010, REV 0) performed for the LDUA system concluded that the consequences of actual LDUA system postulated accidents in Flammable Gas Facility Group 3 waste tanks would have either NO IMPACT or LOW IMPACT on the offsite public and onsite worker. Therefore, from a flammable gas perspective, there is not a rationale for classifying any of SSCs associated with the LDUA as either Safety Class (SC) or Safety Significant (SS) SSCs, which, by default, categorizes them as General Service (GS) SSCs. It follows then, based on current PHMC procedures (HNF-PRO-704 and HNF-IP-0842, Vol IV, Section 5.2) for SEL creation and content, and from a flammable gas perspective, that an SEL is NOT REQ@D HOWEVER!!! There is both a precedent and a prudency to capture all SSCS, which although GS, contribute to a Defense-In-Depth (DID) approach to the design and use of equipment in potentially flammable gas environments. This Revision 0 of the LDUA SEL has been created to capture these SSCs and they are designated as GS-DID in this document. The specific reasons for doing this are listed.

  20. STIP Community Listing | OSTI, US Dept of Energy, Office of Scientific and

    Office of Scientific and Technical Information (OSTI)

    Technical Information STIP Community Listing This page lists various groups and group members within the STIP community. Note: An alphabetical list can be downloaded as an MS-Excel compatible file. Or, you can also view this page in print mode. STI Managers Location Name Contact Ames Laboratory Beth Pieper Program Coordinator, Office of Sponsored Research Administration (515) 294-6486 Argonne National Laboratory Yvette Woell Manager, Argonne Research Library (630) 252-4275

  1. Building America List of FY14 by Technology Type | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    List of FY14 by Technology Type Building America List of FY14 by Technology Type This table lists U.S. Department of Energy Building America projects for FY14 by technology type. PDF icon building_america_fy14projects_technology.pdf More Documents & Publications Building America FY14 Research Projects by Research Team Building America FY14 Projects by Building

  2. EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List |

    Energy Savers [EERE]

    Department of Energy 10-07C/SEP 10-006B Attachment 1: Process Metrics List EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List PDF icon eecbg_sep_reporting_guidance_attachment_06242011.pdf More Documents & Publications EECBG SEP Attachment 1 - Process metric list EECBG Program Notice 10-07A DOE Recovery Act Reporting Requirements for the State Energy Program

  3. Attendees list from the U.S. Department of Energy's High Throughput

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Screening of Hydrogen Storage Materials Workshop on June 26, 2007 | Department of Energy Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of Energy's Hydrogen Storage Meeting held June 26, 2007 in Bethesda, Maryland. PDF icon

  4. List of Topics for Interagency Performance & Risk Assessment Community of

    Energy Savers [EERE]

    Practice (P&RA CoP) Discussion | Department of Energy List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion PDF icon List of Topics - February 24, 2016 More Documents & Publications Status Updates on the

  5. Question of the Week: What Energy-Saving Improvements are on Your To-Do List?

    Broader source: [DOE]

    For most people, improving the efficiency of their home is a process. So tell us what energy-saving improvements are on your to-do list?

  6. DE-SOL-0002555 WIPP Solicitation J-23 PART III - LIST OF DOCUMENTS...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  7. RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA

    Broader source: [DOE]

    Energy Efficiency and Renewable Energy (EERE) is compiling a Teaming Partner List to facilitate the formation of new project teams for the anticipated Buildings Energy Efficiency Frontiers &...

  8. NE-23 List of California Sites Hattie Carwell. SAN/NSQA Division

    Office of Legacy Management (LM)

    SANNSQA Division Attached for your information is the list Of Callfornia sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites ...

  9. Microsoft Word - Attachment J-6 List of Applicable DOE Directives and COntractor Requirements Documents.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    J-6-1 ATTACHMENT J.6 LIST OF APPLICABLE DOE DIRECTIVES AND CONTRACTOR REQUIREMENTS DOCUMENTS (LIST B) The following is a list of applicable DOE Directives and Orders appended to this Contract as prescribed in Section I, Clause I.3. This list is not all inclusive. Document Number Title CRD O 150.1 Continuity Programs CRD O 205.1b, Chg.3 DOE Cyber Program CRD O 206.1 DOE Privacy Program CRD O 243.1B, Admin. Chg 1. Records Management Program CRD O 414.1D, Admin Chg 1. Quality Assurance CRD O

  10. Domestic Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Domestic Price List Print Text Size: A A A FeedbackShare Page ...

  11. Uranium Certified Reference Materials Price List | U.S. DOE Office...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Uranium Certified Reference Materials Price List Print Text Size: ...

  12. International Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates International Price List Print Text Size: A A A FeedbackShare Page ...

  13. Uranium and Thorium Ores Price List | U.S. DOE Office of Science...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Uranium and Thorium Ores Price List Print Text Size: A A A ...

  14. Copy of FINAL SG Demo Project List 11 13 09-External.xls | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of FINAL SG Demo Project List 11 13 09-External.xls More Documents & Publications Smart Grid Regional and Energy Storage Demonstration Projects: Awards Energy Storage Activities...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  16. Listing of awardee names: Active awards as of October 5, 1994

    SciTech Connect (OSTI)

    Not Available


    This is a listing of awarded active contracts for all US DOE facilities and projects. The information contained in the list includes the awardee name and division responsible for the work, BIN, completion date, a one line description of the work, the vendor ID, city, state, congressional district, the value of the contract and the amount of funds expended to date.

  17. Guidance document publications list - Office of Environmental Policy and Assistance RCRA/CERCLA Division (EH-413)

    SciTech Connect (OSTI)


    This document provides a listing of Guidance Documents from the RCRA/CERCLA Division for August 1995. Documents are listed under the following categories: RCRA Guidance Manuals; RCRA Information Briefs; CERCLA Guidance Manuals; CERCLA Regulatory Bulletins; RCRA/CERCLA Guidance Manuals; TSCA Guidance Manuals; TSCA Information Briefs; and, Cross Cut Manuals.

  18. update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls | Department

    Energy Savers [EERE]

    of Energy update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls Office spreadsheet icon update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls More Documents & Publications List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii) updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  20. "List of Covered Electric Utilities" under the Public Utility

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regulatory Policies Act of 1978 (PURPA) - 2008 | Department of Energy 8 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2008 Under Title I of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility. PDF icon "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) More

  1. EM Makes Progress on GAO High-Risk List | Department of Energy

    Office of Environmental Management (EM)

    Makes Progress on GAO High-Risk List EM Makes Progress on GAO High-Risk List February 14, 2013 - 12:00pm Addthis WASHINGTON, D.C. - The U.S. Government Accountability Office (GAO) has removed EM capital asset projects of $750 million or less from its high-risk list because of the nuclear cleanup program's progress in completing that work. "This is good news for EM because it marks an important step in our contract and project management improvement strategy," Senior Advisor for

  2. [Placeholder for opening paragraph/description of PM Group and a list of members]

    Energy Savers [EERE]

    March 20, 2015 VIA E-MAIL Ms. Brenda Edwards U.S. Department of Energy Building Technologies Program Mailstop EE-5B 1000 Independence Avenue, SW Washington, DC 20585-0121 RE: American Gas Association Requests Opportunity to Speak at March 27 Public Meeting (Docket No. EERE-2014-BT-STD-0031/RIN 1904-AD20) Pursuant to the Department of Energy's (DOE) Notice of Proposed Rulemaking and Announcement of Public Meeting regarding Energy Conservation Standards for Residential Furnaces, 80 Fed. Reg. 13120

  3. Microsoft Word - Contact List Template 11-5-14- ali notes.doc

    National Nuclear Security Administration (NNSA)

    Operations E-Mail: Unclassified Fax: 301-903-1998 NMMSS Points-of-Contact for Assistance Name Topic Phone Email Address Karen Antizzo IAEA Reporting General Data Submission Custom Report Requests (301) 903-0872 John Ballard DOE/NNSA Reconciliation Training (301) 903-0092 Elaine Beacom International Reporting (Import/Export) (301) 903-1328 Carl Berger Special Requests and

  4. Fact #651: November 29, 2010 Hybrid Vehicles Dominate EPA's Top Ten Fuel Sippers List for 2011

    Broader source: [DOE]

    Each year, the Environmental Protection Agency (EPA) produces a list of the top ten most fuel efficient vehicles for the model year. In past years, it was the small, lightweight vehicles that...

  5. Minnesota Member Lists the Twin Cities’ First Energy Fit Certified Home

    Broader source: [DOE]

    A home purchased and upgraded by Better Buildings Residential Network member the Center for Energy and Environment (CEE) made headlines as the first “Energy Fit” certified home listed on the...

  6. Department of Energy listing of awardee names active awards as of January 6, 1994

    SciTech Connect (OSTI)

    Not Available


    The awards are listed according to awardee name, bin, completion date, description of work, division, vendor ID, city, state, congressional district, contract value, obligations to date, and P/S.

  7. NMAC 19.33.6 List of Endangered and Threatened Species | Open...

    Open Energy Info (EERE)

    Abstract This regulation provides a list of threatened and endangered species in New Mexico. Published NA Year Signed or Took Effect 2000 Legal Citation NMAC 19.33.6 DOI Not...

  8. Energy Efficiency Can Be at the Top of Your Shopping List | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    list, too. Plug-in hybrid - Electric cars with some serious potential, the lithium ion battery-powered go-getters should be available next year or in 2011, including ones from...

  9. Program listing for heat-pump seasonal-performance model (SPM). [CNHSPM

    SciTech Connect (OSTI)

    Not Available


    The computer program CNHSPM is listed which predicts heat pump seasonal energy consumption (including defrost, cyclic degradation, and supplementary heat) using steady state rating point performance and binned weather data. (LEW)

  10. U.A.C. R315-2: General Requirements - Identification and Listing...

    Open Energy Info (EERE)

    U.A.C. R315-2: General Requirements - Identification and Listing of Hazardous Waste Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document-...

  11. Looking for a way to find utilites per zip code (a list?) | OpenEI...

    Open Energy Info (EERE)

    you head of time. Submitted by Caniemeyer on 1 July, 2013 - 13:55 1 answer Points: 0 Hello- Yes, there is indeed a dataset that lists utilities by zip-code. It can be found on...

  12. List of Attendees at the Controlled Hydrogen Fleet and Infrastructure Demonstation and Pre-Solicitation Meeting

    Broader source: [DOE]

    This list of attendees represents those that attended the Controlled Hydrogen Fleet and Infrastructure Demonstation and Pre-Solicitation Meeting pre-solicitation meeting in Detroit, Michigan, on March 19, 2003.

  13. Laser Incident Lessons Learned and Action List (Technical Report) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Laser Incident Lessons Learned and Action List Citation Details In-Document Search Title: Laser Incident Lessons Learned and Action List × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this document is also available for

  14. Two NREL Scientists Named to Highly Cited Researcher List - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Two NREL Scientists Named to Highly Cited Researcher List Federal Labs Consortium recognizes NREL Education Programs Manager August 6, 2014 Photos of Art Nozik (left) and Keith Emery (right) Two scientists at the Energy Department's National Renewable Energy Laboratory, Art Nozik (left) and Keith Emery (right) were selected from a group of about 200 researchers globally in each of their fields-chemistry and engineering, respectively-for inclusion in the Highly Cited Researchers list.

  15. NAMII in the Top Ten Innovations to Watch List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAMII in the Top Ten Innovations to Watch List NAMII in the Top Ten Innovations to Watch List October 10, 2013 - 12:04pm Addthis A 3D printer at NAMII's facility in Youngstown, Ohio. Photo credit: National Additive Manufacturing Innovation Institute. A 3D printer at NAMII's facility in Youngstown, Ohio. Photo credit: National Additive Manufacturing Innovation Institute. Additive manufacturing is making a big impression and the National Additive Manufacturing Innovation Institute (NAMII) is right

  16. "List of Covered Electric Utilities" under the Public Utility

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regulatory Policies Act of 1978 (PURPA) - 2006 Revised | Department of Energy 6 Revised "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2006 Revised Under Title I of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility.

  17. "List of Covered Electric Utilities" under the Public Utility Regulatory

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Policies Act of 1978 (PURPA) - 2009 | Department of Energy 9 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2009 Under Title I, Sec. 102(c) of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility

  18. NE-23 List of California Sites Hattie Carwell. SAN/NSQA Division

    Office of Legacy Management (LM)

    Hattie Carwell. SAN/NSQA Division Attached for your information is the list Of Callfornia sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites Remedial Action Program (FUSRAP). None of the facilities listed qualified for FUSRAP. The only site in California that was included in FUSRAP was Gilman Hall on the University of California-Berkeley Campus. All California sites that are in our Surplus Facilities Management Program are under San Francisco

  19. NE-23 List of California Sites NE-23 Hattie Car-well, SAN/NSQA Division

    Office of Legacy Management (LM)

    NE-23 Hattie Car-well, SAN/NSQA Division Attached for your information is the list of California sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites Remedial Action Program (FUSRAP). None of the facilities listed qualified"fbr'FUSRAP:'~- The only site in California,that was included in FUSRAP was Gilman Hall on the University of California-Berkeley Campus. All California sites that are in our Surplus Facilities Management Prcgram are

  20. A Growing List | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Growing List High Energy Physics (HEP) HEP Home About Research Facilities Science Highlights Benefits of HEP Medicine Homeland Security Industry Computing Sciences Workforce Development A Growing List Accelerators for Americas Future External link Funding Opportunities Advisory Committees Community Resources Contact Information High Energy Physics U.S. Department of Energy SC-25/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3624 F: (301) 903-2597 E: Email Us

  1. Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD -

    Energy Savers [EERE]

    October 2005 | Department of Energy Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 October 2005 The purpose of this booklet is to assist individuals of Government agencies who generate or review classified documents to recognize the presence of nuclear information that is potentially classified as Restricted Data (RD) or Formerly Restricted Data (FRD). This book is

  2. Today in Energy - Browse by Tag List - U.S. Energy Information

    Gasoline and Diesel Fuel Update (EIA)

    Administration (EIA) Browse by Tag List Tag List | Tag Cloud 2011 Briefs 2012 Briefs 2013 Briefs AEO2011 (Annual Energy Outlook 2011) AEO2012 (Annual Energy Outlook 2012) AEO2013 (Annual Energy Outlook 2013) AEO2014 (Annual Energy Outlook 2014) AEO2015 (Annual Energy Outlook 2015) Africa age of generators series Alaska alternative fuel vehicle alternative transportation fuel animation appliance appliance standards Arkansas Australia Bakken barge Barnett baseload capacity Belgium biofuels

  3. updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    g-2g-3f_10-6-2011.xlsx updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx File updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx More Documents & Publications updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  4. updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    h-2h-3g- 11-4-2011.xlsx updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx File updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1j-2j-3i_12-22

  5. updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    i-2i-3h_12-06-2011.xlsx updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx File updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1g-2g-3f_10-6

  6. updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    j-2j-3i_12-22-2011.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx File updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  7. updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    k-2k-3j-_1-10-2012.xlsx updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx File updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx More Documents & Publications updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011

  8. updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    l-2l-3k-_02-10-2012.xlsx updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx File updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx More Documents & Publications updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  9. updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx File updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1j-2j-3i_12-22

  10. updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx File updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx More Documents & Publications updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1i-2i-3h_12-06

  11. Essam M. El-Hannouny | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Essam El-Hannouny Essam M. El-Hannouny Mechanical Engineer Telephone (630) 252-4976 E-mail

  12. Timothy Allison | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Timothy Allison Timothy Allison Energy & Environmental Policy Scientist Telephone 630-252-3209 E-mail

  13. YoungHo Shin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YoungHo Shin YoungHo Shin Principal Process Development Engineer Telephone (630) 252-4861 E-mail

  14. Benoit Roux | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benoit Roux Senior Scientist (Joint Appointment) & Professor, The University of Chicago Telephone 773.834.3557 E-mail

  15. Brandon Fisher | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineering Specialist Senior Brandon Fisher News Atomically Thin Metallic Boron Telephone 630.252.5324 Fax 630.252.4646 E-mail

  16. Los Alamos National Laboratory Postdoctoral Career Fair 2015

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form August 25 - 27, 2015 Company Name Mailing Address City State Zip Code Contact Person: Name Telephone email Recruiter 1 Name Recruiter 2 Name Recruiter 3 Name Recruiter...

  17. Jonathan Logan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Ian McNulty) Jonathan Logan Telephone 630.252.4874 Fax 630.252.5739 E-mail jmlogan

  18. Catharina Milostan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policy Scientist Telephone 630-252-6009 E-mail Projects Acoustic Building Infiltration Measurement SystemSonic Leak Quantifier Commercial Upstream...

  19. Nancy Dietz-Rago | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Materials Scientist Nancy Dietz-Rago Telephone 630.252.9798 Fax 630.252.5739 E-mail

  20. Tal Heilpern | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Stephen Gray) Tal Heilpern Telephone 630.252.5884 Fax 630.252.4646 E-mail theilpern

  1. Microsoft Word - CAMDGasCylinderRequest.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send all signed completed scanned requests directly to First Name Last Name E-mail: Telephone: Supervisor (if applicable) Department Institution:...

  2. Enhancing Railroad Hazardous Materials Transportation Safety

    Office of Environmental Management (EM)

    * Two Options * Two Options * Fusion Centers * Direct Hazmat * Carriers must provide name, title, telephone number, and e-mail address to fusion centers and those address to...

  3. Laurie Eichberger | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executive Secretary Laurie Eichberger Telephone 630.252.7570 Fax 630.252.6866 E-mail

  4. Lifen Wang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lifen Wang Postdoctoral Appointee (Supervisor, Dean Miller) Telephone (630) 557-9185 E-mail CV/Resume File Wang, Lifen - Bio.docx

  5. Shrirang Abhyankar | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Shrirang Abhyankar Shrirang Abhyankar Computational Engineer Telephone (630) 252-0219 E-mail Projects Distribution Automation

  6. Dean Carbaugh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Senior Technician Dean Carbaugh Telephone 630.252.4833 Fax 630.252.5739 E-mail

  7. Deborah O'Rourke | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deborah O'Rourke NST Assistant Division Director Telephone 630.252.3810 Fax 630.252.6866 E-mail dorourke

  8. Joonseok Lee | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fellow (Supervisor, Elena Roshkova) News Piezoelectrically enhanced ferroelectric polymers via nanoscale mechanical annealing Telephone 630.252.7317 Fax 630.252.4646 E-mail...

  9. Greg Krumdick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Krumdick Principal Systems Engineer Telephone (630) 252-3952 E-mail Projects Process Development and Scale-up Program

  10. Alper Kinaci | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Maria Chan) Alper Kinaci Telephone 630.252.5378 Fax 630.252.4646 E-mail akinaci

  11. State companies dominate OGJ100 list of non-U. S. oil producers

    SciTech Connect (OSTI)

    Not Available


    State owned oil and gas companies dominate the OGJ100 list of non-U.S. producers. Because many of them report only operating information, companies on the worldwide list cannot be ranked by assets or revenues. The list, therefore, is organized regionally, based on location of companies' corporate headquarters. The leading nongovernment company in both reserves and production is Royal Dutch/Shell. It ranks sixth in the world in liquids production and 11th in liquids reserves, as it has for the past 2 years. British Petroleum is the next largest nongovernment company. BP ranks 11th in liquids production and 16th in liquids reserves. Elf Aquitaine, 55.8% government-controlled, ranked 17th in liquids production. AGIP was 20th in liquids production. Kuwait Petroleum returned to the list of top 20 producers, ranking 12th, as it restored production shut in by facilities damage sustained during the Persian Gulf crisis. New to the top 20 reserves list is Petroleo Brasileiro, which moved to 20th position. The top 20 companies in the OGJ100 held reserves estimated at 869.3 billion bbl in 1992 vs. 869.5 billion bbl in 1991 and 854.2 billion bbl in 1990.

  12. Storing files in a parallel computing system using list-based index to identify replica files

    DOE Patents [OSTI]

    Faibish, Sorin; Bent, John M.; Tzelnic, Percy; Zhang, Zhenhua; Grider, Gary


    Improved techniques are provided for storing files in a parallel computing system using a list-based index to identify file replicas. A file and at least one replica of the file are stored in one or more storage nodes of the parallel computing system. An index for the file comprises at least one list comprising a pointer to a storage location of the file and a storage location of the at least one replica of the file. The file comprises one or more of a complete file and one or more sub-files. The index may also comprise a checksum value for one or more of the file and the replica(s) of the file. The checksum value can be evaluated to validate the file and/or the file replica(s). A query can be processed using the list.

  13. Method and apparatus of parallel computing with simultaneously operating stream prefetching and list prefetching engines

    DOE Patents [OSTI]

    Boyle, Peter A.; Christ, Norman H.; Gara, Alan; Mawhinney, Robert D.; Ohmacht, Martin; Sugavanam, Krishnan


    A prefetch system improves a performance of a parallel computing system. The parallel computing system includes a plurality of computing nodes. A computing node includes at least one processor and at least one memory device. The prefetch system includes at least one stream prefetch engine and at least one list prefetch engine. The prefetch system operates those engines simultaneously. After the at least one processor issues a command, the prefetch system passes the command to a stream prefetch engine and a list prefetch engine. The prefetch system operates the stream prefetch engine and the list prefetch engine to prefetch data to be needed in subsequent clock cycles in the processor in response to the passed command.

  14. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 LIST OF DELIVERABLES All deliverables shall be provided to DOE in an editable electronic format (i.e., rather than PDF) in addition to hardcopy. Omission of any deliverable from the List of Deliverables does not affect the obligation of the Contractor to comply with such requirement. Report Reference Due Date Approval or Information Approving Official Update on Transition Activities C.05 Within 7 days of NTP for Contract Transition DOE Approval CO Updated TCC Desk Guides C.6.1.2 Within 60 days


    Office of Scientific and Technical Information (OSTI)

    RECSIVEP ev Tin JUN 11157^; NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to May 21,1979 Office of Administration U. S. Nuclear Regulatory Commission NUREG-0668 TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to M a y 2 1 , 1979 Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v

  16. Condensed listing of surface boreholes at the Waste Isolation Pilot Plant Project through 31 December 1995

    SciTech Connect (OSTI)

    Hill, L.R.; Aguilar, R.; Mercer, J.W.; Newman, G.


    This report contains a condensed listing of Waste Isolation Pilot Plant (WIPP) project surface boreholes drilled for the purpose of site selection and characterization through 31 December 1995. The US Department of Energy (DOE) sponsored the drilling activities, which were conducted primarily by Sandia National Laboratories. The listing provides physical attributes such as location (township, range, section, and state-plane coordinates), elevation, and total borehole depth, as well as the purpose for the borehole, drilling dates, and information about extracted cores. The report also presents the hole status (plugged, testing, monitoring, etc.) and includes salient findings and references. Maps with borehole locations and times-of-drilling charts are included.

  17. From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Unattended Laboratory Heating Equipment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wed, 08 Jan 2003 14:50:55 -0500 From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Unattended Laboratory Heating Equipment Sender: ListServer@HQLNC.DOE.GOV Title: Yellow Alert- Unattended Laboratory Heating Equipment Date: 1/2/03 Identifier: LL-2002-LLNL-30 Lessons Learned Summary: Two recent events at an LLNL facility illustrate once again that small electrical heating sources should be monitored while in use. Discussion of Activities: In the first LLNL incident, plastic bottles of

  18. Hanford Advisory Board FY2014 Work Plan - "A" List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hanford Advisory Board FY2014 Work Plan - "A" List These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. 8/30/2013 v.6 Page 1 of 11 Priority Topics - "A" List Policy Level Issues

  19. Profiles List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anderson-Cook, Christine Computational Physics and Applied Mathematics Information Science ... Bennett, Katrina Computational Physics and Applied Mathematics Computer and Computational ...

  20. Registration List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    postdoc Cinna Julie Wu UC Berkeley Mathematics Dept Clayton Bagwell NERSC David Turner ... postdoc Cinna Julie Wu UC Berkeley Mathematics Dept David Turner LBL Dilworth ...

  1. Trails List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Allowed: hiking, walking, running, biking, horseback riding, photography Bicycles must stay on established trails. Bicycles yield to pedestrians and horses. Anniversary Trail...

  2. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1. Ricky Kendall, Ames laboratory 2. Mike Minkoff, ANL 3. Brian Hingerty, ORNL 4. Doug Rotman, LLNL 5. David J. Dean, ORNL 6. Don Spong, ORNL 7. Viktok K. Decyk, UCLA 8. Robert...

  3. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Samtaney PPPL, Princeton University OSF Oct. 2-3 Yes Yukiko Sekine DOE OSF Oct. 2-3 No John Shalf NERSC OSF Oct. 2-3 No Horst Simon LBNL OSF Oct. 2-3 Yes David Skinner NERSC OSF...

  4. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OSF Sep 17 Yes Richard Saykally Department of Chemistry, UC Berkeley OSF Sep 17-20 No John Shalf LBNL OSF Sep 17 No Horst Simon LBNL OSF Sep 17 Yes David Skinner LBLNERSC OSF...

  5. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    No Yukiko Sekine DOE InPerson No No No Yes Yes John Shalf NERSC InPerson No No No Yes No John Spring UCB InPerson Yes No No No No Mike Stewart NERSC InPerson Yes No No No No...

  6. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    viagrid x Swisdak, Marc University of Maryland inperson x x Taylor, John ANL inperson x Turner, David NERSC inperson x x...

  7. Job Listing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 031007 Firefighter/CIC/EMT $33.13 Engineer/CIC/EMT $19.76 Engineer/CIC/EMT $35.99 Chiefs Aide/CIC/EMT $19.76 Chiefs Aide/CIC/EMT $35.99 Lieutenant/CIC/EMT $20.99 Lieutenant/CIC/EMT $38.21 Captain/CIC/EMT $22.23 Captain/CIC/EMT $40.44 Assistant Chief/CIC/EMT $25.42 Assistant Chief/CIC/EMT $46.18 FP Tech/CIC/EMT $21.13 031019 FP Tech/CIC/EMT $38.47 031049 FP Captain/CIC/EMT $23.60 FP Captain/CIC/EMT $42.91 56-HOUR EMT & HAZ $1.11 10-HOUR EMT & HAZ $2.00 031047 Firefighter/CIC/EMT/HAZ

  8. Email List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Expand Finance & Rates Involvement & Outreach Expand Involvement & Outreach Doing Business Expand Doing Business Skip navigation links Initiatives Columbia River Treaty Non...

  9. Acronym List

    Broader source: [DOE]

    ACL  Alternate concentration limit AEC  U.S. Atomic Energy Commission BLM  U.S. Bureau of Land ManagementBLRA  Baseline Risk AssessmentBMT  Boundary MonumentCDPHE  Colorado Department of Public...

  10. Participant List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Thomas Lograsso Ames Laboratory Henry Lomasney Sandia Solar Technology Stephen ... Meyer Gas Technology Institute 2 Eric Miller Department of EnergyFuel Cell ...

  11. Registration List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Resources Vladimir Goncharov Vanderbilt University Ben Collins University of Michigan Scott Applequist NOAA - National Climate Data Center Shawfeng Dong University of...

  12. Participant List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Megan Brewster U.S. DOE, Advanced Manufacturing Office Joseph Broz SRI International Klaus Brun Southwest Research Institute Dan Carder West Virginia University Mark Carroll Idaho ...

  13. Title list of documents made publicly available, March 1--31, 1995: Volume 17, No. 3

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users. See NOTES at the end of the preface for information about reaching the PDR. Microfiche of the docketed information listed in the Title List is available for sale on a subscription basis from the National Technical Information Service (NTIS).

  14. Title list of documents made publicly available, March 1-31, 1996

    SciTech Connect (OSTI)


    This document is the March 1996 listing of publicly available documents published by the NRC. The documents include: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive material, and (2) nondocketed material received and generated by the NRC in its role as a regulatory agency.

  15. Theoretical hot methane line lists up to T = 2000 K for astrophysical applications

    SciTech Connect (OSTI)

    Rey, M.; Tyuterev, Vl. G.; Nikitin, A. V.


    The paper describes the construction of complete sets of hot methane lines based on accurate ab initio potential and dipole moment surfaces and extensive first-principle calculations. Four line lists spanning the [0-5000] cm{sup 1} infrared region were built at T = 500, 1000, 1500, and 2000 K. For each of these four temperatures, we have constructed two versions of line lists: a version for high-resolution applications containing strong and medium lines and a full version appropriate for low-resolution opacity calculations. A comparison with available empirical databases is discussed in detail for both cold and hot bands giving a very good agreement for line positions, typically <0.1-0.5 cm{sup 1} and ?5% for intensities of strong lines. Together with numerical tests using various basis sets, this confirms the computational convergence of our results for the most important lines, which is the major issue for theoretical spectra predictions. We showed that transitions with lower state energies up to 14,000 cm{sup 1} could give significant contributions to the methane opacity and have to be systematically taken into account. Our list at 2000 K calculated up to J = 50 contains 11.5 billion transitions for I > 10{sup 29} cm mol{sup 1}. These new lists are expected to be quantitatively accurate with respect to the precision of available and currently planned observations of astrophysical objects with improved spectral resolution.


    National Nuclear Security Administration (NNSA)

    III - LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J LIST OF APPENDICES - TABLE OF CONTENTS Appendix A Statement of Work Appendix B Award Fee Plan Appendix C Transition Plan Appendix D Sensitive Foreign Nations Control Appendix E Performance Guarantee Agreement(s) Appendix F National Work Breakdown Structure Appendix G Personnel Appendix Appendix H Key Personnel Appendix I Small Business Subcontracting Plan Appendix J Diversity Plan Guidance Appendix K List of Applicable Directives


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT E: PERFORMANCE GUARANTEE AGREEMENT (Performance Guarantee Agreements dated, August 17, 2012 is hereby incorporated

  18. WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings for Use in the Weatherization Assistance Program

    Broader source: [DOE]

    To notify interested parties of supplemental listings of properties that have been determined to meet certain criteria under the Weatherization Assistance Program (WAP).

  19. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  20. Title III list of lists: Consolidated list of chemicals subject to the Emergency Planning and Community Right-to-Know Act (EPCRA) and section 112(r) of the Clean Air Act, as amended. Title III of the Superfund Amendments and Reauthorization Act of 1986, and Title III of the Clean Air Act Amendments of 1990

    SciTech Connect (OSTI)

    Not Available


    The consolidated chemical list includes chemicals subject to reporting requirements under Title III of the Superfund Amendments and Reauthorization Act of 1986 (SARA), also known as the Emergency Planning and Community Right-to-Know Act (EPCRA), and chemicals listed under section 112(r) of Title III the Clean Air Act (CAA) Amendments of 1990. This consolidated list has been prepared to help firms handling chemicals determine whether they need to submit reports under sections 302, 304, or 313 of SARA Title III (EPCRA) and, for a specific chemical, what reports may need to be submitted. Separate lists are also provided of Resource Conservation and Recovery Act (RCRA) waste streams and unlisted hazardous wastes, and of radionuclides reportable under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). These lists should be used as reference tool, not as a definitive source of compliance information. The chemicals on the consolidated list are ordered by Chemical Abstract Service (CAS) registry number. Categories of chemicals, which do not have CAS registry numbers, but which are cited under CERCLA, EPCRA section 313, and the CAA, are placed at the end of the list. More than one chemical name may be listed for one CAS number, because the same chemical may appear on different lists under different names.

  1. Assessment of the percent status of burning refuse-derived fuel as a fuel supplement in the cement kiln industry

    SciTech Connect (OSTI)


    The purpose of the project was to solicit information on the use of refuse-derived fuel (RDF) in cement kilns by survey, follow up the mailed survey with telephone calls to the recipients, and assemble collected information into a report. A list of companies that had some experience with RFD was compiled and is presented in Appendix A. The procedure for conducting the survey is explained. A copy of the questionnaire is presented in Appendix B. The letters of response are reproduced in Appendix C. Two completed forms were received and clear conclusions are summarized. The effort was terminated and no final report was assembled.

  2. 17th Edition of TOP500 List of World's Fastest SupercomputersReseased

    SciTech Connect (OSTI)

    Strohmaier, Erich; Meuer, Hans W.; Dongarra, Jack J.; Simon,Horst D.


    17th Edition of TOP500 List of World's Fastest Supercomputers Released MANNHEIM, GERMANY; KNOXVILLE, TENN.; BERKELEY, CALIF. In what has become a much-anticipated event in the world of high-performance computing, the 17th edition of the TOP500 list of the world's fastest supercomputers was released today (June 21). The latest edition of the twice-yearly ranking finds IBM as the leader in the field, with 40 percent in terms of installed systems and 43 percent in terms of total performance of all the installed systems. In second place in terms of installed systems is Sun Microsystems with 16 percent, while Cray Inc. retained second place in terms of performance (13 percent). SGI Inc. was third both with respect to systems with 63 (12.6 percent) and performance (10.2 percent).

  3. Title list of documents made publicly available, February 1-28, 1998

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979.

  4. Title list of documents made publicly available, January 1-31, 1998

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies in paper, microfiche, or (selectively) diskette, may be obtained for a fee.

  5. DOE technical standards list: Directory of points of contact for the DOE Technical Standards Program

    SciTech Connect (OSTI)


    This Department of Energy (DOE) technical standards list (TSL) has been prepared by the Office of Nuclear Safety Policy and Standards (EH-31). This TSL is approved for use by all DOE Components (i.e., all DOE Headquarters and field organizations, management and operating contractors, and laboratories). This TSL supplements DOE manuals, directives, orders, and standards. It provides basic and fundamental information for DOE Component personnel involved in identifying standardization documents. It also provides listings of points of contact within DOE and identifies links to points of contact within the Department of Defense (DoD) for coordination of standardization activities. This TSL will be updated to reflect changes in organizations, addresses, and responsibilities as necessary.

  6. Hanford low-level vitrification melter testing -- Master list of data submittals

    SciTech Connect (OSTI)

    Hendrickson, D.W.


    The Westinghouse Hanford Company (WHC) is conducting a two-phased effort to evaluate melter system technologies for vitrification of liquid low-level radioactive waste (LLW) streams. The evaluation effort includes demonstration testing of selected glass melter technologies and technical reports regarding the applicability of the glass melter technologies to the vitrification of Hanford LLW tank waste. The scope of this document is to identify and list vendor document submittals in technology demonstration support of the Hanford Low-Level Waste Vitrification melter testing program. The scope of this document is limited to those documents responsive to the Statement of Work, accepted and issued by the LLW Vitrification Program. The purpose of such a list is to maintain configuration control of vendor supplied data and to enable ready access to, and application of, vendor supplied data in the evaluation of melter technologies for the vitrification of Hanford low-level tank wastes.

  7. LOS ALAMOS, N.M., Dec. 15, 2014-The Los Alamos National Laboratory Fellows list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory Fellows for 2014 December 15, 2014 Honorees span sciences in physics, astrophysics, chemistry LOS ALAMOS, N.M., Dec. 15, 2014-The Los Alamos National Laboratory Fellows list expands by five this week as a new group of high achievers is named. The honorees this year are Christopher L. Fryer, Herbert O. Funsten, John C. Gordon, Jaqueline L. Kiplinger and David S. Moore. "The sustained scientific excellence demonstrated by the work of Chris, Herb, John, Jaqueline and David

  8. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 ACRONYM LIST Acronym Description TRANSCOM Transportation Tracking and Communications System 8(a) Section 8(a) of the Small Business Act ADR Alternative Dispute Resolution CBFO Carlsbad Field Office CCR Central Contractor Registration CFR Code of Federal Regulations CLIN Contract Line Item Number CO Contracting Officer COR Contracting Officer Representative CPARS Contractor Performance Assessment Reporting System DEAR Department of Energy Acquisition Regulation DOE Department of Energy DPLH

  9. All Other Editions Are Obsolete U.S. Department of Energy Shuttle Bus Passenger List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    511.1 (02-94) All Other Editions Are Obsolete U.S. Department of Energy Shuttle Bus Passenger List Date: Time: Bus Number: Driver's Signature: The U.S. Department of Energy (DOE) Shuttle operates Express between the Germantown Building and the Washington Office (Forrestal Building). ICC regulations prohibits en-route stops. The information being collected below is for the purpose of identifying individuals utilizing DOE Shuttle service. It is not retrievable by a personal identifier and is,

  10. Domestic Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Domestic Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates Domestic

  11. Title list of documents made publicly available, August 1-31, 1995

    SciTech Connect (OSTI)


    This document is the August 1995 listing of publicly available documents that are issued by the Nuclear Regulatory Commission. The compilation is broken down into docketed and undocketed items, and each of these categories is further broken down into narrower categories. In general, the docketed items pertain to specific NRC licensees, while the undocketed items are of general interest to all licensees of a particular group.

  12. New FedBizOpps Feature-Small Business Central Event Listing for Outreach and Training

    Broader source: [DOE]

    The Interagency Task Force on Small Business Contracting recommended that agencies post all new outreach and training events on FedBizOpps in order to make it easier and less burdensome for small businesses to learn about and transact business with the federal government. The subject new Small Business Central Event Listing provides a dynamic "calendar" for allowing small business users to search for business development, matchmaking and training opportunities by various criteria, including agency, date, location and small business category.

  13. International Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    International Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates

  14. Plutonium Certified Reference Materials Price List | U.S. DOE Office of

    Office of Science (SC) Website

    Science (SC) Plutonium Certified Reference Materials Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256

  15. User 'To Do' List after Beam Time is Assigned | Linac Coherent Light Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    'To Do' List after Beam Time is Assigned □ Contact the Guest House to make reservations □ Review Checklists, Check-In Procedures & Advance Requirements for Foreign Nationals □ Review Safety of Scheduled Experiments & Complete Training □ Complete User Agreements □ Establish or Confirm User Financial Accounts □ Order Chemicals, Gases, Cryogenics □ Coordinate Equipiment Modifications □ Establish or Confirm Computer Accounts, Set up & Access Electronic Logbooks (eLog) □

  16. A lock-free priority queue design based on multi-dimensional linked lists

    SciTech Connect (OSTI)

    Dechev, Damian; Zhang, Deli


    The throughput of concurrent priority queues is pivotal to multiprocessor applications such as discrete event simulation, best-first search and task scheduling. Existing lock-free priority queues are mostly based on skiplists, which probabilistically create shortcuts in an ordered list for fast insertion of elements. The use of skiplists eliminates the need of global rebalancing in balanced search trees and ensures logarithmic sequential search time on average, but the worst-case performance is linear with respect to the input size. In this paper, we propose a quiescently consistent lock-free priority queue based on a multi-dimensional list that guarantees worst-case search time of O(logN) for key universe of size N. The novel multi-dimensional list (MDList) is composed of nodes that contain multiple links to child nodes arranged by their dimensionality. The insertion operation works by first injectively mapping the scalar key to a high-dimensional vector, then uniquely locating the target position by using the vector as coordinates. Nodes in MDList are ordered by their coordinate prefixes and the ordering property of the data structure is readily maintained during insertion without rebalancing nor randomization. Furthermore, in our experimental evaluation using a micro-benchmark, our priority queue achieves an average of 50% speedup over the state of the art approaches under high concurrency.

  17. A lock-free priority queue design based on multi-dimensional linked lists

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Dechev, Damian; Zhang, Deli


    The throughput of concurrent priority queues is pivotal to multiprocessor applications such as discrete event simulation, best-first search and task scheduling. Existing lock-free priority queues are mostly based on skiplists, which probabilistically create shortcuts in an ordered list for fast insertion of elements. The use of skiplists eliminates the need of global rebalancing in balanced search trees and ensures logarithmic sequential search time on average, but the worst-case performance is linear with respect to the input size. In this paper, we propose a quiescently consistent lock-free priority queue based on a multi-dimensional list that guarantees worst-case search time of O(logN)more » for key universe of size N. The novel multi-dimensional list (MDList) is composed of nodes that contain multiple links to child nodes arranged by their dimensionality. The insertion operation works by first injectively mapping the scalar key to a high-dimensional vector, then uniquely locating the target position by using the vector as coordinates. Nodes in MDList are ordered by their coordinate prefixes and the ordering property of the data structure is readily maintained during insertion without rebalancing nor randomization. Furthermore, in our experimental evaluation using a micro-benchmark, our priority queue achieves an average of 50% speedup over the state of the art approaches under high concurrency.« less

  18. State-owned companies dominate list of largest non-U. S. producers

    SciTech Connect (OSTI)

    Beck, R.J.; Williamson, M.


    Because state-owned oil and gas companies dominate Oil and Gas Journal's list of largest non-US producers, data aren't fully comparable with those of the OGJ300. Many state companies report only production and reserves, with little or no financial data. Companies on the OGJ100, therefore, cannot be ranked by assets or revenues. Instead, they are listed by regions, based on location of corporate headquarters. There was no change in makeup of the top 20 holders of crude oil reserves. These companies' reserves totaled 872.3 billion bbl in 1993. The top 20 non-US companies now control 87.3 % of total world crude oil reserves, according to OGJ estimates. This is up marginally from 87.2 % of total world oil reserves in 1992. The top 20 had 87.7 % of total world reserves in 1991 and 85.5 % in 1990. The table lists company name, total assets, revenues, net income, capital and exploratory expenditures, worldwide oil production, gas production, oil and gas reserves worldwide.

  19. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)



    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  20. Title list of documents made publicly available. Volume 16, Number 5

    SciTech Connect (OSTI)

    Not Available


    The Title List of Documents Made Publicly Available contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  1. Title list of documents made publicly available: February 1--29, 1996. Volume 18, Number 2

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  2. Title list of documents made publicly available. Volume 17, No. 5

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (3) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  3. Title list of documents made publicly available. Volume 17, No. 7

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  4. Title list of documents made publicly available, May 1-31, 1996

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed, material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index.

  5. Listing of DOE/FE Authorizations Issued in 2013 | Department of Energy

    Energy Savers [EERE]

    3 Listing of DOE/FE Authorizations Issued in 2013 The following chart contains all Orders issued by the Office of Natural Gas Regulatory Activities in 2013 thru December 19. The orders include all new or renewed authority to Import and Export Natural Gas and/or Liquefied Natural Gas, as well as all procedural orders; i.e., vacates, name changes. To download applications, click here and select the "View (blankets), PDF (exports)" tab. The Orders are in PDF format and Require the Acrobat

  6. Listing of DOE/FE Authorizations Issued in 2014 | Department of Energy

    Energy Savers [EERE]

    4 Listing of DOE/FE Authorizations Issued in 2014 The following chart contains all Orders issued by the Office of Natural Gas Regulatory Activities in 2014 thru December 31st. The orders include all new or renewed authority to Import and Export Natural Gas and/or Liquefied Natural Gas, as well as all procedural orders; i.e., vacates, name changes. To download applications, click here and select the "View (blankets), PDF (exports)" tab. The Orders are in PDF format and Require the

  7. Project W-320, 241-C-106 waste retrieval spare parts list

    SciTech Connect (OSTI)

    Hays, W.H.


    Spare parts for equipment installed in the tank dome space or pump or valve pits should not be inventoried onsite due to the extensive, time-consuming work package planning, personnel/equipment mobilization, and funding requirements that are prerequisites to any repair or replacement. These issues provide adequate time to procure parts from offsite sources. All parts listed in this inventory can either be stocked in the DynCorp Tri-Cities Services, Inc., 2101-M Warehouse, or are available from the vendor/manufacturer.

  8. Title list of documents made publicly available: October 1--31, 1994. Volume 16, Number 10

    SciTech Connect (OSTI)

    Not Available


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  9. Title list of documents made publicly available, September 1-30, 1997

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  10. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 LIST OF APPLICABLE DOE DIRECTIVES The Contractor shall comply with the requirements of the DOE Directives identified below. DOE directives may be found at Regulation and Number Regulation Title DOE O 150.1 Continuity Programs DOE O 200.1A Information Technology Management DOE O 203.1 Limited Personal use of Government Office Equipment including Information Technology DOE O 205.1B Chg 2 Department of Energy Cyber Security Program DOE O 206.1 Department of Energy

  11. Title list of documents made publicly available, January 1, 1997--January 31, 1997

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  12. TPA PM List by TSD as of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TREATMENT, STORAGE AND DISPOSAL UNITS PROJECT MANAGERS LIST AS OF SEPTEMBER 30, 2015 Prepared By MSA TPA Site Wide Integration TSD NO. Description Ecology PM DOE PM Assistant Manager Status Lead Regulatory Agency D-1-2 1301-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-1-2 1325-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-2-10 216-A-37-1 Crib Menard, N. Cline, M.W. Corey, R. J. Interim Ecology Lead D-2-11


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 NMED COMMENTS ITEM 3 REVISE VOLATILE ORGANIC COMPOUND (VOC) TARGET ANALYTE LIST OTHER CHANGES TO VOC MONITORING PROGRAM Page 1 of 21 VOC 3*1: PMR Section 3, Topic 1, Table 1 Recalculated Waste Matrix Code Group Weighting Factors based on the 2004 Compliance Recertification Contact Handled (CH) Transuranic (TRU) Waste Inventory (m 3 ) The new weighting factors appear to be based on CH TRU waste only and do not include remote handled (RH) TRU waste. There was no discussion in the PMR addressing

  14. A transputer-based list mode parallel system for digital radiography with 2D silicon detectors

    SciTech Connect (OSTI)

    Conti, M.; Russo, P.; Scarlatella, A. . Dipt. di Scienze Fisiche and INFN); Del Guerra, A. . Dipt. di Fisica and INFN); Mazzeo, A.; Mazzocca, N.; Russo, S. . Dipt. di Informatica e Sistemistica)


    The authors believe that a dedicated parallel computer system can represent an effective and flexible approach to the problem of list mode acquisition and reconstruction of digital radiographic images obtained with a double-sided silicon microstrip detector. They present a Transputer-based implementation of a parallel system for the data acquisition and image reconstruction from a silicon crystal with 200[mu]m read-out pitch. They are currently developing a prototype of the system connected to a detector with a 10mm[sup 2] sensitive area.

  15. Title list of documents made publicly available, April 1--30 1997, Vol. 19, No. 4

    SciTech Connect (OSTI)

    Morris, E.B.


    This report describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes: (1) material associated with civilian nuclear power plants and other uses of radioactive materials and (2) material received and published by NRC pertinent to its role as a regulatory agency. In this report, 7 items of the first type are included, and 25 regulatory type items are listed. The report is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  16. Title list of documents made publicly available, March 1--31, 1998. Volume 20, Number 3

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  17. Uranium Certified Reference Materials Price List | U.S. DOE Office of

    Office of Science (SC) Website

    Science (SC) Uranium Certified Reference Materials Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E:

  18. Uranium and Thorium Ores Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    and Thorium Ores Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates

  19. Hanford Advisory Board FY2014 Work Plan - "A" List - Facilitat

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    "A" List - Facilitator notes on midyear status for TWC-lead topics (updated 4/30/14) These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. Adopted by Consensus, September 6, 2013 Page 1 of

  20. Hanford Advisory Board FY2014 Work Plan - "A" List - RAP ISSUE MANAGERS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RAP ISSUE MANAGERS (updated 11/13/13) These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. Adopted by Consensus, September 6, 2013 Page 1 of 12 Priority Topics - "A" List Policy Level Issues

  1. Title list of documents made pulicly available, March 1-31, 1997

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  2. Title list of documents made publicly available, April 1-30, 1995. Volume 17, No. 4

    SciTech Connect (OSTI)


    This document is NUREG-0540, Volume 17, Number 4. The Title List of Documents Made Publicly Available is a monthly publication, It contains descriptions of the information received and generated by the US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by the NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which the NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  3. Title list of documents made publicly available: May 1--31, 1997. Volume 19, Number 5

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  4. Title list of documents made publicly available, December 1--31, 1993, Volume 15, No. 12

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  5. Fact #779: May 13, 2013 EPA's Top Ten Rated Vehicles List for Model Year 2013 is All Electric

    Broader source: [DOE]

    The 2013 model year marks the first time when the Environmental Protection Agency's (EPA's) top ten most fuel efficient vehicles list is comprised entirely of electric vehicles. Electric vehicles...

  6. DOE technical standards list: Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    The body of this document contains a listing of DOE employees and DOE contractors who have submitted form DOE F 1300.2, Record of Non-Government Standards Activity, which is attached to the end of this document. Additional names were added from rosters supplied by non-Government standards bodies. The committees or governing bodies in which the person participates is listed after each name. An asterisk preceding the committee notation indicates that the person has identified himself or herself as the DOE representative on that committee. Appendices to this document are also provided to sort the information by the parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees. DOE employees and contractors listed in this technical standards list are those recorded as of May 1, 1999.

  7. Discussion on a Code Comparison Effort for the Geothermal Technologies

    Office of Environmental Management (EM)

    About » Directory Listings Directory Listings There are three DOE Directory Listings: An alphabetical listing of all DOE federal employees including their telephone number, routing symbol, and location (building/room number) A listing of Headquarters staff by organization including their telephone number, routing symbol, location (building/room number), and fax number (when available) A listing of Field staff by organization including their telephone number, location (building/room


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)



    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT F: GUIDANCE FOR PREPARATION OF DIVERSITY PLAN DE-SOL-0002555 WIPP Solicitation J-24 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT F GUIDANCE FOR PREPARATION OF DIVERSITY PLAN (See Contract Clause entitled "Diversity Plan") This Guidance is to assist the Contractor in understanding the information being sought by the Department for each of the Diversity elements and

  10. Title list of documents made publicly available, November 1-30, 1995

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docker Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users.

  11. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  12. Test report of evaluation of primary exhaust ventilation flowmeters for double shell hydrogen watch list tanks

    SciTech Connect (OSTI)

    Willingham, W.E., Westinghouse Hanford


    This document reports the results of testing four different flowmeters for use in the primary exhaust ventilation ducts of Double Shell Tanks on the hydrogen watch list that do not already have this capability. This currently includes tanks 241-AW-101,241-AN- 103, 241-AN-104, 241-AN-105 and 241-SY-103. The anticipated airflow velocity in these tanks range from 0.25 m/s(50 ft/min) to 1/78 m/s (350 ft/min). Past experiences at Hanford have forced the evaluation and selection of instruments to be used at the low flow and relatively high humidity conditions found in these tanks. Based on the results of this test, a flow meter has been chosen for installation in the primary exhaust ventilation ducts of the above mentioned waste tanks.

  13. Safeguards summary event list (SSEL), January 1, 1990--December 31, 1995

    SciTech Connect (OSTI)


    The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 4, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, rough December 31, 1995. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.

  14. Safeguards Summary Event List (SSEL), January 1, 1990--December 31, 1996, Vol. 2, Rev. 5

    SciTech Connect (OSTI)


    The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 5, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, through December 31, 1996. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.

  15. Development of an ideal observer that incorporates nuisance parameters and processes list-mode data

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    MacGahan, Christopher Jonathan; Kupinski, Matthew Alan; Hilton, Nathan R.; Brubaker, Erik M.; Johnson, William C.


    Observer models were developed to process data in list-mode format in order to perform binary discrimination tasks for use in an arms-control-treaty context. Data used in this study was generated using GEANT4 Monte Carlo simulations for photons using custom models of plutonium inspection objects and a radiation imaging system. We evaluated observer model performance and then presented using the area under the receiver operating characteristic curve. Lastly, we studied the ideal observer under both signal-known-exactly conditions and in the presence of unknowns such as object orientation and absolute count-rate variability; when these additional sources of randomness were present, their incorporationmore » into the observer yielded superior performance.« less

  16. Flora of the Mayacmas Mountains. [Listing of 679 species in the Geysers Geothermal Resource area

    SciTech Connect (OSTI)

    Neilson, J.A.


    This flora describes the plants that occur within the Mayacmas Mountain Range of northern California. It is the result of ten years of environmental assessment by the author in the Geysers Geothermal Resource area, located in the center of the Mayacmas Range. The flora includes notes on plant communities and ecology of the area, as well as habitat and collection data for most of the 679 species covered. Altogether 74 families, 299 genera and 679 species are included in the flora. The work is divided into eight subdivisions: trees; shrubs; ferns and fern allies; aquatic plants; tules, sedges, and rushes; lilies and related plants; dicot herbs; and grasses. Within each subdivision, family, genera and species are listed alphabetically. Keys are provided at the beginning of each subdivision. A unique combination of physical, environmental and geologic factors have resulted in a rich and diverse flora in the Mayacmas. Maps have been provided indicating known locations for species of rare or limited occurrence.

  17. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  18. DOE Technical Standards List. Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    This is a periodic report on the level of agency participation in non-Government standards activities. This technical standards list is intended to assist US Department of Energy (DOE) management and other personnel involved in the DOE technical Standards Program by identifying those participating individuals. The body of this document contains a listing of DOE employees and DOE contractors who have submitted a Record of Non-Government Standards Activity. Additional names were added from rosters supplied by non-Government standards bodies. Appendices to this document are provided to list the information by parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees.

  19. DOE technical standards list: Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    The body of this document contains a listing of DOE employees and DOE contractors who have submitted form DOE F 1300.2, Record of Non-Government Standards Activity, which is attached to the end of this document and to DOE Order 1300.2A. Additional names were added from rosters supplied by non-Government standards bodies. The committees or governing bodies in which the person participates is listed after each name. An asterisk preceding the committee notation indicates that the person has identified himself or herself as the DOE representative on that committee. Appendices to this document are also provided to sort the information by the parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees. DOE employees and contractors listed in this TSL are those recorded as of July 1, 1996.

  20. From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Hazards from Modifying Finished Products

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    07 Jan 2003 15:55:12 -0500 From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Hazards from Modifying Finished Products Sender: ListServer@HQLNC.DOE.GOV Title: Yellow Alert- Hazards from Modifying Finished Products Date: 1/2/2003 Identifier: LL-2002-LLNL-31 Lessons Learned Summary: It is important to identify any hazards involved with the modification of a "finished" commercial product. Discussion of Activities: Finished products do not require a label for material hazards

  1. Prioritized List of Research Needs to support MRWFD Case Study Flowsheet Advancement

    SciTech Connect (OSTI)

    Law, Jack Douglas; Soelberg, Nicholas Ray


    In FY-13, a case study evaluation was performed of full recycle technologies for both the processing of light-water reactor (LWR) used nuclear fuels as well as fast reactor (FR) fuel in the full recycle option. This effort focused on the identification of the case study processes and the initial preparation of material balance flowsheets for the identified technologies. In identifying the case study flowsheets, it was decided that two cases would be developed: one which identifies the flowsheet as currently developed and another near-term target flowsheet which identifies the flowsheet as envisioned within two years, pending the results of ongoing research. The case study focus is on homogeneous aqueous recycle of the U/TRU resulting from the processing of LWR fuel as feed for metal fuel fabrication. The metal fuel is utilized in a sodium cooled fast reactor and the used fast reactor fuel processed using electrochemical separations. The recovered U/TRU from electrochemical separations is recycled to fuel fabrication and the fast reactor. Waste streams from the aqueous and electrochemical processing are treated and prepared for disposition. Off-gas from the separations and waste processing are also treated. As part of the FY-13 effort, preliminary process unknowns and research needs to advance the near-term target flowsheets were identified. In FY-14, these research needs were updated, expanded and prioritized. This report again updates the prioritized list of research needs based upon results to date in FY-15. The research needs are listed for each of the main portions of the flowsheet: 1) Aqueous headend, 2) Headend tritium pretreatment off-gas, 3) Aqueous U/Pu/Np recovery, 4) Aqueous TRU product solidification, 5) Aqueous actinide/lanthanide separation, 6) Aqueous off-gas treatment, 7) Aqueous HLW management, 8) Treatment of aqueous process wastes, 9) E-chem actinide separations, 10) E-chem off-gas, 11) E-chem HLW management. The identified research needs were prioritized within each of these areas. No effort was made to perform an overall prioritization. This information will be used by the MRWFD Campaign leadership in research planning for FY-16. Additionally, this information will be incorporated into the next version of the Case Study Report scheduled to be issued September 2015.

  2. Title III List of Lists: Consolidated list of chemicals subject to the Emergency Planning and Community Right-to-Know Act (EPCRA) and Section 112(r) of the Clean Air Act, as amended. Title III of the Superfund Amendments and Reauthorization Act of 1986, and Title III of the Clean Air Act Amendments of 1990

    SciTech Connect (OSTI)


    This consolidated chemical list includes chemicals subject to reporting requirements under Title III of the Superfund Amendments and Reauthorization Act of 1986 (SARA), also known as the Emergency Planning and Community Right-to-Know Act (EPCRA) and chemicals listed under Section 112(r) of Title III of the Clean Air Act (CAA) Amendments of 1990. This consolidated list has been prepared to help firms handling chemicals determine whether they need to submit reports under sections 302, 304, or 314 or SARA Title III (EPCRA) and, for a specific chemical, what reports may need to be submitted. It also will also help firms determine whether they will be subject to accident prevention regulations under CAA section 112(r).

  3. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues

  4. Experimental Unevaluated Nuclear Data List (XUNDL) from the National Nuclear Data Center (NNDC)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    XUNDL was established in 1998. While it contains compiled nuclear structure data in the "ENSDF" format, the difference is that the ENSDF collection holds evaluated data, while XUNDL holds experimental data that have not yet been evaluated. The manual for one of the evaluated collections defines evaluation as "the process of analyzing experimentally measured cross-section data, combining them with the predictions of nuclear model calculations, and attempting to extract the true value of a cross section." (Document ENDF-102) The XUNDL data are the experimental data before these calculations and comparisons are done. In general, the information in a given XUNDL dataset comes from a single journal article or from a set of closely related articles by one group of authors. The bulk of the compilations are carried out by the Nuclear Data Group at McMaster University. As of February 2008, the XUNDL database contained more than 2500 datasets for 1484 nuclides. The data can be searched through specialized interfaces or browsed. There is also a special list of hypernucleus datasets available. (Specialized Interface)

  5. Treatability studies of actual listed waste sludges from the Oak Ridge Reservation (ORR)

    SciTech Connect (OSTI)

    Jantzen, C.M.; Peeler, D.K.; Gilliam, T.M.; Bleier, A.; Spence, R.D.


    Oak Ridge National Laboratory (ORNL) and Savannah River Technology Center (SRTC) are investigating vitrification for various low-level and mixed wastes on the Oak Ridge Reservation (ORR). Treatability studies have included surrogate waste formulations at the laboratory-, pilot-, and field-scales and actual waste testing at the laboratory- and pilot-scales. The initial waste to be processing through SRTC`s Transportable Vitrification System (TVS) is the K-1407-B and K-1407-C (B/C) Pond sludge waste which is a RCRA F-listed waste. The B/C ponds at the ORR K-25 site were used as holding and settling ponds for various waste water treatment streams. Laboratory-, pilot-, and field- scale ``proof-of-principle`` demonstrations are providing needed operating parameters for the planned field-scale demonstration with actual B/C Pond sludge waste at ORR. This report discusses the applied systems approach to optimize glass compositions for this particular waste stream through laboratory-, pilot-, and field-scale studies with surrogate and actual B/C waste. These glass compositions will maximize glass durability and waste loading while optimizing melt properties which affect melter operation, such as melt viscosity and melter refractory corrosion. Maximum waste loadings minimize storage volume of the final waste form translating into considerable cost savings.


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  7. Thermal springs list for the United States; National Oceanic and Atmospheric Administration Key to Geophysical Records Documentation No. 12

    SciTech Connect (OSTI)

    Berry, G.W.; Grim, P.J.; Ikelman, J.A.


    The compilation has 1702 thermal spring locations in 23 of the 50 States, arranged alphabetically by State (Postal Service abbreviation) and degrees of latitude and longitude within the State. It shows spring name, surface temperature in degrees Fahrenheit and degrees Celsius; USGS Professional Paper 492 number, USGS Circular 790 number, NOAA number, north to south on each degree of latitude and longitude of the listed. USGS 1:250,000-scale (AMS) map; and the USGS topographic map coverage, 1:63360- or 1:62500-scale (15-minute) or 1:24000-scale (7.5-minute) quadrangle also included is an alphabetized list showing only the spring name and the State in which it is located. Unnamed springs are omitted. The list includes natural surface hydrothermal features: springs, pools, mud pots, mud volcanoes, geysers, fumaroles, and steam vents at temperature of 20{sup 0}C (68[sup 0}F) or greater. It does not include wells or mines, except at sites where they supplement or replace natural vents presently or recently active, or, in some places, where orifices are not distinguishable as natural or artificial. The listed springs are located on the USGS 1:250,000 (AMS) topographic maps. (MHR)

  8. Participant List for the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure Meeting on January 31, 2007

    Broader source: [DOE]

    This list describes the participants at the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure meeting on January 31, 2007.

  9. Notice of Availability of a Preliminary List of Standby Power Products and Testing Guidelines, Federal Register, 66 FR 67517, December 31, 2001

    Broader source: [DOE]

    Document displays the notice of availability of a preliminary list of standby power products and testing guidelines, which was published in the Federal Register on December 31, 2001.

  10. Telephone. Federal Communications Commission. Marlene H. Dortch...

    Office of Environmental Management (EM)

    ... (GSA), and National Aeronautics and Space Administration (NASA). ACTION: Correction. ... DoD, GSA, and NASA adopted as final, with changes, an interim rule amending the Federal ...

  11. EIS-0298: Telephone Flat Geothermal Development Project

    Broader source: [DOE]

    This EIS is for a Plan of Operation (POO) for Development and Production; and for a POO for Utilization and Disposal for a proposed geothermal development project, including: a power plant, geothermal production and injection wellfield, ancillary facilities, and transmission line on the Modoc National Forest in Siskiyou and Modoc Counties, California.


    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  13. Telephone. Federal Communications Commission. Marlene H. Dortch...

    Broader source: (indexed) [DOE]

    Commission amends 47 CFR parts 20 and 54 as follows: PART 20-COMMERCIAL MOBILE RADIO SERVICES 1. The authority citation for part 20 continues to read as follows:...

  14. Telephoning for Energy Efficiency in Vermont

    Broader source: [DOE]

    This is a phone call you want to take. NeighborWorks of Western Vermont (NWWVT) is phonebanking homeowners in Shrewsburgh, VT offering up home energy audits at a fraction of the cost to help local residents save energy to save money.

  15. Cellular telephone-based radiation detection instrument

    DOE Patents [OSTI]

    Craig, William W.; Labov, Simon E.


    A network of radiation detection instruments, each having a small solid state radiation sensor module integrated into a cellular phone for providing radiation detection data and analysis directly to a user. The sensor module includes a solid-state crystal bonded to an ASIC readout providing a low cost, low power, light weight compact instrument to detect and measure radiation energies in the local ambient radiation field. In particular, the photon energy, time of event, and location of the detection instrument at the time of detection is recorded for real time transmission to a central data collection/analysis system. The collected data from the entire network of radiation detection instruments are combined by intelligent correlation/analysis algorithms which map the background radiation and detect, identify and track radiation anomalies in the region.

  16. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)



    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT A LAWS, REGULATIONS, AND DIRECTIVES (DEC 2000) (a) In performing work under this contract, the Contractor shall comply with the requirements of applicable Federal, State, and local laws and regulations (including DOE regulations), unless relief has been granted in writing by the appropriate regulatory agency. (b) In performing work under this contract, the Contractor shall comply with the requirements of those


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT C: DRAFT PERFORMANCE EVALUATION AND MEASUREMENT PLAN (PEMP) DE-EM-0001971 WIPP M&O J-9 Draft PERFORMANCE EVALUATION AND MEASUREMENT PLAN (PEMP) OCTOBER 1 (2012) through SEPTEMBER 30, (2013) Contract No. DE- EM0001971 SECTION J ATTACHMENT C I. INTRODUCTION This Performance Evaluation and Measurement Plan (PEMP) provides a standard process for development, administration, and coordination of all phases of the


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT G: SUMMARY OF CONTRACT DELIVERABLES DE-SOL-0002555 WIPP Solicitation J-27 SUMMARY OF CONTRACT DELIVERABLES Deliverable Reference Deliverable DOE Action Deliverable Due Date 1 1. C.3.1.5 Ten Year Site Plan Approval Within 6 months of written notice to proceed, updated annually 2. C.3.1.5 Maintenance Plan (including Nuclear Maintenance Management Plan) Approval Within 6 months of written notice to proceed, updated