National Library of Energy BETA

Sample records for mailing address control

  1. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  2. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  3. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  4. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  5. Addressable morphology control of silica structures by manipulating...

    Office of Scientific and Technical Information (OSTI)

    Addressable morphology control of silica structures by manipulating the reagent addition time Citation Details In-Document Search Title: Addressable morphology control of silica ...

  6. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  7. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  8. Addressable morphology control of silica structures by manipulating the

    Office of Scientific and Technical Information (OSTI)

    reagent addition time (Journal Article) | SciTech Connect Addressable morphology control of silica structures by manipulating the reagent addition time Citation Details In-Document Search Title: Addressable morphology control of silica structures by manipulating the reagent addition time Authors: Sharma, Jaswinder K [1] ; Datskos, Panos G [1] ; Chen, Jihua [1] + Show Author Affiliations ORNL [ORNL Publication Date: 2014-01-01 OSTI Identifier: 1110986 DOE Contract Number: DE-AC05-00OR22725

  9. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  10. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  11. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  12. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  13. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  14. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  15. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  16. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  17. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  18. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  19. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  20. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  1. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  2. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  3. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  4. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  5. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  6. Addressing Control of Hazardous Energy (COHE) Requirements in a Laser Safety Program

    SciTech Connect (OSTI)

    Woods, Michael; /SLAC

    2012-02-15

    OSHA regulation 29CFR1910.147 specifies control of hazardous energy requirements for 'the servicing and maintenance of machines and equipment in which the unexpected energization or start up of the machines or equipment, or release of stored energy could cause injury to employees.' Class 3B and Class 4 laser beams must be considered hazardous energy sources because of the potential for serious eye injury; careful consideration is therefore needed to safely de-energize these lasers. This paper discusses and evaluates control of hazardous energy principles in this OSHA regulation, in ANSI Z136.1 ''Safe Use of Lasers,'' and in ANSI Z244.1 ''Control of Hazardous Energy, Lockout/Tagout and Alternative Methods.'' Recommendations are made for updating and improving CoHE (control of hazardous energy) requirements in these standards for their applicability to safe laser operations.

  7. ASER Web Addresses and Points of Contact at DOE Sites

    Office of Environmental Management (EM)

    ASER Web Addresses and Points of Contact at DOE Sites March 29, 2013 Site and Web Address ASER Contact Name Phone E-mail Ames Laboratory http:www.ameslab.govoperationsesha...

  8. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  9. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  10. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  11. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  12. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity Addressing Cybersecurity Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. March 17, 2016 Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. Contact Richard P. Feynman Center for Innovation (505) 665-9090 Email Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the

  13. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity March 17, 2016 Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the challenges organizations face in trying to protect their data. According to Experian, the risk of a data breach is higher than ever with almost half of organizations suffering at least one security incident in the last 12 months. It's no wonder industry and government are looking for more tools to keep their data safe. To this end, in 2015, Los Alamos

  14. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  15. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  16. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  17. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  18. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  19. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  20. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  1. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  2. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  3. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  4. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  5. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  6. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  7. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  8. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  9. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  10. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  11. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  12. change_address_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CHANGE OF ADDRESS and EMERGENCY NOTIFICATION TO: HUMAN RESOURCES DATE: Z Social Security Print First Name Print Middle Name or Initial Print Last Name (Currently in Payroll...

  13. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  14. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  15. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  16. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  17. Addressing the workforce pipeline challenge

    SciTech Connect (OSTI)

    Leonard Bond; Kevin Kostelnik; Richard Holman

    2006-11-01

    A secure and affordable energy supply is essential for achieving U.S. national security, in continuing U.S. prosperity and in laying the foundations to enable future economic growth. To meet this goal the next generation energy workforce in the U.S., in particular those needed to support instrumentation, controls and advanced operations and maintenance, is a critical element. The workforce is aging and a new workforce pipeline, to support both current generation and new build has yet to be established. The paper reviews the challenges and some actions being taken to address this need.

  18. Brinkman Addresses JLab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brinkman Addresses JLab Brinkman Addresses JLab Brinkman Addresses JLab Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. "There is still a lot of interesting nuclear physics that we want to do

  19. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  20. Address:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Additive Manufacturing for Ceramics Citation Details In-Document Search Title: Additive Manufacturing for Ceramics Authors: Peterson, Dominic S. [1] + Show Author Affiliations Los Alamos National Laboratory [Los Alamos National Laboratory Publication Date: 2014-01-29 OSTI Identifier: 1119593 Report Number(s): LA-UR-14-20523 DOE Contract Number: AC52-06NA25396 Resource Type: Technical Report Research Org: Los Alamos National Laboratory (LANL) Sponsoring Org: DOE/LANL Country of Publication:

  1. Keynote Address | Department of Energy

    Office of Environmental Management (EM)

    40PM to 2:05PM PDT Pacific Ballroom Wednesday keynote address by Dan Arvizu, Director, National Renewable Energy Laboratory

  2. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  3. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  4. Keynote Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    10PM to 1:40PM PDT Pacific Ballroom Wednesday's keynote address by Dr. David Danielson, Assistant Secretary for Energy Efficiency and Renewable Energy, U.S. Department of Energy

  5. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  7. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  8. State of the Lab Address

    ScienceCinema (OSTI)

    King, Alex

    2013-03-01

    In his third-annual State of the Lab address, Ames Laboratory Director Alex King called the past year one of "quiet but strong progress" and called for Ames Laboratory to continue to build on its strengths while responding to changing expectations for energy research.

  9. Addressing Deferred Maintenance, Infrastructure Costs, and Excess...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities at Portsmouth and Paducah Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities ...

  10. POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Addressing Missclassified Positions POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions This memorandum provides policy guidance on how to consistently address misclassified positions within the Department and is effective immediately. There are several different circumstances that affect how a misclassified position will be addressed. PDF icon POLICY GUIDANCE MEMORANDUM #3A Addressing Missclassified Positions Responsible Contacts Jennifer Ackerman

  11. Addressing failures in exascale computing

    SciTech Connect (OSTI)

    Snir, Marc; Wisniewski, Robert W.; Abraham, Jacob A.; Adve, Sarita; Bagchi, Saurabh; Balaji, Pavan; Belak, Jim; Bose, Pradip; Cappello, Franck; Carlson, William; Chien, Andrew A.; Coteus, Paul; Debardeleben, Nathan A.; Diniz, Pedro; Engelmann, Christian; Erez, Mattan; Saverio, Fazzari; Geist, Al; Gupta, Rinku; Johnson, Fred; Krishnamoorthy, Sriram; Leyffer, Sven; Liberty, Dean; Mitra, Subhasish; Munson, Todd; Schreiber, Robert; Stearly, Jon; Van Hensbergen, Eric

    2014-05-01

    We present here a report produced by a workshop on Addressing Failures in Exascale Computing held in Park City, Utah, August 411, 2012. The charter of this workshop was to establish a common taxonomy about resilience across all the levels in a computing system; discuss existing knowledge on resilience across the various hardware and software layers of an exascale system; and build on those results, examining potential solutions from both a hardware and software perspective and focusing on a combined approach. The workshop brought together participants with expertise in applications, system software, and hardware; they came from industry, government, and academia; and their interests ranged from theory to implementation. The combination allowed broad and comprehensive discussions and led to this document, which summarizes and builds on those discussions.

  12. Addressing Chromium in Groundwater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Chromium in Groundwater Addressing Chromium in Groundwater From 1956 to 1972, a non-nuclear power plant at Los Alamos National Laboratory periodically flushed water out ...

  13. Deputy Secretary Poneman Addresses Nuclear Deterrence Summit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Nuclear Deterrence Summit Deputy Secretary Poneman Addresses Nuclear Deterrence Summit February 17, 2010 - 12:00am Addthis Alexandria, VA - U.S. Deputy Secretary of ...

  14. EPA -- Addressing Children's Health through Reviews Conducted...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EPA -- Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act EPA -- Addressing Children's ...

  15. Expanding Opportunity and Addressing Unique Challenges Facing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color ...

  16. Address conversion unit for multiprocessor system

    SciTech Connect (OSTI)

    Fava, T.F.; Lary, R.F.; Blackledge, R.

    1987-03-03

    An address conversion unit is described for use in one processor in a multi-processor data processing system including a common memory, the processors and common memory being interconnected by a common bus including means for transferring address signals defining a common address space. The processor includes private bus means including means for transferring signals including address signals defining a private address space. A processor unit means is connected to the private bus means and includes means for transmitting and receiving signals including address signals over the private bus means for engaging in data transfers thereover. The address conversion unit is connected to the private bus means and common bus means for receiving address signals over the private bus means from the processor unit means in the private address space. The unit comprises: A. pointer storage means for storing a pointer identifying a portion of the common bus memory space; B. pointer generation means connected to receive a common bus address and for generating a pointer in response thereto for storage in the pointer storage means; and C. common bus address generation means connected to the private bus and the pointer storage means for receiving an address from the processor unit means and for generating a common bus address in response thereto. The common bus address is used to initiate transfers between the processor unit means and the common memory over the common bus.

  17. Final Report on Internet Addressable Lightswitch

    SciTech Connect (OSTI)

    Rubinstein, Francis; Pettler, Peter

    2001-08-27

    This report describes the work performed to develop and test a new switching system and communications network that is useful for economically switching lighting circuits in existing commercial buildings. The first section of the report provides the general background of the IBECS (Integrated Building Environmental Communications System) research and development work as well as the context for the development of the new switching system. The research and development effort that went into producing the first proof-of-concept (the IBECS Addressable Power Switch or APS) and the physical prototype of that concept is detailed in the second section. In the third section of the report, we detail the refined Powerline Carrier Based IBECS Title 24 Wall Switch system that evolved from the APS prototype. The refined system provided a path for installing IBECS switching technology in existing buildings that may not be already wired for light level switching control. The final section of the report describes the performance of the IBECS Title 24 Switch system as applied to a small demonstration in two offices at LBNL's Building 90. We learned that the new Powerline Carrier control systems (A-10 technology) that have evolved from the early X-10 systems have solved most of the noise problems that dogged the successful application of X-10 technologies in commercial buildings. We found that the new A-10 powerline carrier control technology can be reliable and effective for switching lighting circuits even in electrically noisy office environments like LBNL. Thus we successfully completed the task objectives by designing, building and demonstrating a new switching system that can provide multiple levels of light which can be triggered either from specially designed wall switches or from a digital communications network. By applying commercially available powerline carrier based technologies that communicate over the in-place lighting wiring system, this type of control can be economi cally installed even in existing buildings that were not wired for dual-level lighting.

  18. Keynote Address: Future Vision | Department of Energy

    Office of Environmental Management (EM)

    Future Vision Keynote Address: Future Vision May 20, 2014 1:00PM to 1:30PM PDT Pacific Ballroom Tuesday's keynote address by Raffi Garabedian, Chief Technology Officer, First Solar

  19. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  20. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  1. The INL Seismic Risk Assessment Project: Requirements for Addressing DOE

    Office of Environmental Management (EM)

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  2. Research Projects Addressing Technical Challenges to Environmentally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acceptable Shale Gas Development Selected by DOE | Department of Energy Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE Research Projects Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE November 28, 2012 - 12:00pm Addthis Washington, DC - Fifteen research projects aimed at addressing the technical challenges of producing natural gas from shales and tight sands, while simultaneously

  3. Recommendations to Address Power Reliability Concerns Raised...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a ...

  4. Energy Department Assistant Secretary Patricia Hoffman Addresses...

    Broader source: Energy.gov (indexed) [DOE]

    for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the ... In addition, whatever local reliability challenges that could arise should be manageable ...

  5. Addressing Challenges of Identifying Geometrically Diverse Sets...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Challenges of Identifying Geometrically Diverse Sets of Crystalline Porous Materials Previous Next List R. L. Martin, B. Smit, and M. Haranczyk, J. Chem Inf. Model. 52...

  6. Addressing the Challenges of RCCI Operation on a Light-Duty Multi-Cylinder Engine

    Broader source: Energy.gov [DOE]

    ORNL and UW collaboration in evaluating and developing RCCI operation in fully built multi-cylinder engine to address hardware, aftertreatment, and control challenges

  7. Addressing the Challenges of RCCI Operation on a Light-Duty Multi...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ORNL and UW collaboration in evaluating and developing RCCI operation in fully built multi-cylinder engine to address hardware, aftertreatment, and control challenges PDF icon ...

  8. 2015 State of Indian Nations Address

    Broader source: Energy.gov [DOE]

    The President of the National Congress of American Indians will deliver his annual State of the Indian Nations address to Member of Congress, government officials, tribal leaders and citizens, and...

  9. Federal Actions to Address Impacts of Uranium

    Office of Legacy Management (LM)

    Federal Actions to Address Impacts of Uranium Contamination in the Navajo Nation 2014 Page | i TABLE OF CONTENTS Executive Summary ....................................................................................................................... 1 Introduction .................................................................................................................................... 2 Summary of Work Completed 2008-2012

  10. Shared address collectives using counter mechanisms

    DOE Patents [OSTI]

    Blocksome, Michael; Dozsa, Gabor; Gooding, Thomas M; Heidelberger, Philip; Kumar, Sameer; Mamidala, Amith R; Miller, Douglas

    2014-02-18

    A shared address space on a compute node stores data received from a network and data to transmit to the network. The shared address space includes an application buffer that can be directly operated upon by a plurality of processes, for instance, running on different cores on the compute node. A shared counter is used for one or more of signaling arrival of the data across the plurality of processes running on the compute node, signaling completion of an operation performed by one or more of the plurality of processes, obtaining reservation slots by one or more of the plurality of processes, or combinations thereof.

  11. Cheaper Adjoints by Reversing Address Computations

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hascoët, L.; Utke, J.; Naumann, U.

    2008-01-01

    The reverse mode of automatic differentiation is widely used in science and engineering. A severe bottleneck for the performance of the reverse mode, however, is the necessity to recover certain intermediate values of the program in reverse order. Among these values are computed addresses, which traditionally are recovered through forward recomputation and storage in memory. We propose an alternative approach for recovery that uses inverse computation based on dependency information. Address storage constitutes a significant portion of the overall storage requirements. An example illustrates substantial gains that the proposed approach yields, and we show use cases in practical applications.

  12. Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy ...

  13. Financing Innovation to Address Global Climate Change

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy’s Loan Programs Office (LPO) is helping address the global challenge of climate change by providing critical financing needed to deploy some of the world’s largest and most innovative clean energy and advanced technology vehicles manufacturing projects, preventing more than 25 million metric tons of CO2 emissions to date.

  14. Mapping virtual addresses to different physical addresses for value disambiguation for thread memory access requests

    DOE Patents [OSTI]

    Gala, Alan; Ohmacht, Martin

    2014-09-02

    A multiprocessor system includes nodes. Each node includes a data path that includes a core, a TLB, and a first level cache implementing disambiguation. The system also includes at least one second level cache and a main memory. For thread memory access requests, the core uses an address associated with an instruction format of the core. The first level cache uses an address format related to the size of the main memory plus an offset corresponding to hardware thread meta data. The second level cache uses a physical main memory address plus software thread meta data to store the memory access request. The second level cache accesses the main memory using the physical address with neither the offset nor the thread meta data after resolving speculation. In short, this system includes mapping of a virtual address to a different physical addresses for value disambiguation for different threads.

  15. Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session. The meeting will be livestreamed at energy.gov/live

  16. Multithreaded Global Address Space Communication Techniques

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Multithreaded Global Address Space Communication Techniques for Gyrokinetic Fusion Applications on Ultra-Scale Platforms Robert Preissl Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 rpreissl@lbl.gov Nathan Wichmann CRAY Inc. St. Paul, MN, USA, 55101 wichmann@cray.com Bill Long CRAY Inc. St. Paul, MN, USA, 55101 longb@cray.com John Shalf Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 jshalf@lbl.gov Stephane Ethier Princeton Plasma Physics Laboratory Princeton, NJ,

  17. Global-Address Space Networking (GASNet) Library

    Energy Science and Technology Software Center (OSTI)

    2011-04-06

    GASNet (Global-Address Space Networking) is a language-independent, low-level networking layer that provides network-independent, high-performance communication primitives tailored for implementing parallel global address space SPMD languages such as UPC and Titanium. The interface is primarily intended as a compilation target and for use by runtime library writers (as opposed to end users), and the primary goals are high performance, interface portability, and expressiveness. GASNet is designed specifically to support high-performance, portable implementations of global address spacemore » languages on modern high-end communication networks. The interface provides the flexibility and extensibility required to express a wide variety of communication patterns without sacrificing performance by imposing large computational overheads in the interface. The design of the GASNet interface is partitioned into two layers to maximize porting ease without sacrificing performance: the lower level is a narrow but very general interface called the GASNet core API - the design is basedheavily on Active Messages, and is implemented directly on top of each individual network architecture. The upper level is a wider and more expressive interface called GASNet extended API, which provides high-level operations such as remote memory access and various collective operations. This release implements GASNet over MPI, the Quadrics "elan" API, the Myrinet "GM" API and the "LAPI" interface to the IBM SP switch. A template is provided for adding support for additional network interfaces.« less

  18. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  19. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  20. Framework for Address Cooperative Extended Transactions

    Energy Science and Technology Software Center (OSTI)

    1997-12-01

    The Framework for Addressing Cooperative Extended Transactions (FACET) is an object-oriented software framework for building models of complex, cooperative behaviors of agents. it can be used to implement simulation models of societal processes such as the complex interplay of participating individuals and organizations engaged in multiple concurrent transactions in pursuit of their various goals. These transactions can be patterned on, for example, clinical guidelines and procedures, business practices, government and corporate policies, etc. FACET canmore » also address other complex behaviors such as biological life cycles or manufacturing processes. FACET includes generic software objects representing the fundamental classes of agent -- Person and Organization - with mechanisms for resource management, including resolution of conflicting requests for participation and/or use of the agent's resources. The FACET infrastructure supports stochastic behavioral elements and coping mechanisms by which specified special conditions and events can cause an active cooperative process to be preempted, diverting the participants onto appropriate alternative behavioral pathways.« less

  1. NEW APPROACH TO ADDRESSING GAS GENERATION IN RADIOACTIVE MATERIAL PACKAGING

    SciTech Connect (OSTI)

    Watkins, R; Leduc, D; Askew, N

    2009-06-25

    Safety Analysis Reports for Packaging (SARP) document why the transportation of radioactive material is safe in Type A(F) and Type B shipping containers. The content evaluation of certain actinide materials require that the gas generation characteristics be addressed. Most packages used to transport actinides impose extremely restrictive limits on moisture content and oxide stabilization to control or prevent flammable gas generation. These requirements prevent some users from using a shipping container even though the material to be shipped is fully compliant with the remaining content envelope including isotopic distribution. To avoid these restrictions, gas generation issues have to be addressed on a case by case basis rather than a one size fits all approach. In addition, SARP applicants and review groups may not have the knowledge and experience with actinide chemistry and other factors affecting gas generation, which facility experts in actinide material processing have obtained in the last sixty years. This paper will address a proposal to create a Gas Generation Evaluation Committee to evaluate gas generation issues associated with Safety Analysis Reports for Packaging material contents. The committee charter could include reviews of both SARP approved contents and new contents not previously evaluated in a SARP.

  2. Protocol for Addressing Induced Seismicity Associated with Enhanced...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems (EGS) Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems...

  3. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the...

  4. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of ...

  5. Addressing Uncertainties in Design Inputs: A Case Study of Probabilist...

    Office of Environmental Management (EM)

    Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF Addressing Uncertainties in Design Inputs: A Case...

  6. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy ...

  7. Opportunities for Building America Research to Address Energy...

    Energy Savers [EERE]

    Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address...

  8. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change...

  9. Energy Department Addresses Largest Gathering of Geothermal Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Largest Gathering of Geothermal Energy Stakeholders Energy Department Addresses Largest Gathering of Geothermal Energy Stakeholders October 4, 2012 - 1:00pm Addthis Photo ...

  10. DOE Convenes Multi-stakeholder Process to Address Privacy for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by Smart Grid Technologies DOE Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by ...

  11. Strategies to Address Split Incentives in Multifamily Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily Low-Income Peer Exchange Call: Strategies to Address Split ...

  12. Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen...

    Open Energy Info (EERE)

    Agenda for Addressing Climate Change in Bangladesh: Copenhagen and Beyond Jump to: navigation, search Name Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen and...

  13. Indonesia National Action Plan Addressing Climate Change | Open...

    Open Energy Info (EERE)

    National Action Plan Addressing Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Indonesia National Action Plan Addressing Climate Change AgencyCompany...

  14. New partnership uses advanced computer science modeling to address...

    National Nuclear Security Administration (NNSA)

    computer science modeling to address climate change | National Nuclear Security ... New partnership uses advanced computer science modeling to address climate change Several ...

  15. NBP RFI-Addressing Policy and Logistical Challenges to Smart...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid ...

  16. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: ...

  17. New York Independent System Operator, Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. New York Independent System Operator, Smart Grid RFI: Addressing Policy and ...

  18. Response to Request for Information titled "Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and ...

  19. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American ...

  20. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical ...

  1. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation ...

  2. Progress Energy draft regarding Smart Grid RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical ...

  3. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. ...

  4. Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges ...

  5. Assistant Secretary Patricia Hoffman to Deliver Keynote Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Patricia Hoffman to Deliver Keynote Address at IEEE PES Conference on Innovative Smart Grid Technologies Assistant Secretary Patricia Hoffman to Deliver Keynote Address at IEEE PES ...

  6. Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District Smart Grid RFI: Addressing Policy and ...

  7. DOE Action Plan Addressing the Electricity Transmission System

    Broader source: Energy.gov (indexed) [DOE]

    U.S. DEPARTMENT OF ENERGY ACTION PLAN ADDRESSING THE ELECTRICITY TRANSMISSION SYSTEM DRAFT DOE Action Plan Addressing the Electricity Transmission System 1 Table of Contents * ...

  8. U.S. Leads International Collaborative to Address Wind Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife Challenges U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife ...

  9. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials 2013 DOE ...

  10. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. ...

  11. Keynote Address: Ali Zaidi, the White House Domestic Policy Council

    Broader source: Energy.gov [DOE]

    Keynote address by Ali Zaidi, Deputy Director for Energy Policy, the White House Domestic Policy Council.

  12. Johnson Controls | Open Energy Information

    Open Energy Info (EERE)

    Controls Jump to: navigation, search Logo: Johnson Controls Name: Johnson Controls Address: 5757 N. Green Bay Avenue Place: Milwaukee, Wisconsin Zip: 53201 Sector: Efficiency...

  13. Compensated individually addressable array technology for human breast imaging

    DOE Patents [OSTI]

    Lewis, D. Kent

    2003-01-01

    A method of forming broad bandwidth acoustic or microwave beams which encompass array design, array excitation, source signal preprocessing, and received signal postprocessing. This technique uses several different methods to achieve improvement over conventional array systems. These methods are: 1) individually addressable array elements; 2) digital-to-analog converters for the source signals; 3) inverse filtering from source precompensation; and 4) spectral extrapolation to expand the bandwidth of the received signals. The components of the system will be used as follows: 1) The individually addressable array allows scanning around and over an object, such as a human breast, without any moving parts. The elements of the array are broad bandwidth elements and efficient radiators, as well as detectors. 2) Digital-to-analog converters as the source signal generators allow virtually any radiated field to be created in the half-space in front of the array. 3) Preprocessing allows for corrections in the system, most notably in the response of the individual elements and in the ability to increase contrast and resolution of signal propagating through the medium under investigation. 4) Postprocessing allows the received broad bandwidth signals to be expanded in a process similar to analytic continuation. Used together, the system allows for compensation to create beams of any desired shape, control the wave fields generated to correct for medium differences, and improve contract and resolution in and through the medium.

  14. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  15. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges. | Department of Energy RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal's core technology is the ability to understand the access control of the network as a whole - not simply the behavior of a single device. RedSeal analyzes the interactions of firewalls,

  16. Technology Plan to Address the EM Mercury Challenge

    Broader source: Energy.gov [DOE]

    EM’s Technology Plan to Address the EM Mercury Challenge addresses mercury contamination, and advocates for research and technology development to resolve key technical uncertainties with the pollutant in environmental remediation, facility deactivation and decommissioning, and tank waste processing.

  17. Moving Forward to Address Nuclear Waste Storage and Disposal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Moving Forward to Address Nuclear Waste Storage and Disposal Moving Forward to Address Nuclear Waste Storage and Disposal March 24, 2015 - 2:15pm Addthis Three trucks transport ...

  18. Keynote Address: Billy Parish of Mosaic | Department of Energy

    Office of Environmental Management (EM)

    Billy Parish of Mosaic Keynote Address: Billy Parish of Mosaic May 20, 2014 3:00PM to 3:30PM PDT Pacific Ballroom Billy Parish, President and Founder of Mosaic, will address Summit attendees

  19. How Do I Get Authorization to Work with Lasers at the ALS?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    controls (beam containment, interlocks) and administrative controls (training, signage). Through This e-mail address is being protected from spambots. You need JavaScript...

  20. Method for the electro-addressable functionalization of electrode arrays

    Office of Scientific and Technical Information (OSTI)

    (Patent) | SciTech Connect Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of electrode arrays A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable

  1. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges. Pepco Holdings, Inc. (PHI) is pleased to respond to the US Department of Energy (DOE) request for information regarding addressing policy and logistical challenges to smart grid implementation. This follows on the heels of

  2. Progress Energy draft regarding Smart Grid RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges | Department of Energy Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges PDF icon Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges More Documents & Publications Comments of DRSG to DOE Smart Grid RFI:

  3. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges. Southern recognizes that many policy and logistical concerns must be addressed for the promises of smart grid technologies and applications to be fully realized in ways that are beneficial, secure, and cost-effective

  4. Keynote Address: Update on Environmental Management | Department of Energy

    Energy Savers [EERE]

    Address: Update on Environmental Management Keynote Address: Update on Environmental Management Keynote presentation made by David G. Huizenga for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY. PDF icon Keynote Address: Update on Environmental Management More Documents & Publications Chairs Meeting - November 2013 Chairs Meeting - April 2014 Chairs Meeting - April 2013

  5. Individually addressable cathodes with integrated focusing stack or detectors

    DOE Patents [OSTI]

    Thomas, Clarence E.; Baylor, Larry R.; Voelkl, Edgar; Simpson, Michael L.; Paulus, Michael J.; Lowndes, Douglas; Whealton, John; Whitson, John C.; Wilgen, John B.

    2005-07-12

    Systems and method are described for addressable field emission array (AFEA) chips. A plurality of individually addressable cathodes are integrated with an electrostatic focusing stack and/or a plurality of detectors on the addressable field emission array. The systems and methods provide advantages including the avoidance of space-charge blow-up.

  6. Addressing Barriers to Upgrade Projects at Affordable Multifamily

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Properties (201) | Department of Energy Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Better Buildings Residential Network Peer Exchange Call Series: Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201), call slides and discussion summary. PDF icon Call Slides and Discussion Summary More Documents & Publications Incorporating Energy

  7. Addressing Climate Change with Next Generation Energy Storage Technology -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joint Center for Energy Storage Research March 19, 2015, Videos Addressing Climate Change with Next Generation Energy Storage Technology George Crabtree gives keynote at Loyola University In March 2015, George Crabtree gave the keynote address, "Addressing Climate Change with Next Generation Energy Storage Technology" at the Institute of Environmental Sustainability Climate Change Conference at Loyola University

  8. Software programs that address site-specific inventory characteristics issues.

    SciTech Connect (OSTI)

    Dare, J. H.; Cournoyer, M. E.

    2001-01-01

    The proper characterization of Hazardous, Mixed Low-Level, and Mixed Transuranic waste enhances productivity and safety. Hazardous material criteria that need to be considered include physical and health hazards inherent to the waste stream. Other factors that may influence characterization include: particulate diameter, complexing or chelating agent properties, lead, and mercury content, pressurized containers, and P-listed wastes. To meet these requirements are only a simple matter of generating a database with the proper fields. Manufactures and institutional databases bank huge sources of information, such as, work control documents, substance identification, container types, components of mixtures, physical property data, and regulatory data. In this report, utilization of commercially available software programs to take advantage of these resources in addressing waste characterization issues are presented. The application of user-friendly programs eliminates part of the tediousness associated with the complex requirements of certifying to general waste acceptance criteria with minimal impact on programmatic work. In other words, tapping into manufacturer and institutional database provides a way to take advantage of the combined expertise of these resources in managing a cost effective waste certification program as well as adding a quality assurance element to the program.

  9. Bush Administration Plays Leading Role in Studying and Addressing Global

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change | Department of Energy Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change February 27, 2007 - 3:49pm Addthis Washington, DC - Continuing to take the lead in addressing global climate change, Energy Secretary Samuel Bodman, Environmental Protection Agency (EPA) Administrator Stephen Johnson, and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice

  10. U.S. Leads International Collaborative to Address Wind Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development/Wildlife Challenges | Department of Energy U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges May 18, 2015 - 5:46pm Addthis The U.S. Department of Energy (DOE) is leading a new International Energy Agency (IEA) Wind Task to address concerns about the environmental effects of wind energy technology. Task 34, also known as WREN (Working together

  11. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Across U.S. Industry | Department of Energy Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry PDF icon eip_report_pg9.pdf More Documents & Publications ITP Energy Intensive Processes: Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy Technology Solutions Energy Technology Solutions: Public-Private

  12. Opportunities for Building America Research to Address Energy Upgrade

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Challenges: HVAC, Envelope and IAQ (301) | Department of Energy Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Better Buildings Residential Network Peer Exchange Call Series: Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ

  13. DOE Seeks Input On Addressing Contractor Pension and Medical Benefits

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Liabilities | Department of Energy Input On Addressing Contractor Pension and Medical Benefits Liabilities DOE Seeks Input On Addressing Contractor Pension and Medical Benefits Liabilities March 27, 2007 - 12:10pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced in the Federal Register that it is seeking public comment on how to address the increasing costs and liabilities of contractor employee pension and medical benefits. Under the Department of Energy's unique

  14. Working Together to Address Natural Gas Storage Safety | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Together to Address Natural Gas Storage Safety Working Together to Address Natural Gas Storage Safety April 1, 2016 - 11:15am Addthis Working Together to Address Natural Gas Storage Safety Franklin (Lynn) Orr Franklin (Lynn) Orr Under Secretary for Science and Energy Marie Therese Dominguez Marie Therese Dominguez Administrator, U.S. Department of Transportation's Pipeline and Hazardous Materials Safety Administration As a part of the Administration's ongoing commitment to support

  15. Energy Saver RSS Subscribers: Update Your Feed Address | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy RSS Subscribers: Update Your Feed Address Energy Saver RSS Subscribers: Update Your Feed Address September 28, 2015 - 12:46pm Addthis Just a short administrative note for Energy Saver RSS subscribers: our feed address is changing. To continue reading the Energy Saver Blog through your RSS feed reader, please update the link in your reader to http://energy.gov/rss/energysaver/1280681. Thanks for reading and subscribing to Energy Saver! Addthis Related Articles The Energy Savers Blog

  16. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy Feedstocks-From Field to Fuel Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Allen Julian, Chief Business Officer, MBI PDF icon julian_biomass_2014.pdf More Documents & Publications 2015 Peer Review Presentations-Biochemical Conversion 2015 Peer Review Report Process Design and

  17. Expanding Opportunity and Addressing Unique Challenges Facing Women and

    Energy Savers [EERE]

    Girls of Color | Department of Energy Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color November 17, 2014 - 11:35am Addthis When President Obama founded the White House Council on Women and Girls (CWG) within the first two months of taking office, he charged us with working to address inequalities and barriers facing women and girls in our schools, workplaces, and

  18. Secretary Chu Addresses the International Atomic Energy Agency General

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy Addresses the International Atomic Energy Agency General Conference Secretary Chu Addresses the International Atomic Energy Agency General Conference September 20, 2010 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu addressed the International Atomic Energy Agency's 54th General Conference today in Vienna. His prepared remarks are below: Thank you, Ambassador Enkhsaikhan. Congratulations on your election as President of this Conference.

  19. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges. The Department of Energy is seeking comments on policy and logistical challenges that confront smart grid implementation, as well as recommendations on how to best overcome those challenges. PDF icon Steffes Corporation

  20. Strategies to Address Split Incentives in Multifamily Buildings |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy to Address Split Incentives in Multifamily Buildings Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily / Low-Income Peer Exchange Call: Strategies to Address Split Incentives in Multifamily Buildings, Call Slides and Discussion Summary, April 26, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Outreach to Multifamily Landlords and Tenants Stewards of Affordable Housing for

  1. Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Technical Conference | Department of Energy Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference November 30, 2011 - 1:50pm Addthis WASHINGTON, D.C. - Department of Energy Assistant Secretary for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the 2011 Federal Energy Regulatory Commission technical conference in Washington, D.C.

  2. Synthetic Biology for Advanced Fuels (Opening Keynote Address...

    Office of Scientific and Technical Information (OSTI)

    Synthetic Biology for Advanced Fuels (Opening Keynote Address - 2010 JGI User Meeting) Citation Details In-Document Search Title: Synthetic Biology for Advanced Fuels (Opening ...

  3. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration ... and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice Admiral ...

  4. Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas Exhibition November 16, ... ASHGABAT, TURKMENISTAN - U.S. Secretary of Energy Samuel W. Bodman today held bilateral ...

  5. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes. Authors: Harper, Jason C. ; Polsky, ...

  6. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications Studies on Lithium Manganese Rich MNC Composite Cathodes ... Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials

  7. Address (Smart Grid Project) (France) | Open Energy Information

    Open Energy Info (EERE)

    France) Jump to: navigation, search Project Name Address Country France Coordinates 46.073231, 2.427979 Loading map... "minzoom":false,"mappingservice":"googlemaps3","type":"R...

  8. Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy...

    Energy Savers [EERE]

    Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid ... to the U.S. Department of Energy, Office of Electricity Delivery ...

  9. Africa - Technical Potential of Solar Energy to Address Energy...

    Open Energy Info (EERE)

    - Technical Potential of Solar Energy to Address Energy Poverty and Avoid GHG Emissions Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Technical Potential of Solar...

  10. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. The Alliance to Save ...

  11. Smart Grid RFI: Addressing Policy and Logistical Challenges,...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges, Comments from the Edison Electric Institute Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from the Edison Electric Institute The Edison Electric ...

  12. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of ...

  13. Ambient Corporation's Reply comments to DOE RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation's Reply comments to DOE RFI: ...

  14. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Federal Register Notice Volume 75, No. 180 - Sep. 17, 2010 Addressing Policy and Logistical Challenges to Smart Grid Implementation: Federal Register ...

  15. Addressing Policy and Logistical Challenges to smart grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    smart grid Implementation: eMeter Response to Department of Energy RFI Addressing Policy and Logistical Challenges to smart grid Implementation: eMeter Response to Department of ...

  16. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable ...

  17. Addressing mechanical reliability issues in Sandia MEMS devices...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing mechanical reliability issues in Sandia MEMS devices. No abstract prepared. Authors: Tanner, Danelle Mary, 1952- 1 ; -) ; Buchheit, Thomas E. ; Boyce, Brad Lee ...

  18. Microsoft Word - Actions to address lessons learned.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Actions to address Work Planning and Scheduling System lessons learned Action Executive owner Staff assigned Due date Understand the business environment of vendor references....

  19. Exploring the Utilization of Complex Algal Communities to Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase ...

  20. Addressing Challenging Materials at Oak Ridge National Laboratory...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing Challenging Materials at Oak Ridge National Laboratory No abstract prepared. Authors: Jubin, Robert Thomas 1 ; Patton, Bradley D 1 ; Robinson, Sharon M 1 ; ...

  1. Symbiosis: Addressing Biomass Production Challenges and Climate Change |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Symbiosis: Addressing Biomass Production Challenges and Climate Change Symbiosis: Addressing Biomass Production Challenges and Climate Change This presentation was the opening keynote of the Symbiosis Conference. PDF icon symbiosis_conference_hamilton.pdf More Documents & Publications The Future of Bioenergy Feedstock Production Symbiosis Biofeedstock Conference: Expanding Commercialization of Mutualistic Microbes to Increase Feedstock Production Symbiosis

  2. Method for the electro-addressable functionalization of electrode arrays

    DOE Patents [OSTI]

    Harper, Jason C.; Polsky, Ronen; Dirk, Shawn M.; Wheeler, David R.; Arango, Dulce C.; Brozik, Susan M.

    2015-12-15

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes.

  3. IP address management : augmenting Sandia's capabilities through open source tools.

    SciTech Connect (OSTI)

    Nayar, R. Daniel

    2005-08-01

    Internet Protocol (IP) address management is an increasingly growing concern at Sandia National Laboratories (SNL) and the networking community as a whole. The current state of the available IP addresses indicates that they are nearly exhausted. Currently SNL doesn't have the justification to obtain more IP address space from Internet Assigned Numbers Authority (IANA). There must exist a local entity to manage and allocate IP assignments efficiently. Ongoing efforts at Sandia have been in the form of a multifunctional database application notably known as Network Information System (NWIS). NWIS is a database responsible for a multitude of network administrative services including IP address management. This study will explore the feasibility of augmenting NWIS's IP management capabilities utilizing open source tools. Modifications of existing capabilities to better allocate available IP address space are studied.

  4. Ambient Control Systems | Open Energy Information

    Open Energy Info (EERE)

    Control Systems Jump to: navigation, search Logo: Ambient Control Systems Name: Ambient Control Systems Address: 1810 Gillespie Way Place: El Cajon, California Zip: 92020 Region:...

  5. Reprogrammable read only variable threshold transistor memory with isolated addressing buffer

    DOE Patents [OSTI]

    Lodi, Robert J.

    1976-01-01

    A monolithic integrated circuit, fully decoded memory comprises a rectangular array of variable threshold field effect transistors organized into a plurality of multi-bit words. Binary address inputs to the memory are decoded by a field effect transistor decoder into a plurality of word selection lines each of which activates an address buffer circuit. Each address buffer circuit, in turn, drives a word line of the memory array. In accordance with the word line selected by the decoder the activated buffer circuit directs reading or writing voltages to the transistors comprising the memory words. All of the buffer circuits additionally are connected to a common terminal for clearing all of the memory transistors to a predetermined state by the application to the common terminal of a large magnitude voltage of a predetermined polarity. The address decoder, the buffer and the memory array, as well as control and input/output control and buffer field effect transistor circuits, are fabricated on a common substrate with means provided to isolate the substrate of the address buffer transistors from the remainder of the substrate so that the bulk clearing function of simultaneously placing all of the memory transistors into a predetermined state can be performed.

  6. The State of the Ames Laboratory Address 2011

    ScienceCinema (OSTI)

    King, Alex

    2013-03-01

    Alex King, director of The Ames Laboratory, discusses the budget situation, improvements at Ames Lab and infrastructure improvements during the State of the Lab address on Tuesday, May 24, 2011.

  7. United Indigenous Voices Address Sustainability: Climate Change and Traditional Places

    Broader source: Energy.gov [DOE]

    At the First Stewards Symposium, over 300 industry and policy leaders from around the nation will discuss four main themes generated from the 2012 First Stewards Symposium that address issues...

  8. Keynote Address: Ali Zaidi, the White House Domestic Policy Council...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ali Zaidi, the White House Domestic Policy Council Keynote Address: Ali Zaidi, the White House Domestic Policy Council May 21, 2014 2:05PM to 2:30PM PDT Pacific Ballroom Keynote...

  9. Keynote Address: Cristin Dorgelo, White House Office of Science...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to ...

  10. U.S. Energy Secretary Addresses International Atomic Energy Agency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Energy Secretary Addresses International Atomic Energy Agency General Conference September 19, 2011 - 4:48pm Addthis VIENNA, AUSTRIA - U.S. Energy Secretary Steven Chu ...

  11. Chapter VII: Addressing Environmental Aspects of TS&D Infrastructure

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Environmental Aspects of TS&D Infrastructure QER ... be in demand because new classes of jobs (e.g., smart grid ... As a result, energy jobs are classified with traditional job ...

  12. The INL Seismic Risk Assessment Project: Requirements for Addressing...

    Office of Environmental Management (EM)

    The INL Seismic Risk Assessment Project: Requirements for Addressing DOE Order 420.1C & A Proposed Generic Methodology Presentation from the May 2015 Seismic Lessons-Learned Panel ...

  13. Corrective Action Plan Addressing the Accident Investigation Report

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Corrective Action Plan Addressing the Accident Investigation Report of the February 5, 2014 Fire Event and the February 14, 2014 Radiological Release Event, Rev 1 Page 2 of 89 Table of Contents 1 Purpose ................................................................................................................................................................................................ 7 2 Summary of the

  14. NERSC Implements Organizational Changes to Better Address Evolving Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environment NERSC Organizational Changes to Better Address Evolving Data Environment NERSC Implements Organizational Changes to Better Address Evolving Data Environment February 23, 2015 Contact: Jon Bashor, jbashor@lbl.gov, 510-486-5849 Sudip Dosanjh, director of the Department of Energy's National Energy Research Scientific Computing Center, announced several organizational changes to help the center's 6,000 users more productively manage their data-intensive research. The changes took

  15. Addressing Failures in Exascale Computing (Technical Report) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Technical Report: Addressing Failures in Exascale Computing Citation Details In-Document Search Title: Addressing Failures in Exascale Computing Authors: Snir, M. ; Wisniewski, R. W. ; Abraham, J. A. ; Adve, S. V. ; Bagchi, S. ; Balaji, P. ; Belak, J. ; Bose, P. ; Cappello, F. ; Carlson, B. ; Chien, A. A. ; Coteus, P. ; Debardeleben, N. A. ; Diniz, P. ; Engelmann, C. ; Erez, M. ; Fazzari, S. ; Geist, A. ; Gupta, R. ; Johnson, F. more »; Krishnamoorthy, S. ; Leyffer, S. ; Liberty, D.

  16. Exploring the Utilization of Complex Algal Communities to Address Algal

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pond Crash and Increase Annual Biomass Production for Algal Biofuels | Department of Energy Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels white paper exploring complex algal communities as a means of increasing algal biomass production PDF icon

  17. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges to Smart Grid Implementation | Department of Energy NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation The NAP Coalition is a "Coalition of Coalitions" that has been formed for the purpose of implementing the National Action Plan released by FERC in cooperation with DOE in June of 2010. Organizations working

  18. Addressing Policy and Logistical Challenges to Smart Grid Implementation

    Energy Savers [EERE]

    Before the Department of Energy Washington, D.C. 20585 In the Matter of Addressing Policy and Logistical Challenges to Smart Grid Implementation Smart Grid RFI: Addressing Policy and Logistical Challenges COMMENTS OF BALTIMORE GAS & ELECTRIC COMPANY I. Introduction BGE is the nation's oldest utility company. It has met the energy needs of Central Maryland for nearly 200 years. Today, it serves more than 1.2 million business and residential electric customers and approximately 650,000 gas

  19. Addressing Challenging Materials at Oak Ridge National Laboratory

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Addressing Challenging Materials at Oak Ridge National Laboratory Citation Details In-Document Search Title: Addressing Challenging Materials at Oak Ridge National Laboratory No abstract prepared. Authors: Jubin, Robert Thomas [1] ; Patton, Bradley D [1] ; Robinson, Sharon M [1] ; Van Hoesen, Stephen Dirk [1] + Show Author Affiliations ORNL Publication Date: 2010-01-01 OSTI Identifier: 973839 DOE Contract Number: DE-AC05-00OR22725 Resource Type: Conference

  20. Addressing mechanical reliability issues in Sandia MEMS devices.

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Addressing mechanical reliability issues in Sandia MEMS devices. Citation Details In-Document Search Title: Addressing mechanical reliability issues in Sandia MEMS devices. No abstract prepared. Authors: Tanner, Danelle Mary, 1952- [1] ; -) ; Buchheit, Thomas E. ; Boyce, Brad Lee ; Goods, Steven Howard + Show Author Affiliations (, Publication Date: 2005-02-01 OSTI Identifier: 897611 Report Number(s): SAND2005-0920C TRN: US200705%%131 DOE Contract Number:

  1. Advanced Test Reactor National Scientific User Facility: Addressing

    Office of Scientific and Technical Information (OSTI)

    advanced nuclear materials research (Conference) | SciTech Connect Advanced Test Reactor National Scientific User Facility: Addressing advanced nuclear materials research Citation Details In-Document Search Title: Advanced Test Reactor National Scientific User Facility: Addressing advanced nuclear materials research The Advanced Test Reactor National Scientific User Facility (ATR NSUF), based at the Idaho National Laboratory in the United States, is supporting Department of Energy and

  2. Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges to Smart Grid Implementation | Department of Energy Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District (The District) an Independent Special District of the State of Florida is appreciative of the opportunity to submit for your consideration the following comments in response to the U.S.

  3. PROJECT PROFILE: Addressing Soiling: From Interface Chemistry to

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Practicality | Department of Energy Addressing Soiling: From Interface Chemistry to Practicality PROJECT PROFILE: Addressing Soiling: From Interface Chemistry to Practicality Funding Opportunity: SuNLaMP SunShot Subprogram: Photovoltaics Location: National Renewable Energy Laboratory, Golden, CO Amount Awarded: $6,000,000 Natural soiling is responsible for about 4% output power loss and may be adding one cent per kilowatt hour to the levelized cost of energy (LCOE) depending on the site.

  4. DOE Awards Over a Billion Supercomputing Hours to Address Scientific

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Over a Billion Supercomputing Hours to Address Scientific Challenges DOE Awards Over a Billion Supercomputing Hours to Address Scientific Challenges January 26, 2010 - 12:00am Addthis Washington, DC. - The U.S. Department of Energy announced today that approximately 1.6 billion supercomputing processor hours have been awarded to 69 cutting-edge research projects through the Innovative and Novel Computational Impact on Theory and Experiment (INCITE) program.

  5. President Obama Praises NAMII in State of the Union Address

    Broader source: Energy.gov [DOE]

    In his 2013 State of the Union address, President Obama used the National Additive Manufacturing Institute (NAMII) as a model of the potential for innovation in manufacturing in the U.S. His address made it clear that his Administration is making the revitalization of the manufacturing sector a priority, stating that he plans to make the U.S. "a magnet for new jobs and manufacturing." He laid out a plan for spurring growth in manufacturing in the following statement:

  6. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American Society of Heating, Refrigerating and Air-Conditioning Engineers Inc. (ASHRAE), founded in 1894, is an international organization of over 50,000 members. ASHRAE fulfills its mission of advancing heating, ventilation, air conditioning and refrigeration to serve humanity and promote a

  7. Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges to Smart Grid Implementation | Department of Energy Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation submits the following comments to the US Department of Energy (DOE) in hopes that their contribution can highlight and further the understanding of the DOE on

  8. New partnership uses advanced computer science modeling to address climate

    National Nuclear Security Administration (NNSA)

    change | National Nuclear Security Administration partnership uses advanced computer science modeling to address climate change Friday, August 29, 2014 - 10:26am Several national laboratories and institutions have joined forces to develop and apply the most complete climate and Earth system model to address the most challenging and demanding climate change issues. Accelerated Climate Modeling for Energy, or ACME, is designed to accelerate the development and application of fully coupled,

  9. Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Logistical Challenges | Department of Energy Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative is a generation and transmission cooperative (G&T) that provides the wholesale electrical requirements and other services for 25 electric distribution cooperatives and 16 municipal utilities in the Upper Midwest. PDF icon Smart Grid RFI:

  10. Helping Local Officials Address Fuel Shortages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Helping Local Officials Address Fuel Shortages Helping Local Officials Address Fuel Shortages November 3, 2012 - 6:30pm Addthis The Energy Department continues to work with its federal and state partners to restore critical energy infrastructure throughout the region affected by Hurricane Sandy. The Energy Department continues to work with its federal and state partners to restore critical energy infrastructure throughout the region affected by Hurricane Sandy. Lindsey Geisler Lindsey Geisler

  11. Biosurveillance panel to address essential science for public health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Panel to address essential science for public health Biosurveillance panel to address essential science for public health A team of national experts across varied disciplines will be gathering Feb. 17 in Chicago, prepared to explore the most critical aspects of international disease awareness. February 17, 2014 Basil Swanson Basil Swanson Contact Nancy Ambrosiano Communications Office (505) 699-1149 Email "It is absolutely essential that nations are able to quickly detect and characterize a

  12. Can Cloud Computing Address the Scientific Computing Requirements for DOE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Researchers? Well, Yes, No and Maybe Can Cloud Computing Address the Scientific Computing Requirements for DOE Researchers? Well, Yes, No and Maybe Can Cloud Computing Address the Scientific Computing Requirements for DOE Researchers? Well, Yes, No and Maybe January 30, 2012 Jon Bashor, Jbashor@lbl.gov, +1 510-486-5849 Magellan1.jpg Magellan at NERSC After a two-year study of the feasibility of cloud computing systems for meeting the ever-increasing computational needs of scientists,

  13. Report Outlines Promising Opportunities for Addressing Climate Change

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Report Outlines Promising Opportunities for Addressing Climate Change For more information contact: George Douglas, 303-275-4096 email: George Douglas Golden, Colo., Nov. 15, 2000 - Researchers from five U.S. Department of Energy national laboratories, including the National Renewable Energy Laboratory, have issued a major report that finds the United States can make impressive strides toward addressing climate change through smart policies and technologies. The report, "Scenarios for a

  14. Keynote Address: Cristin Dorgelo, White House Office of Science and

    Office of Environmental Management (EM)

    Technology Policy | Department of Energy Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to 2:30PM PDT Pacific Ballroom Cristin Dorgelo, Assistant Director of Grand Challenges for The White House Office of Science and Technology Policy will deliver a keynote address

  15. Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models

    Office of Scientific and Technical Information (OSTI)

    Position Aware Linear Solid (PALS). (Conference) | SciTech Connect Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models Position Aware Linear Solid (PALS). Citation Details In-Document Search Title: Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models Position Aware Linear Solid (PALS). Abstract not provided. Authors: Mitchell, John Anthony ; Silling, Stewart Andrew Publication Date: 2013-12-01 OSTI Identifier: 1121945 Report Number(s):

  16. Wind vs. Biofuels: Addressing Climate, Health and Energy

    SciTech Connect (OSTI)

    Professor Mark Jacobson

    2007-01-29

    The favored approach today for addressing global warming is to promote a variety of options: biofuels, wind, solar thermal, solar photovoltaic, geothermal, hydroelectric, and nuclear energy and to improve efficiency. However, by far, most emphasis has been on biofuels. It is shown here, though, that current-technology biofuels cannot address global warming and may slightly increase death and illness due to ozone-related air pollution. Future biofuels may theoretically slow global warming, but only temporarily and with the cost of increased air pollution mortality. In both cases, the land required renders biofuels an impractical solution. Recent measurements and statistical analyses of U.S. and world wind power carried out at Stanford University suggest that wind combined with other options can substantially address global warming, air pollution mortality, and energy needs simultaneously.

  17. Wind versus Biofuels for Addressing Climate, Health, and Energy

    SciTech Connect (OSTI)

    Jacobson, Mark Z.

    2007-01-29

    The favored approach today for addressing global warming is to promote a variety of options: biofuels, wind, solar thermal, solar photovoltaic, geothermal, hydroelectric, and nuclear energy and to improve efficiency. However, by far, most emphasis has been on biofuels. It is shown here, though, that current-technology biofuels cannot address global warming and may slightly increase death and illness due to ozone-related air pollution. Future biofuels may theoretically slow global warming, but only temporarily and with the cost of increased air pollution mortality. In both cases, the land required renders biofuels an impractical solution. Recent measurements and statistical analyses of U.S. and world wind power carried out at Stanford University suggest that wind combined with other options can substantially address global warming, air pollution mortality, and energy needs simultaneously.

  18. Addressing the Need for Alternative Transportation Fuels: The Joint

    Office of Scientific and Technical Information (OSTI)

    BioEnergy Institute (Journal Article) | SciTech Connect Addressing the Need for Alternative Transportation Fuels: The Joint BioEnergy Institute Citation Details In-Document Search Title: Addressing the Need for Alternative Transportation Fuels: The Joint BioEnergy Institute Today, carbon-rich fossil fuels, primarily oil, coal, and natural gas, provide 85% of the energy consumed in the U.S. As world demand increases, oil reserves may become rapidly depleted. Fossil fuel use increases CO{sub

  19. Keynote Address at MIT Energy Conference 2016 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Keynote Address at MIT Energy Conference 2016 Keynote Address at MIT Energy Conference 2016 March 4, 2016 - 9:00am Addthis Well, thank you to all the students in the energy club for they have been doing and are doing today. I have to say it's great to be back on campus at this energy conference in what, for me, is a brief window between a two-year recusal of appearing at MIT to January 20th, 2017. So this is a good time to get here. It's also great to read from a distance and to - and to see up

  20. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  1. Argonne Director Eric Isaacs addresses the National Press Club

    ScienceCinema (OSTI)

    Eric Isaccs

    2010-01-08

    Argonne Director Eric Isaacs addresses the National Press Club on 9/15/2009. To build a national economy based on sustainable energy, the nation must first "reignite its innovation ecology," he said. Issacs makes the case for investing in science to secure America's future.

  2. Briefing Memo: Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session.

  3. Agenda: Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session.

  4. Plan for addressing issues relating to oil shale plant siting

    SciTech Connect (OSTI)

    Noridin, J. S.; Donovan, R.; Trudell, L.; Dean, J.; Blevins, A.; Harrington, L. W.; James, R.; Berdan, G.

    1987-09-01

    The Western Research Institute plan for addressing oil shale plant siting methodology calls for identifying the available resources such as oil shale, water, topography and transportation, and human resources. Restrictions on development are addressed: land ownership, land use, water rights, environment, socioeconomics, culture, health and safety, and other institutional restrictions. Descriptions of the technologies for development of oil shale resources are included. The impacts of oil shale development on the environment, socioeconomic structure, water availability, and other conditions are discussed. Finally, the Western Research Institute plan proposes to integrate these topics to develop a flow chart for oil shale plant siting. Western Research Institute has (1) identified relative topics for shale oil plant siting, (2) surveyed both published and unpublished information, and (3) identified data gaps and research needs. 910 refs., 3 figs., 30 tabs.

  5. Smart Grid RFI: Addressing Policy and Logistical Challenges

    Energy Savers [EERE]

    Electricity Delivery and Energy Reliability 1000 Independence Avenue, SW Room 8H033 Washington, DC 20585 Submitted electronically via smartgridpolicy@hq.doe.gov Smart Grid Request for Information: Addressing Policy and Logistical Challenges Comments of the Alliance to Save Energy The Alliance to Save Energy (the Alliance) thanks the Department of Energy for the opportunity to comment on broad issues of policy and logistical challenges faced in smart grid implementation. The Alliance to Save

  6. Addressing Policy and Logistical Challenges to Smart Grid Implementation:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments by the Office of the Ohio Consumers' Counsel | Department of Energy Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel The Office of the Ohio Consumers' Counsel ("OCC") hereby submits the following comments in response to the United States Department of Energy ("DOE") Request for Information

  7. Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Edison Electric Institute | Department of Energy Challenges, Comments from the Edison Electric Institute Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from the Edison Electric Institute The Edison Electric Institute ("EEI"), on behalf of its member companies, hereby submits the following comments in response to the request by the Department of Energy ("DOE" or "Department") for information on a wide range of issues dealing with Smart

  8. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Alliance to Save Energy. | Department of Energy Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. The Alliance to Save Energy is a coalition of prominent business, government, environmental, and consumer leaders who promote the efficient use of energy worldwide to benefit consumers, the environment, economy, and national security. The Alliance to Save Energy (the Alliance) thanks the

  9. Community Leaders to Address Energy Solutions Through Leadership Program -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL Community Leaders to Address Energy Solutions Through Leadership Program May 16, 2007 Thirteen local community leaders were chosen to join the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory's (NREL) Executive Energy Leadership program. Energy Execs will participate in monthly educational sessions covering topics such as solar technology, wind energy and transportation of the future. Sessions will include an in depth look at future markets and

  10. UK Energy Minister to Address World Renewable Energy Congress - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL UK Energy Minister to Address World Renewable Energy Congress Conference, Expo to Bring International 'Clean Energy' experts to Denver April 7, 2004 Golden, Colo. - Stephen Timms, energy minister for the United Kingdom will speak to delegates from as many as 100 nations at the opening ceremony of the eighth World Renewable Energy Congress (WREC VIII) in Denver on Aug. 30. Expected to be the world's largest gathering of renewable energy experts, WREC VIII will provide a forum

  11. Automotive Thermoelectric Generator (TEG) Controls

    Broader source: Energy.gov [DOE]

    Addresses functions to be controlled that make the difference between a barely functional and an efficient, cost-effective thermoelectric generator(TEG)

  12. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    CREATIVE ELECTRO POWER CREATIVE ELECTRO POWER kazipara mirpur Dhaka Solar IPS CONTROLLER Solar panel http www smmbd com Southern CA Area Caprock Roofing Caprock Roofing Lewisville...

  13. A novel electron gun with an independently addressable cathode array.

    SciTech Connect (OSTI)

    Rudys, Joseph Matthew; Reed, Kim Warren; Pea, Gary Edward; Schneider, Larry X.

    2006-08-01

    The design of a novel electron gun with an array of independently addressable cathode elements is presented. Issues relating to operation in a 6.5 Tesla axial magnetic field are discussed. Simulations with the TriComp [1] electromagnetic field code that were used to determine the space charge limited tube characteristic and to model focusing of the electron beam in the magnetic field are reviewed. Foil heating and stress calculations are discussed. The results of CYLTRAN [2] simulations yielding the energy spectrum of the electron beam and the current transmitted through the foil window are presented.

  14. Imulation of polymer forming processes - addressing industrial needs

    SciTech Connect (OSTI)

    Thibault, F.; DiRaddo, R. [Industrial Materials Institute-National Research Council (Canada)

    2011-05-04

    The objective of this paper is to present the development of simulation and design optimization capabilities, for polymer forming processes, in the context of addressing industrial needs. Accomplishments generated from close to twenty years of research in this field, at the National Research Council (NRC), are presented. Polymer forming processes such as extrusion blow moulding, stretch blow moulding and thermoforming have been the focus of the work, yet the research is extendable to similar polymer forming operations such as micro-blow moulding, sheet blow moulding and composites stamping. The research considers material models, process sequence integration and design optimization, derivative processes and 3D finite elements with multi-body contact.

  15. Content-addressable memory based enforcement of configurable policies

    DOE Patents [OSTI]

    Berg, Michael J

    2014-05-06

    A monitoring device for monitoring transactions on a bus includes content-addressable memory ("CAM") and a response policy unit. The CAM includes an input coupled to receive a bus transaction tag based on bus traffic on the bus. The CAM stores data tags associated with rules of a security policy to compare the bus transaction tag to the data tags. The CAM generates an output signal indicating whether one or more matches occurred. The response policy unit is coupled to the CAM to receive the output signal from the CAM and to execute a policy action in response to the output signal.

  16. Recent NRC research activities addressing valve and pump issues

    SciTech Connect (OSTI)

    Morrison, D.L.

    1996-12-01

    The mission of the U.S. Nuclear Regulatory Commission (NRC) is to ensure the safe design, construction, and operation of commercial nuclear power plants and other facilities in the U.S.A. One of the main roles that the Office of Nuclear Regulatory Research (RES) plays in achieving the NRC mission is to plan, recommend, and implement research programs that address safety and technical issues deemed important by the NRC. The results of the research activities provide the bases for developing NRC positions or decisions on these issues. Also, RES performs confirmatory research for developing the basis to evaluate industry responses and positions on various regulatory requirements. This presentation summarizes some recent RES supported research activities that have addressed safety and technical issues related to valves and pumps. These activities include the efforts on determining valve and motor-operator responses under dynamic loads and pressure locking events, evaluation of monitoring equipment, and methods for detecting and trending aging of check valves and pumps. The role that RES is expected to play in future years to fulfill the NRC mission is also discussed.

  17. CONTROL ROD

    DOE Patents [OSTI]

    Zinn, W.H.; Ross, H.V.

    1958-11-18

    A control rod is described for a nuclear reactor. In certaln reactor designs it becomes desirable to use a control rod having great width but relatively llttle thickness. This patent is addressed to such a need. The neutron absorbing material is inserted in a triangular tube, leaving volds between the circular insert and the corners of the triangular tube. The material is positioned within the tube by the use of dummy spacers to achleve the desired absorption pattern, then the ends of the tubes are sealed with suitable plugs. The tubes may be welded or soldered together to form two flat surfaces of any desired width, and covered with sheetmetal to protect the tubes from damage. This design provides a control member that will not distort under the action of outside forces or be ruptured by gases generated within the jacketed control member.

  18. Network Security Mechanisms Utilizing Dynamic Network Address Translation LDRD Project

    SciTech Connect (OSTI)

    PRICE, CARRIE M.; STANTON, ERIC; LEE, ERIK J.; MICHALSKI, JOHN T.; CHUA, KUAN SEAH; WONG, YIP HENG; TAN, CHUNG PHENG

    2002-11-01

    A new protocol technology is just starting to emerge from the laboratory environment. Its stated purpose is to provide an additional means in which networks, and the services that reside on them, can be protected from adversarial compromise. This report has a two-fold objective. First is to provide the reader with an overview of this emerging Dynamic Defenses technology using Dynamic Network Address Translation (Dynat). This ''structure overview'' is concentrated in the body of the report, and describes the important attributes of the technology. The second objective is to provide a framework that can be used to help in the classification and assessment of the different types of dynamic defense technologies along with some related capabilities and limitations. This information is primarily contained in the appendices.

  19. Western Wind Strategy: Addressing Critical Issues for Wind Deployment

    SciTech Connect (OSTI)

    Douglas Larson; Thomas Carr

    2012-03-30

    The goal of the Western Wind Strategy project was to help remove critical barriers to wind development in the Western Interconnection. The four stated objectives of this project were to: (1) identify the barriers, particularly barriers to the operational integration of renewables and barriers identified by load-serving entities (LSEs) that will be buying wind generation, (2) communicate the barriers to state officials, (3) create a collaborative process to address those barriers with the Western states, utilities and the renewable industry, and (4) provide a role model for other regions. The project has been on the forefront of identifying and informing state policy makers and utility regulators of critical issues related to wind energy and the integration of variable generation. The project has been a critical component in the efforts of states to push forward important reforms and innovations that will enable states to meet their renewable energy goals and lower the cost to consumers of integrating variable generation.

  20. GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions November ...

  1. Addressing Chromium in Groundwater WATER Los Alamos National Laboratory

    Office of Environmental Management (EM)

    NOT MEASUREMENT SENSITIVE DOE-HDBK-1211-2014 April 2014 DOE HANDBOOK ACTIVITY-LEVEL WORK PLANNING AND CONTROL IMPLEMENTATION U.S. Department of Energy AREA HDBK Washington, DC 20585 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. DOE-HDBK-1211-2014 TABLE OF CONTENTS FOREWORD .......................................................................................................................... v 1.0.

  2. Hidden benefits of electric vehicles for addressing climate change

    SciTech Connect (OSTI)

    Li, Canbing; Cao, Yijia; Zhang, Mi; Wang, Jianhui; Liu, Jianguo; Shi, Haiqing; Geng, Yinghui

    2015-03-19

    There is an increasingly hot debate on whether the replacement of conventional vehicles (CVs) by electric vehicles (EVs) should be delayed or accelerated since EVs require higher cost and cause more pollution than CVs in the manufacturing process. Here we reveal two hidden benefits of EVs for addressing climate change to support the imperative acceleration of replacing CVs with EVs. As EVs emit much less heat than CVs within the same mileage, the replacement can mitigate urban heat island effect (UHIE) to reduce the energy consumption of air conditioners, benefitting local and global climates. To demonstrate these effects brought by the replacement of CVs by EVs, we take Beijing, China, as an example. EVs emit only 19.8% of the total heat emitted by CVs per mile. The replacement of CVs by EVs in 2012 could have mitigated the summer heat island intensity (HII) by about 0.94°C, reduced the amount of electricity consumed daily by air conditioners in buildings by 14.44 million kilowatt-hours (kWh), and reduced daily CO₂ emissions by 10,686 tonnes.

  3. Addressing Energy Demand through Demand Response. International Experiences and Practices

    SciTech Connect (OSTI)

    Shen, Bo; Ghatikar, Girish; Ni, Chun Chun; Dudley, Junqiao; Martin, Phil; Wikler, Greg

    2012-06-01

    Demand response (DR) is a load management tool which provides a cost-effective alternative to traditional supply-side solutions to address the growing demand during times of peak electrical load. According to the US Department of Energy (DOE), demand response reflects “changes in electric usage by end-use customers from their normal consumption patterns in response to changes in the price of electricity over time, or to incentive payments designed to induce lower electricity use at times of high wholesale market prices or when system reliability is jeopardized.” 1 The California Energy Commission (CEC) defines DR as “a reduction in customers’ electricity consumption over a given time interval relative to what would otherwise occur in response to a price signal, other financial incentives, or a reliability signal.” 2 This latter definition is perhaps most reflective of how DR is understood and implemented today in countries such as the US, Canada, and Australia where DR is primarily a dispatchable resource responding to signals from utilities, grid operators, and/or load aggregators (or DR providers).

  4. Addressing the Need for Independence in the CSE Model

    SciTech Connect (OSTI)

    Abercrombie, Robert K; Ferragut, Erik M; Sheldon, Frederick T; Grimaila, Michael R

    2011-01-01

    Abstract Information system security risk, defined as the product of the monetary losses associated with security incidents and the probability that they occur, is a suitable decision criterion when considering different information system architectures. Risk assessment is the widely accepted process used to understand, quantify, and document the effects of undesirable events on organizational objectives so that risk management, continuity of operations planning, and contingency planning can be performed. One technique, the Cyberspace Security Econometrics System (CSES), is a methodology for estimating security costs to stakeholders as a function of possible risk postures. In earlier works, we presented a computational infrastructure that allows an analyst to estimate the security of a system in terms of the loss that each stakeholder stands to sustain, as a result of security breakdowns. Additional work has applied CSES to specific business cases. The current state-of-the-art of CSES addresses independent events. In typical usage, analysts create matrices that capture their expert opinion, and then use those matrices to quantify costs to stakeholders. This expansion generalizes CSES to the common real-world case where events may be dependent.

  5. Hidden benefits of electric vehicles for addressing climate change

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Li, Canbing; Cao, Yijia; Zhang, Mi; Wang, Jianhui; Liu, Jianguo; Shi, Haiqing; Geng, Yinghui

    2015-03-19

    There is an increasingly hot debate on whether the replacement of conventional vehicles (CVs) by electric vehicles (EVs) should be delayed or accelerated since EVs require higher cost and cause more pollution than CVs in the manufacturing process. Here we reveal two hidden benefits of EVs for addressing climate change to support the imperative acceleration of replacing CVs with EVs. As EVs emit much less heat than CVs within the same mileage, the replacement can mitigate urban heat island effect (UHIE) to reduce the energy consumption of air conditioners, benefitting local and global climates. To demonstrate these effects brought bymore » the replacement of CVs by EVs, we take Beijing, China, as an example. EVs emit only 19.8% of the total heat emitted by CVs per mile. The replacement of CVs by EVs in 2012 could have mitigated the summer heat island intensity (HII) by about 0.94°C, reduced the amount of electricity consumed daily by air conditioners in buildings by 14.44 million kilowatt-hours (kWh), and reduced daily CO₂ emissions by 10,686 tonnes.« less

  6. Regulatory approaches for addressing dissolved oxygen concerns at hydropower facilities

    SciTech Connect (OSTI)

    Peterson, Mark J.; Cada, Glenn F.; Sale, Michael J.; Eddlemon, Gerald K.

    2003-03-01

    Low dissolved oxygen (DO) concentrations are a common water quality problem downstream of hydropower facilities. At some facilities, structural improvements (e.g. installation of weir dams or aerating turbines) or operational changes (e.g., spilling water over the dam) can be made to improve DO levels. In other cases, structural and operational approaches are too costly for the project to implement or are likely to be of limited effectiveness. Despite improvements in overall water quality below dams in recent years, many hydropower projects are unable to meet state water quality standards for DO. Regulatory agencies in the U.S. are considering or implementing dramatic changes in their approach to protecting the quality of the Nations waters. New policies and initiatives have emphasized flexibility, increased collaboration and shared responsibility among all parties, and market-based, economic incentives. The use of new regulatory approaches may now be a viable option for addressing the DO problem at some hydropower facilities. This report summarizes some of the regulatory-related options available to hydropower projects, including negotiation of site-specific water quality criteria, use of biological monitoring, watershed-based strategies for the management of water quality, and watershed-based trading. Key decision points center on the health of the local biological communities and whether there are contributing impacts (i.e., other sources of low DO effluents) in the watershed. If the biological communities downstream of the hydropower project are healthy, negotiation for site-specific water quality standards or biocriteria (discharge performance criteria based on characteristics of the aquatic biota) might be pursued. If there are other effluent dischargers in the watershed that contribute to low DO problems, watershed-scale strategies and effluent trading may be effective. This report examines the value of regulatory approaches by reviewing their use in other

  7. Addressing Water Consumption of Evaporative Coolers with Greywater

    SciTech Connect (OSTI)

    Sahai, Rashmi; Shah, Nihar; Phadke, Amol

    2012-07-01

    Evaporative coolers (ECs) provide significant gains in energy efficiency compared to vapor compression air conditioners, but simultaneously have significant onsite water demand. This can be a major barrier to deployment in areas of the world with hot and arid climates. To address this concern, this study determined where in the world evaporative cooling is suitable, the water consumption of ECs in these cities, and the potential that greywater can be used reduce the consumption of potable water in ECs. ECs covered 69percent of the cities where room air conditioners are may be deployed, based on comfort conditions alone. The average water consumption due to ECs was found to be 400 L/household/day in the United States and Australia, with the potential for greywater to provide 50percent this amount. In the rest of the world, the average water consumption was 250 L/household/day, with the potential for greywater to supply 80percent of this amount. Home size was the main factor that contributed to this difference. In the Mediterranean, the Middle East, Northern India, and the Midwestern and Southwestern United States alkalinity levels are high and water used for bleeding will likely contribute significantly to EC water consumption. Although technically feasible, upfront costs for household GW systems are currently high. In both developed and developing parts of the world, however, a direct EC and GW system is cost competitive with conventional vapor compression air conditioners. Moreover, in regions of the world that face problems of water scarcity the benefits can substantially outweigh the costs.

  8. Contamination Control Techniques

    SciTech Connect (OSTI)

    EBY, J.L.

    2000-05-16

    Welcome to a workshop on contamination Control techniques. This work shop is designed for about two hours. Attendee participation is encouraged during the workshop. We will address different topics within contamination control techniques; present processes, products and equipment used here at Hanford and then open the floor to you, the attendees for your input on the topics.

  9. Gas turbine based cogeneration facilities: Key issues to be addressed at an early design stage

    SciTech Connect (OSTI)

    Vandesteene, J.L.; De Backer, J.

    1998-07-01

    The basic design of a cogeneration facility implies much more than looking for a gas turbine generating set that matches the steam host heat demand, and making an economical evaluation of the project. Tractebel Energy Engineering (TEE) has designed, built and commissioned since the early nineties 350 MW of cogeneration facilities, mainly producing electricity and steam with natural gas fired gas turbines, which is the present most common option for industrial combined heat and power production. A standardized cogeneration design does not exist. Each facility has to be carefully adapted to the steam host's particular situation, and important technical issues have to be addressed at an early stage of plant design. Unexpected problems, expensive modifications, delays during execution of the project and possible long term operational limitations or drawbacks may result if these questions are left unanswered. This paper comments the most frequent questions on design values, required flexibility of the HRSG, reliability and backup, control system, connection to the grid

  10. Hawaii Department of Health Office of Environmental Quality Control...

    Open Energy Info (EERE)

    Office of Environmental Quality Control Jump to: navigation, search Name: Hawaii Department of Health Office of Environmental Quality Control Address: 235 S. Beretania Suite 702...

  11. Recommended Practice for Securing Control System Modems | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Practice for Securing Control System Modems Recommended Practice for Securing Control System Modems This paper addresses an often overlooked "backdoor" into critical infrastructure ...

  12. Join @Energy for the 2015 State of the Union Address | Department...

    Energy Savers [EERE]

    Join @Energy for the 2015 State of the Union Address Join @Energy for the 2015 State of the Union Address January 20, 2015 - 12:08pm Addthis Join us for live coverage of the State...

  13. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments ...

  14. GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges The GridWise Alliance ...

  15. Comments of DRSG to DOE Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DRSG to DOE Smart Grid RFI: Addressing Policy and Logistical Challenges Comments of DRSG to DOE Smart Grid RFI: Addressing Policy and Logistical Challenges In light of the fact ...

  16. U-115: Novell GroupWise Client Address Book Processing Buffer Overflow Vulnerability

    Broader source: Energy.gov [DOE]

    The vulnerability is caused due to an error when processing Novell Address Book (".nab") files and can be exploited to cause a heap-based buffer overflow via an overly long email address.

  17. Controlled Unclassified Information

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Chapter 13-2 Transmission UCNI: A document containing UCNI may be transmitted by (1) U.S. First Class, Express, Certified, or Registered mail; (2) any other means approved for ...

  18. Keynote Address

    Broader source: Energy.gov [DOE]

    An overview and update on Environmental Management given by Alice Williams, Associate Principal Deputy Assistant Secretary of the Office of Environmental Management.

  19. Keynote Address

    Office of Environmental Management (EM)

    Planning & Policy EM-41 Safety Management EM-42 ... transuranic waste Moab (UT): Dispose of nearly ... 3.Water Resources 4.Human Health 5.Ecology 6.Socioeconomics ...

  20. 5-address

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  1. GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Questions | Department of Energy GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions November 23, 2015 - 2:57pm Addthis GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions The Greenhouse gases, Regulated Emissions, and Energy use in Transportation (GREET) model allows researchers and analysts to fully evaluate the energy and emission

  2. U.S. Energy Secretary Addresses International Atomic Energy Agency General

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy Addresses International Atomic Energy Agency General Conference U.S. Energy Secretary Addresses International Atomic Energy Agency General Conference September 19, 2011 - 4:48pm Addthis VIENNA, AUSTRIA - U.S. Energy Secretary Steven Chu addressed the International Atomic Energy Agency's General Conference today in Vienna. Opening with a message from President Barack Obama, Secretary Chu highlighted the importance of safety and security in the nuclear

  3. NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Implementation. September 10, 2009 | Department of Energy NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 The Telecommunications Industry Association (TIA) is pleased to provide comments on how to address the numerous challenges facing the development and deployment of smart grid technologies. Smart grid is a more robust application of

  4. Response to Request for Information titled "Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges to Smart Grid Implementation" | Department of Energy to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation." urrent smart grid initiatives are

  5. U-237: Mozilla Firefox CVE-2012-1950 Address Bar URI Spoofing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addthis PROBLEM: Mozilla Firefox CVE-2012-1950 Address Bar URI Spoofing Vulnerability PLATFORM: Version(s): Mozilla Firefox 6 - 12 ABSTRACT: To exploit this issue, an attacker...

  6. Challenges to be Addressed | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Challenges to be Addressed Advanced Scientific Computing Research (ASCR) ASCR Home About Research Applied Mathematics Computer Science Exascale Tools Workshop Programming ...

  7. JLab Will Begin Testing its Public Address System on a Monthly Basis |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jefferson Lab Will Begin Testing its Public Address System on a Monthly Basis On April 20, Jefferson Lab Will Begin Testing its Public Address System on a Monthly Basis On Wednesday, April 20, Jefferson Lab will begin conducting a monthly test of its Public Address (PA) System - the live audible announcement feature - available through the lab's Cisco phones. Starting on April 20, these tests will occur at 5:30 p.m. on the third Wednesday of each month. The Public Address System may be used

  8. RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MBG Auditorium RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big Data Challenges in Simulation-based Science Professor Manish Parashar Rutgers University ...

  9. The Lessons of Practice: Domestic Policy Reform as a Way to Address...

    Open Energy Info (EERE)

    Lessons of Practice: Domestic Policy Reform as a Way to Address Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: The Lessons of Practice: Domestic Policy...

  10. Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing Policy and Logistical Challenges to Smart Grid Implementation Galvin Electricity Initiative DOE RFI DOE RFI ...

  11. Genes and Genomics for Improving Energy Crops (Keynote Address - 2010 JGI User Meeting)

    ScienceCinema (OSTI)

    Pennell, Roger

    2011-04-28

    Roger Pennell, Vice President of Trait Development at Ceres, Inc., delivers a keynote address at the 5th Annual DOE JGI User Meeting on March 25, 2010

  12. Recommendations to Address Power Reliability Concerns Raised as a Result of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pending Environmental Regulations for Electric Generation Stations | Department of Energy to Address Power Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Memorandum from the Electricity Advisory Committee to Secretary Chu and Assistant Secretary Patricia Hoffman on recommendations to

  13. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  14. Electrically actuatable doped polymer flakes and electrically addressable optical devices using suspensions of doped polymer flakes in a fluid host

    DOE Patents [OSTI]

    Trajkovska-Petkoska, Anka; Jacobs, Stephen D.; Marshall, Kenneth L.; Kosc, Tanya Z.

    2010-05-11

    Doped electrically actuatable (electrically addressable or switchable) polymer flakes have enhanced and controllable electric field induced motion by virtue of doping a polymer material that functions as the base flake matrix with either a distribution of insoluble dopant particles or a dopant material that is completely soluble in the base flake matrix. The base flake matrix may be a polymer liquid crystal material, and the dopants generally have higher dielectric permittivity and/or conductivity than the electrically actuatable polymer base flake matrix. The dopant distribution within the base flake matrix may be either homogeneous or non-homogeneous. In the latter case, the non-homogeneous distribution of dopant provides a dielectric permittivity and/or conductivity gradient within the body of the flakes. The dopant can also be a carbon-containing material (either soluble or insoluble in the base flake matrix) that absorbs light so as to reduce the unpolarized scattered light component reflected from the flakes, thereby enhancing the effective intensity of circularly polarized light reflected from the flakes when the flakes are oriented into a light reflecting state. Electro-optic devices contain these doped flakes suspended in a host fluid can be addressed with an applied electric field, thus controlling the orientation of the flakes between a bright reflecting state and a non-reflecting dark state.

  15. Progress in Addressing DNFSB Recommendation 2002-1 Issues: Improving Accident Analysis Software Applications

    SciTech Connect (OSTI)

    VINCENT, ANDREW

    2005-04-25

    Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 2002-1 (''Quality Assurance for Safety-Related Software'') identified a number of quality assurance issues on the use of software in Department of Energy (DOE) facilities for analyzing hazards, and designing and operating controls to prevent or mitigate potential accidents. Over the last year, DOE has begun several processes and programs as part of the Implementation Plan commitments, and in particular, has made significant progress in addressing several sets of issues particularly important in the application of software for performing hazard and accident analysis. The work discussed here demonstrates that through these actions, Software Quality Assurance (SQA) guidance and software tools are available that can be used to improve resulting safety analysis. Specifically, five of the primary actions corresponding to the commitments made in the Implementation Plan to Recommendation 2002-1 are identified and discussed in this paper. Included are the web-based DOE SQA Knowledge Portal and the Central Registry, guidance and gap analysis reports, electronic bulletin board and discussion forum, and a DOE safety software guide. These SQA products can benefit DOE safety contractors in the development of hazard and accident analysis by precluding inappropriate software applications and utilizing best practices when incorporating software results to safety basis documentation. The improvement actions discussed here mark a beginning to establishing stronger, standard-compliant programs, practices, and processes in SQA among safety software users, managers, and reviewers throughout the DOE Complex. Additional effort is needed, however, particularly in: (1) processes to add new software applications to the DOE Safety Software Toolbox; (2) improving the effectiveness of software issue communication; and (3) promoting a safety software quality assurance culture.

  16. U.S.-China Clean Energy Research Center Issues Solicitation to Address the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Water Nexus | Department of Energy China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus U.S.-China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus March 4, 2015 - 4:31pm Addthis News Media Contact 202 586 4940 DOENews@hq.doe.gov U.S.-China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus WASHINGTON - Today the U.S. Department of Energy (DOE) issued a $12.5 million Funding

  17. When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! June 8, 2011 - 5:25pm Addthis Wendy Wolfson Tsabba Communications Specialist, Lawrence Berkeley National Laboratory What does this mean for me? There are "only" 3.2 billion unique addresses available across the Internet and we are quickly approaching that limit. Network engineers have been working on a new protocol called

  18. Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation

    Energy Savers [EERE]

    | Department of Energy Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation April 3, 2015 - 4:31pm Addthis What does this project do? Goal 1. Protect human health and the environment. Federal agencies recently completed a second Five-Year Plan to address uranium contamination on the Navajo Nation, which follows a progress report on the first plan that was initiated in January 2007. Contributing

  19. Oil and Gas Company Oil and Gas Company Address Place Zip Website

    Open Energy Info (EERE)

    Oil and Gas Company Address Place Zip Website Abu Dhabi National Oil Company Abu Dhabi National Oil Company Abu http www adnoc ae default aspx Al Furat Petroleum Company Al Furat...

  20. Tungsten impurity transport experiments in Alcator C-Mod to address...

    Office of Scientific and Technical Information (OSTI)

    Alcator C-Mod to address high priority research and development for ITER Citation Details In-Document Search Title: Tungsten impurity transport experiments in Alcator C-Mod to ...

  1. Energy levels of the electrons localized over the surface of an inert film with address electrodes

    SciTech Connect (OSTI)

    Petrin, A. B.

    2013-03-15

    The problem of searching for the potential energy and the energy spectrum of the electrons localized over the surface of a thin liquid or solid inert film due to address electrodes placed under the film is considered.

  2. DOE to Address Small Businesses Barriers in Government Contracting at Waste Management Conference

    Broader source: Energy.gov [DOE]

    PHOENIX – EM and the DOE Office of Small and Disadvantaged Business Utilization (OSDBU) are working to address barriers that hinder small businesses from competing for prime contracts for work in the Cold War cleanup program.

  3. April 30, 2008; HSS/Union Working Group Meeting to address training...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The following is a synthesis of actionsactivities identified in the April 30 HSSUnion meeting to address training issues with focus in the areas of the development of DOE-wide ...

  4. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry

    SciTech Connect (OSTI)

    2011-03-07

    AMO is developing advanced technologies that cut energy use and carbon emissions in some of the most energy-intensive processes within U.S. manufacturing. The brochure describes the AMO R&D projects that address these challenges.

  5. U-115: Novell GroupWise Client Address Book Processing Buffer...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    is vulnerable to an exploit where a malformed address book could cause heap memory corruption, which could lead to remote code execution under the privilege of the user that...

  6. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  7. AMO Deputy Director Addresses Water-Energy Nexus at 2016 Energy Efficiency

    Office of Environmental Management (EM)

    Global Forum | Department of Energy Deputy Director Addresses Water-Energy Nexus at 2016 Energy Efficiency Global Forum AMO Deputy Director Addresses Water-Energy Nexus at 2016 Energy Efficiency Global Forum May 20, 2016 - 3:49pm Addthis From left to right: Moderator Ramola Musante, panelists Ron Voglewede, Bill Varley, Rob Ivester, and S. Raghupathy. From left to right: Moderator Ramola Musante, panelists Ron Voglewede, Bill Varley, Rob Ivester, and S. Raghupathy. Water is a part of every

  8. New York Independent System Operator, Smart Grid RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges. | Department of Energy York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. New York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. In response to the Department of Energy's (DOE) Request for Information regarding smart grid implementation listed in the September 17, 2010 Federal Register, the New York Independent System Operator, Inc. (NYISO) offers the attached white paper entitled

  9. Recent Research to Address Technical Barriers to Increased Use of Biodiesel

    Energy Savers [EERE]

    | Department of Energy Recent Research to Address Technical Barriers to Increased Use of Biodiesel Recent Research to Address Technical Barriers to Increased Use of Biodiesel 2005 Diesel Engine Emissions Reduction (DEER) Conference Presentations and Posters PDF icon 2005_deer_clark.pdf More Documents & Publications The Advanced Collaborative Emissions Study (ACES):Phase 3 Diesel Reformers for On-board Hydrogen Applications Minimizing Lubricant-Ash Requirement and Impact on Emission

  10. Secretary Chu's Address to the IAEA General Conference in Vienna, Austria |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Address to the IAEA General Conference in Vienna, Austria Secretary Chu's Address to the IAEA General Conference in Vienna, Austria September 14, 2009 - 12:00am Addthis 53rd IAEA General Conference - As Prepared for Delivery Secretary Steven Chu Monday, September 14, 2009 Thank you, Madame President. Congratulations on your election as President of this Conference. I would also like to congratulate Ambassador Amano on his appointment as Director General. I pledge my

  11. Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing Policy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Logistical Challenges to Smart Grid Implementation | Department of Energy Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing Policy and Logistical Challenges to Smart Grid Implementation Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing Policy and Logistical Challenges to Smart Grid Implementation The Galvin Electricity Initiative, a non-profit organization, has dedicated its resources to researching and developing both prototypes and policy reforms

  12. GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges The GridWise Alliance is a coalition of over 150 companies, organizations, and academic institutions advocating for a smart grid for a more sustainable future. We are consensus-driven and technology neutral and do not advocate for specific platforms or technologies, but, rather, for policies that will

  13. Smart Grid Consortium, Response of New York State Smart Grid Addressing

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Policy and Logistical Challenges | Department of Energy Consortium, Response of New York State Smart Grid Addressing Policy and Logistical Challenges Smart Grid Consortium, Response of New York State Smart Grid Addressing Policy and Logistical Challenges It represents a unique public-private partnership of largely New York State utilities, authorities, universities, industrial companies, and institutions and research organizations which came together in a collaborative manner to facilitate

  14. BCDA - Beamline Controls and Data Acquisition Group

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * Data Acquisition * ebrick * Hardware * Software * Group Info * Sector Contacts * Knowledge Base * Meetings * Mailing list * APS PV Information * EPICS Naming Convention Print...

  15. Addressing environmental justice under the National Environment Policy Act at Sandia National Laboratories/New Mexico

    SciTech Connect (OSTI)

    Cohen, T.M.; Bleakly, D.R.

    1997-04-01

    Under Executive Order 12898, Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations, the Department of Energy (DOE) and Sandia National Laboratories New Mexico (SNL) are required to identify and address, as appropriate, disproportionately high, adverse human health or environmental effects of their activities on minority and low-income populations. The National Environmental Policy Act (NEPA) also requires that environmental justice issues be identified and addressed. This presents a challenge for SNL because it is located in a culturally diverse area. Successfully addressing potential impacts is contingent upon accurately identifying them through objective analysis of demographic information. However, an effective public participation process, which is necessarily subjective, is also needed to understand the subtle nuances of diverse populations that can contribute to a potential impact, yet are not always accounted for in a strict demographic profile. Typically, there is little or no coordination between these two disparate processes. This report proposes a five-step method for reconciling these processes and uses a hypothetical case study to illustrate the method. A demographic analysis and community profile of the population within 50 miles of SNL were developed to support the environmental justice analysis process and enhance SNL`s NEPA and public involvement programs. This report focuses on developing a methodology for identifying potentially impacted populations. Environmental justice issues related to worker exposures associated with SNL activities will be addressed in a separate report.

  16. FAQS Reference Guide – Instrumentation and Control

    Broader source: Energy.gov [DOE]

    This reference guide has been developed to address the competency statements in the June 2013 edition of DOE-Standard (STD)-1162-2013, Instrumentation and Control Functional Area Qualification Standard.

  17. U.S. Department of Energy Initiates New Outreach Efforts to Address a

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Changing Wind Industry | Department of Energy Initiates New Outreach Efforts to Address a Changing Wind Industry U.S. Department of Energy Initiates New Outreach Efforts to Address a Changing Wind Industry March 31, 2014 - 10:12am Addthis The U.S. Department of Energy (DOE) recently announced the launch of WINDExchange, a national engagement and outreach initiative that marks a new era of DOE's involvement in wind energy. Building on the success of DOE's previous work in this area, the

  18. Join @Energy for the 2016 State of the Union Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    @Energy for the 2016 State of the Union Address Join @Energy for the 2016 State of the Union Address January 11, 2016 - 11:10am Addthis Join us for live coverage of the State of the Union, starting at 9PM ET on Tuesday. | Image courtesy of Carly Wilkins. Join us for live coverage of the State of the Union, starting at 9PM ET on Tuesday. | Image courtesy of Carly Wilkins. Allison Lantero Allison Lantero Digital Content Specialist, Office of Public Affairs How can I participate? Follow along with

  19. Keynote Address to the American Council on Renewable Energy | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Address to the American Council on Renewable Energy Keynote Address to the American Council on Renewable Energy June 20, 2007 - 2:07pm Addthis Remarks Prepared for Energy Secretary Samuel W. Bodman Thank you, Michael, for that introduction and thank you all for coming. It is good to be in New York, back among the financial community. For those of you who don't know, when I left M.I.T - where I taught chemical engineering - to enter the business world I started out as a venture

  20. Secretary Moniz's Keynote Address at the ARPA-E Summit in Washington D.C.

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    -- As Delivered | Department of Energy Keynote Address at the ARPA-E Summit in Washington D.C. -- As Delivered Secretary Moniz's Keynote Address at the ARPA-E Summit in Washington D.C. -- As Delivered February 26, 2014 - 5:18pm Addthis Dr. Ernest Moniz Dr. Ernest Moniz Secretary of Energy Well, thank you, Dan (Poneman). As Dan indicated, we go back a ways and if you look at Secretaries and Deputy Secretaries and Acting Secretaries of the Department of Energy, I'm pretty sure that Dan is the

  1. Tungsten impurity transport experiments in Alcator C-Mod to address high

    Office of Scientific and Technical Information (OSTI)

    priority research and development for ITER (Journal Article) | SciTech Connect Tungsten impurity transport experiments in Alcator C-Mod to address high priority research and development for ITER Citation Details In-Document Search Title: Tungsten impurity transport experiments in Alcator C-Mod to address high priority research and development for ITER Experiments in Alcator C-Mod tokamak plasmas in the Enhanced D-alpha H-mode regime with ITER-like mid-radius plasma density peaking and Ion

  2. NNSA Administrator Addresses the Next Generation of Nuclear Security Professionals: Part 2

    ScienceCinema (OSTI)

    Thomas D'Agostino

    2010-09-01

    Administrator Thomas DAgostino of the National Nuclear Security Administration addressed the next generation of nuclear security professionals during the opening session of todays 2009 Department of Energy (DOE) Computational Science Graduate Fellowship Annual Conference. Administrator DAgostino discussed NNSAs role in implementing President Obamas nuclear security agenda and encouraged the computing science fellows to consider careers in nuclear security.

  3. DOE NSF Partnership to Address Critical Challenges in Hydrogen Production from Solar Water Splitting

    Broader source: Energy.gov [DOE]

    EERE and the National Science Foundation (NSF) announce a funding opportunity in the area of renewable hydrogen technology research and development, specifically addressing discovery and development of advanced materials systems and chemical proceesses for direct photochemical and/or thermochemical water splitting for application in the solar production of hydrogen fuel.

  4. NNSA Administrator Addresses the Next Generation of Nuclear Security Professionals: Part 1

    ScienceCinema (OSTI)

    Thomas D'Agostino

    2010-09-01

    Administrator Thomas DAgostino of the National Nuclear Security Administration addressed the next generation of nuclear security professionals during the opening session of todays 2009 Department of Energy (DOE) Computational Science Graduate Fellowship Annual Conference. Administrator DAgostino discussed NNSAs role in implementing President Obamas nuclear security agenda and encouraged the computing science fellows to consider careers in nuclear security.

  5. Dream controller

    DOE Patents [OSTI]

    Cheng, George Shu-Xing; Mulkey, Steven L; Wang, Qiang; Chow, Andrew J

    2013-11-26

    A method and apparatus for intelligently controlling continuous process variables. A Dream Controller comprises an Intelligent Engine mechanism and a number of Model-Free Adaptive (MFA) controllers, each of which is suitable to control a process with specific behaviors. The Intelligent Engine can automatically select the appropriate MFA controller and its parameters so that the Dream Controller can be easily used by people with limited control experience and those who do not have the time to commission, tune, and maintain automatic controllers.

  6. Dual arm master controller concept

    SciTech Connect (OSTI)

    Kuban, D.P.; Perkins, G.S.

    1984-01-01

    The Advanced Servomanipulator (ASM) slave was designed with an anthropomorphic stance, gear/torque tube power drives, and modular construction. These features resulted in increased inertia, friction, and backlash relative to tape-driven manipulators. Studies were performed which addressed the human factors design and performance trade-offs associated with the corresponding master controller best suited for the ASM. The results of these studies, as well as the conceptual design of the dual arm master controller, are presented. 6 references, 3 figures.

  7. Addressing the Manufacturing Issues Associated with the use of Ceramic Materials for Diesel Engine Components.

    SciTech Connect (OSTI)

    McSpadden, SB

    2001-09-12

    This CRADA supports the objective of selecting appropriate ceramic materials for manufacturing several diesel engine components and addressing critical manufacturing issues associated with these components. Materials that were evaluated included several varieties of silicon nitride and stabilized zirconia. The critical manufacturing issues that were addressed included evaluation of the effect of grain size and the effect of the grinding process on mechanical properties, mechanical performance, reliability, and expected service life. The CRADA comprised four tasks: (1) Machining of Zirconia and Silicon Nitride Materials; (2) Mechanical Properties Characterization and Performance Testing; (3) Tribological Studies; and (4) Residual Stress Studies. Using instrumented equipment at the High Temperature Materials Laboratory (HTML) Machining and Inspection Research User Center (MIRUC), zirconia and silicon nitride materials were ground into simulated component geometries. These components were subsequently evaluated for mechanical properties, wear, and residual stress characteristics in tasks two, three, and four.

  8. UNITED STATES OF AMERICA DEPARTMENT OF ENERGY Smart Grid RFI: Addressing Policy and Logistical Challenges

    Energy Savers [EERE]

    DEPARTMENT OF ENERGY Smart Grid RFI: Addressing Policy and Logistical Challenges The National Association of Regulatory Utility Commissioners (NARUC) appreciates the opportunity to provide comments to the Department of Energy (DOE) on this Request for Information (RFI) regarding the policy and logistical challenges of the smart grid. 75 Fed. Reg. 57006 (Sept. 17, 2010). INTRODUCTION NARUC is the national organization of State commissions responsible for economic and safety regulation of

  9. Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope & IAQ (301)

    Energy Savers [EERE]

    Peer Exchange Call Series: Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope & IAQ (301) July 21, 2015 Call Slides and Discussion Summary Agenda  Call Logistics and Introductions  Opening Polls  Residential Network and Peer Exchange Call Overview  Introduction to Building America Technology to Market Roadmaps  Eric Werling, Building America Program Director, DOE Building Technologies Office  Questions, Discussion, and

  10. Jackie Chen to give keynote address at ISC High performance conference in

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Germany to give keynote address at ISC High performance conference in Germany - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing

  11. Chapter VII: Addressing Environmental Aspects of TS&D Infrastructure

    Energy Savers [EERE]

    36 QER Report: Energy Transmission, Storage, and Distribution Infrastructure | April 2015 Chapter VII: Addressing Environmental Aspects of TS&D Infrastructure QER Report: Energy Transmission, Storage, and Distribution Infrastructure | April 2015 8-1 Chapter VIII This chapter gives an overview of current and projected employment in and related to the energy sector and discusses programs to assist in meeting the demand for new workers going forward. The first section provides estimates of jobs

  12. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode

    Broader source: Energy.gov (indexed) [DOE]

    Materials | Department of Energy 2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting PDF icon es161_burrell_2012_o.pdf More Documents & Publications Studies on Lithium Manganese Rich MNC Composite Cathodes Vehicle Technologies Office Merit Review 2014: Electrochemical Modeling of LMR-NMC Materials and Electrodes Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials

  13. Recommendations for Addressing Axial Burnup in the PWR Burnup Credit Analyses

    SciTech Connect (OSTI)

    Wagner, J.C.

    2002-10-23

    This report presents studies performed to support the development of a technically justifiable approach for addressing the axial-burnup distribution in pressurized-water reactor (PWR) burnup-credit criticality safety analyses. The effect of the axial-burnup distribution on reactivity and proposed approaches for addressing the axial-burnup distribution are briefly reviewed. A publicly available database of profiles is examined in detail to identify profiles that maximize the neutron multiplication factor, k{sub eff}, assess its adequacy for PWR burnup credit analyses, and investigate the existence of trends with fuel type and/or reactor operations. A statistical evaluation of the k{sub eff} values associated with the profiles in the axial-burnup-profile database was performed, and the most reactive (bounding) profiles were identified as statistical outliers. The impact of these bounding profiles on k{sub eff} is quantified for a high-density burnup credit cask. Analyses are also presented to quantify the potential reactivity consequence of loading assemblies with axial-burnup profiles that are not bounded by the database. The report concludes with a discussion on the issues for consideration and recommendations for addressing axial burnup in criticality safety analyses using burnup credit for dry cask storage and transportation.

  14. DEVICE CONTROLLER, CAMERA CONTROL

    Energy Science and Technology Software Center (OSTI)

    1998-07-20

    This is a C++ application that is the server for the cameral control system. Devserv drives serial devices, such as cameras and videoswitchers used in a videoconference, upon request from a client such as the camxfgbfbx ccint program. cc Deverv listens on UPD ports for clients to make network contractions. After a client connects and sends a request to control a device (such as to pan,tilt, or zooma camera or do picture-in-picture with a videoswitcher),more » devserv formats the request into an RS232 message appropriate for the device and sends this message over the serial port to which the device is connected. Devserv then reads the reply from the device from the serial port to which the device is connected. Devserv then reads the reply from the device from the serial port and then formats and sends via multicast a status message. In addition, devserv periodically multicasts status or description messages so that all clients connected to the multicast channel know what devices are supported and their ranges of motion and the current position. The software design employs a class hierarchy such that an abstract base class for devices can be subclassed into classes for various device categories(e.g. sonyevid30, cononvco4, panasonicwjmx50, etc.). which are further subclassed into classes for various device categories. The devices currently supported are the Sony evi-D30, Canon, VCC1, Canon VCC3, and Canon VCC4 cameras and the Panasonic WJ-MX50 videoswitcher. However, developers can extend the class hierarchy to support other devices.« less

  15. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  16. Stormwater Controls

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stormwater Controls Stormwater Controls Originally built to provide drinking water, the Los Alamos Canyon Reservoir now serves to keep flow at safe levels and slow down flood ...

  17. OMB Control No.

    Energy Savers [EERE]

    300.3 (09-93) (All other editions are obsolete) OMB Control No. 1910-0500 OMB Burden Disclosure Statement on Page 4 U.S. Department of Energy Semi-Annual Summary Report of DOE-Owned Plant and Capital Equipment (P&CE) Contractor Name Address Location of Property (City, State) Contracting Office Contract No. Asset Type Code Beginning Balance As of No. of Items $ Acquisitions No. of Items $ Dispositions No. of Items $ Ending Balance As of No. of Items $ Total Plant and Capital Equipment 1 2 3 4

  18. Controlling OSHA PSM documentation

    SciTech Connect (OSTI)

    Person, J.S. [Warren-Forthought, Inc., Angleton, TX (United States)

    1997-06-01

    At present, most companies in the hazardous materials process industries are knowledgeable in the requirements of the OSHA Process Safety Management (PSM) standard (29 CFR 1910.119), issued in May of 1992. The current question facing many of these companies is no longer ``How does one comply?`` but rather, ``What does one do with all the documentation generated from the OSHA PSM Standard?``. Using an Electronic Performance Support System (EPSS) for delivering and controlling OSHA PSM documentation will be discussed. This paper will address the important components of an EPSS and successful case studies.

  19. Addressing trend-related changes within cumulative effects studies in water resources planning

    SciTech Connect (OSTI)

    Canter, L.W.; Chawla, M.K.; Swor, C.T.

    2014-01-15

    Summarized herein are 28 case studies wherein trend-related causative physical, social, or institutional changes were connected to consequential changes in runoff, water quality, and riparian and aquatic ecological features. The reviewed cases were systematically evaluated relative to their identified environmental effects; usage of analytical frameworks, and appropriate models, methods, and technologies; and the attention given to mitigation and/or management of the resultant causative and consequential changes. These changes also represent important considerations in project design and operation, and in cumulative effects studies associated therewith. The cases were grouped into five categories: institutional changes associated with legislation and policies (seven cases); physical changes from land use changes in urbanizing watersheds (eight cases); physical changes from land use changes and development projects in watersheds (four cases); physical, institutional, and social changes from land use and related policy changes in river basins (three cases); and multiple changes within a comprehensive study of land use and policy changes in the Willamette River Basin in Oregon (six cases). A tabulation of 110 models, methods and technologies used in the studies is also presented. General observations from this review were that the features were unique for each case; the consequential changes were logically based on the causative changes; the analytical frameworks provided relevant structures for the studies, and the identified methods and technologies were pertinent for addressing both the causative and consequential changes. One key lesson was that the cases provide useful, “real-world” illustrations of the importance of addressing trend-related changes in cumulative effects studies within water resources planning. Accordingly, they could be used as an “initial tool kit” for addressing trend-related changes.

  20. The following data/assumptions will better address the LLW differences between t

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    data/assumptions will better address the LLW differences between the LEU option and the LEU/Th option of Alternative 1. 1. There is 397 kg fissile ( 233 U and 235 U) in the HTGR fuel. 2. Based on past experience of LLW to Nevada National Security Site, it is expected that the maximum quantity of fissile in a Type B shipping container (CASTOR cask) will be restricted to 1 kg. To protect a 1 kg maximum, it is assumed that 900 grams would be the maximum in a CASTOR cask. Therefore, from a fissile

  1. Addressing a single spin in diamond with a macroscopic dielectric microwave cavity

    SciTech Connect (OSTI)

    Le Floch, J.-M.; Tobar, M. E.; Bradac, C.; Nand, N.; Volz, T.; Castelletto, S.

    2014-09-29

    We present a technique for addressing single nitrogen-vacancy (NV) center spins in diamond over macroscopic distances using a tunable dielectric microwave cavity. We demonstrate optically detected magnetic resonance (ODMR) for a single negatively charged NV center (NV{sup }) in a nanodiamond (ND) located directly under the macroscopic microwave cavity. By moving the cavity relative to the ND, we record the ODMR signal as a function of position, mapping out the distribution of the cavity magnetic field along one axis. In addition, we argue that our system could be used to determine the orientation of the NV{sup } major axis in a straightforward manner.

  2. Myth-Busting2Ž: Addressing Misconceptions and Further Improving Communication During the Acquisition Process

    Energy Savers [EERE]

    MA N A G E ME N T A N D B U D G E T W A S H I N G T O N , D . C . 2 0 5 0 3 O F F I C E O F F E D E R A L May 7, 2012 P R O C U R E M E N T P O L I C Y MEMORANDUM FOR CHIEF ACQUISITION OFFICERS SENIOR PROCUREMENT EXECUTIVES CHIEF INFORMATION OFFICERS FROM: Lesley A. Field Acting Administrator for Federal Procurement Policy SUBJECT: "Myth-Busting 2": Addressing Misconceptions and Further Improving Communication During the Acquisition Process Early, frequent, and constructive engagement

  3. RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Challenges in Simulation-based Science | Princeton Plasma Physics Lab 8, 2014, 4:00pm to 5:30pm Colloquia MBG Auditorium RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big Data Challenges in Simulation-based Science Professor Manish Parashar Rutgers University Presentation: PDF icon Presentation Abstract: PDF icon COLL.01.28.14.pdf COLLOQUIUM RE-SCHEDULED FROM JAN. 22 TO JAN 28 Data-related challenges are quickly dominating computational and data-enabled sciences, and are

  4. SOFTWARE TOOLS THAT ADDRESS HAZARDOUS MATERIAL ISSUES DURING NUCLEAR FACILITY D and D

    SciTech Connect (OSTI)

    M. COURNOYER; R. GRUNDEMANN

    2001-03-01

    The 49-year-old Chemistry and Metallurgy Research (CMR) Facility is where analytical chemistry and metallurgical studies on samples of plutonium and nuclear materials are conduct in support of the Department of Energy's nuclear weapons program. The CMR Facility is expected to be decontaminated and decommissioned (D and D) over the next ten to twenty years. Over the decades, several hazardous material issues have developed that need to be address. Unstable chemicals must be properly reassigned or disposed of from the workspace during D and D operation. Materials that have critical effects that are primarily chronic in nature, carcinogens, reproductive toxin, and materials that exhibit high chronic toxicity, have unique decontamination requirements, including the decontrolling of areas where these chemicals were used. Certain types of equipment and materials that contain mercury, asbestos, lead, and polychlorinated biphenyls have special provisions that must be addressed. Utilization of commercially available software programs for addressing hazardous material issues during D and D operations such as legacy chemicals and documentation are presented. These user-friendly programs eliminate part of the tediousness associated with the complex requirements of legacy hazardous materials. A key element of this approach is having a program that inventories and tracks all hazardous materials. Without an inventory of chemicals stored in a particular location, many important questions pertinent to D and D operations can be difficult to answer. On the other hand, a well-managed inventory system can address unstable and highly toxic chemicals and hazardous material records concerns before they become an issue. Tapping into the institutional database provides a way to take advantage of the combined expertise of the institution in managing a cost effective D and D program as well as adding a quality assurance element to the program. Using laboratory requirements as a logic flow diagram, quality and cost effective methods are used to provide necessary information of programmatic, quality, and safety issues concerns. In summary, by seamlessly managing non-programmatic issues, chemical software programs allow scientists in nuclear research facilities more time to concentrate on their technical areas of interest.

  5. Method and apparatus for controlling multiple motors

    DOE Patents [OSTI]

    Jones, Rollin G.; Kortegaard, Bert L.; Jones, David F.

    1987-01-01

    A method and apparatus are provided for simultaneously controlling a plurality of stepper motors. Addressing circuitry generates address data for each motor in a periodic address sequence. Memory circuits respond to the address data for each motor by accessing a corresponding memory location containing a first operational data set functionally related to a direction for moving the motor, speed data, and rate of speed change. First logic circuits respond to the first data set to generate a motor step command. Second logic circuits respond to the command from the first logic circuits to generate a third data set for replacing the first data set in memory with a current operational motor status, which becomes the first data set when the motor is next addressed.

  6. COMPUTER SIMULATIONS TO ADDRESS PU-FE EUTECTICISSUE IN 3013 STORAGE VESSEL

    SciTech Connect (OSTI)

    Gupta, N; Allen Smith, A

    2007-03-06

    On November 22, 2005, the Manager of the Plutonium Finishing Plant (PFP) in Richland, WA issued an Occurrence Report involving a potential Pu-Fe eutectic failure mechanism for the stainless steel (SS) 3013 cans containing plutonium (Pu) metal. Four additional reports addressed nuclear safety concerns about the integrity of stainless steel containers holding plutonium during fire scenarios. The reports expressed a belief that the probability and consequences of container failure due to the formation of a plutonium-iron eutectic alloy had been overlooked. Simplified thermal model to address the Pu-Fe eutectic concerns using axisymmetric model similar to the models used in the 9975 SARP were performed. The model uses Rocky Flats configuration with 2 stacked Pu buttons inside a 3013 assembly. The assembly has an outer can, an inner can, and a convenience can, all stainless steel. The boundary conditions are similar to the regulatory 30 minutes HAC fire analyses. Computer simulations of the HAC fire transients lasting 4 hours of burn time show that the interface between the primary containment vessel and the Pu metal in the 9975 package will not reach Pu-Fe eutectic temperature of 400 C.

  7. Enabling a Highly-Scalable Global Address Space Model for Petascale Computing

    SciTech Connect (OSTI)

    Apra, Edoardo; Vetter, Jeffrey S; Yu, Weikuan

    2010-01-01

    Over the past decade, the trajectory to the petascale has been built on increased complexity and scale of the underlying parallel architectures. Meanwhile, software de- velopers have struggled to provide tools that maintain the productivity of computational science teams using these new systems. In this regard, Global Address Space (GAS) programming models provide a straightforward and easy to use addressing model, which can lead to improved produc- tivity. However, the scalability of GAS depends directly on the design and implementation of the runtime system on the target petascale distributed-memory architecture. In this paper, we describe the design, implementation, and optimization of the Aggregate Remote Memory Copy Interface (ARMCI) runtime library on the Cray XT5 2.3 PetaFLOPs computer at Oak Ridge National Laboratory. We optimized our implementation with the flow intimation technique that we have introduced in this paper. Our optimized ARMCI implementation improves scalability of both the Global Arrays (GA) programming model and a real-world chemistry application NWChem from small jobs up through 180,000 cores.

  8. System for routing messages in a vertex symmetric network by using addresses formed from permutations of the transmission line indicees

    DOE Patents [OSTI]

    Faber, Vance; Moore, James W.

    1992-01-01

    A network of interconnected processors is formed from a vertex symmetric graph selected from graphs .GAMMA..sub.d (k) with degree d, diameter k, and (d+1)!/(d-k+1)! processors for each d.gtoreq.k and .GAMMA..sub.d (k,-1) with degree 3-1, diameter k+1, and (d+1)!/(d-k+1)! processors for each d.gtoreq.k.gtoreq.4. Each processor has an address formed by one of the permutations from a predetermined sequence of letters chosen a selected number of letters at a time, and an extended address formed by appending to the address the remaining ones of the predetermined sequence of letters. A plurality of transmission channels is provided from each of the processors, where each processor has one less channel than the selected number of letters forming the sequence. Where a network .GAMMA..sub.d (k,-1) is provided, no processor has a channel connected to form an edge in a direction .delta..sub.1. Each of the channels has an identification number selected from the sequence of letters and connected from a first processor having a first extended address to a second processor having a second address formed from a second extended address defined by moving to the front of the first extended address the letter found in the position within the first extended address defined by the channel identification number. The second address is then formed by selecting the first elements of the second extended address corresponding to the selected number used to form the address permutations.

  9. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: Energy.gov [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  10. FIPA agent based network distributed control system

    SciTech Connect (OSTI)

    D. Abbott; V. Gyurjyan; G. Heyes; E. Jastrzembski; C. Timmer; E. Wolin

    2003-03-01

    A control system with the capabilities to combine heterogeneous control systems or processes into a uniform homogeneous environment is discussed. This dynamically extensible system is an example of the software system at the agent level of abstraction. This level of abstraction considers agents as atomic entities that communicate to implement the functionality of the control system. Agents' engineering aspects are addressed by adopting the domain independent software standard, formulated by FIPA. Jade core Java classes are used as a FIPA specification implementation. A special, lightweight, XML RDFS based, control oriented, ontology markup language is developed to standardize the description of the arbitrary control system data processor. Control processes, described in this language, are integrated into the global system at runtime, without actual programming. Fault tolerance and recovery issues are also addressed.

  11. The necessity for a practical approach to address organic emissions from cement kilns

    SciTech Connect (OSTI)

    Yonley, C.; Schreiber, B.; Kellerman, S.; Kellett, C.

    1998-12-31

    There is an inherent difficulty in monitoring organic emissions from hazardous waste combustion in the cement process. Data gathered by the EPA and the industry indicate that organic emissions at the main stack of cement kilns are principally from process characteristics and/or the desorption of organic constituents contained in the raw materials. Organic emissions are primarily based on the facility design and origin of the raw materials. One would generally conclude that organic emissions from fuels are essentially non-existent. To understand alternatives for monitoring organic emissions, this paper reviews some of the historical background behind the issue and reviews trends of characteristic organic emissions data. Based on this discussion and review, some approaches are presented to address organic emissions testing and monitoring when utilizing hazardous waste fuel in a cement kiln.

  12. In Situ Airborne Instrumentation: Addressing and Solving Measurement Problems in Ice Clouds

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Baumgardner, Darrel; Kok, Greg; Avallone, L.; Bansemer, A.; Borrmann, S.; Brown, P.; Bundke, U.; Chuang, P. Y.; Cziczo, D.; Field, P.; et al

    2012-02-01

    A meeting of 31 international experts on in situ measurements from aircraft was held to identify unresolved questions concerning ice formation and evolution in ice clouds, assess the current state of instrumentation that can address these problems, introduce emerging technology that may overcome current measurement issues and recommend future courses of action that can improve our understanding of ice cloud microphysical processes and their impact on the environment. The meeting proceedings and outcome has been described in detail in a manuscript submitted to the Bulletin of the American Meteorological Society (BAMS) on March 24, 2011. This paper is currently undermore » review. The remainder of this summary, in the following pages, is the text of the BAMS article. A technical note that will be published by the National Center for Atmospheric Research is currently underway and is expected to be published before the end of the year.« less

  13. In Situ Airborne Instrumentation: Addressing and Solving Measurement Problems in Ice Clouds

    SciTech Connect (OSTI)

    Baumgardner, Darrel; Kok, Greg; Avallone, L.; Bansemer, A.; Borrmann, S.; Brown, P.; Bundke, U.; Chuang, P. Y.; Cziczo, D.; Field, P.; Gallagher, M.; Gayet, J. -F.; Korolev, A.; Kraemer, M.; McFarquhar, G.; Mertes, S.; Moehler, O.; Lance, S.; Lawson, P.; Petters, M. D.; Pratt, K.; Roberts, G.; Rogers, D.; Stetzer, O.; Stith, J.; Strapp, W.; Twohy, C.; Wendisch, M.

    2012-02-01

    A meeting of 31 international experts on in situ measurements from aircraft was held to identify unresolved questions concerning ice formation and evolution in ice clouds, assess the current state of instrumentation that can address these problems, introduce emerging technology that may overcome current measurement issues and recommend future courses of action that can improve our understanding of ice cloud microphysical processes and their impact on the environment. The meeting proceedings and outcome has been described in detail in a manuscript submitted to the Bulletin of the American Meteorological Society (BAMS) on March 24, 2011. This paper is currently under review. The remainder of this summary, in the following pages, is the text of the BAMS article. A technical note that will be published by the National Center for Atmospheric Research is currently underway and is expected to be published before the end of the year.

  14. Strategies to Address Identified Education Gaps in the Preparation of a National Security Workforce

    SciTech Connect (OSTI)

    2008-06-30

    This report will discuss strategies available to address identified gaps and weaknesses in education efforts aimed at the preparation of a skilled and properly trained national security workforce.The need to adequately train and educate a national security workforce is at a critical juncture. Even though there are an increasing number of college graduates in the appropriate fields, many of these graduates choose to work in the private sector because of more desirable salary and benefit packages. This is contributing to an inability to fill vacant positions at NNSA resulting from high personnel turnover from the large number of retirements. Further, many of the retirees are practically irreplaceable because they are Cold War scientists that have experience and expertise with nuclear weapons.

  15. My Account | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    My Account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  16. User account | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User account User account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  17. The Challenges and Potential of Nuclear Energy for Addressing Climate Change

    SciTech Connect (OSTI)

    Kim, Son H.; Edmonds, James A.

    2007-10-24

    The response to climate change and the stabilization of atmospheric greenhouse gas concentrations has major implications for the global energy system. Stabilization of atmospheric carbon dioxide (CO2) concentrations requires a peak and an indefinite decline of global CO2 emissions. Nuclear energy, along with other technologies, has the potential to contribute to the growing demand for energy without emitting CO2. Nuclear energy is of particular interest because of its global prevalence and its current significant contribution, nearly 20%, to the world’s electricity supply. We have investigated the value of nuclear energy in addressing climate change, and have explored the potential challenges for the rapid and large-scale expansion of nuclear energy as a response to climate change. The scope of this study is long-term and the modeling time frame extends out a century because the nature of nuclear energy and climate change dictate that perspective. Our results indicate that the value of the nuclear technology option for addressing climate change is denominated in trillions of dollars. Several-fold increases to the value of the nuclear option can be expected if there is limited availability of competing carbon-free technologies, particularly fossil-fuel based technologies that can capture and sequester carbon. Challenges for the expanded global use of nuclear energy include the global capacity for nuclear construction, proliferation, uranium availability, and waste disposal. While the economic costs of nuclear fuel and power are important, non-economic issues transcend the issues of costs. In this regard, advanced nuclear technologies and new vision for the global use of nuclear energy are important considerations for the future of nuclear power and climate change.

  18. Utility Regulation and Business Model Reforms for Addressing the Financial Impacts of Distributed Solar on Utilities

    Broader source: Energy.gov [DOE]

    Implementing a range of alternative utility-rate reforms could minimize solar value losses at increasing levels of distributed PV penetration (see Barbose et al. 2016). In conjunction with the technical issues described above, the connections between distributed PV and electric distribution systems hinge on utility business models and regulations. As PV deployment has leapt forward and presaged a truly significant solar contribution, however, it has become clear that utilities’ traditional treatment of distributed PV cannot be taken for granted—nor can the future value and deployment of distributed PV. At the heart of this issue is net energy metering (NEM). Under NEM, PV owners can sell to a utility the electricity they generate but cannot consume on site, often at full retail rates. This widespread policy has helped drive the rapid growth of distributed PV, but the success has raised concerns about the potential for higher electricity rates and cost-shifting to non-solar customers, reduced utility shareholder profitability, reduced utility earnings opportunities, and inefficient resource allocation. The resulting reform efforts have revolved largely around changing NEM rules and retail rate structures. Most of the reforms to date address NEM concerns by reducing the benefits provided to distributed PV customers and thus constraining PV deployment. A new analysis estimates that eliminating NEM nationwide, by compensating exports of PV electricity at wholesale rather than retail rates would cut cumulative distributed PV deployment by 20% in 2050 compared with a continuation of current policies. This would slow the PV cost reductions that arise from larger scale and market certainty. It could also thwart achievement of the SunShot deployment goals even if the initiative’s cost targets are achieved. This undesirable prospect is stimulating the development of alternative reform strategies that address concerns about distributed PV compensation without inordinately harming PV economics and growth.

  19. Stormwater Controls

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stormwater Controls Stormwater Controls Originally built to provide drinking water, the Los Alamos Canyon Reservoir now serves to keep flow at safe levels and slow down flood impacts. August 1, 2013 Los Alamos Canyon Reservoir Los Alamos Canyon Reservoir

  20. Project Controls

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-03-28

    Project controls are systems used to plan, schedule, budget, and measure the performance of a project/program. The cost estimation package is one of the documents that is used to establish the baseline for project controls. This chapter gives a brief description of project controls and the role the cost estimation package plays.

  1. S. 276: A Bill to amend the Surface Mining Control and Reclamation Act of 1977 to improve control of acid mine drainage, and for other purposes. Introduced in the Senate of the United States, One Hundred Third Congress, First Session, February 2, 1993

    SciTech Connect (OSTI)

    Not Available

    1993-01-01

    This bill amends the Surface Mining Control and Reclamation Act of 1977 to improve control of acid mine drainage. State use of funds is addressed.

  2. Addressing the Federal-State-Local Interface Issues During a Catastrophic Event Such as an Anthrax Attack

    SciTech Connect (OSTI)

    Stein, Steven L.; Lesperance, Ann M.; Upton, Jaki F.

    2010-02-01

    On October 9, 2008, federal, state and local policy makers, emergency managers, and medical and public health officials convened in Seattle, Washington, for a workshop on Addressing the Federal-State-Local Interface Issues During a Catastrophic Event Such as an Anthrax Attack. The day-long symposium was aimed at generating a dialogue about recovery and restoration through a discussion of the associated challenges that impact entire communities, including people, infrastructure, and critical systems. The Principal Federal Official (PFO) provided an overview of the role of the PFO in a catastrophic event. A high-level summary of an anthrax scenario was presented. The remainder of the day was focused on interactive discussions among federal, state and local emergency management experts in the areas of: • Decision-making, prioritization, and command and control • Public health/medical services • Community resiliency and continuity of government. Key topics and issues that resulted from discussions included: • Local representation in the Joint Field Office (JFO) • JFO transition to the Long-Term Recovery Office • Process for prioritization of needs • Process for regional coordination • Prioritization - process and federal/military intervention • Allocation of limited resources • Re-entry decision and consistency • Importance of maintaining a healthy hospital system • Need for a process to establish a consensus on when it is safe to re-enter. This needs to be across all jurisdictions including the military. • Insurance coverage for both private businesses and individuals • Interaction between the government and industry. The symposium was sponsored by the Interagency Biological Restoration Demonstration, a collaborative regional program jointly funded by the U.S. Department of Homeland Security and the U.S. Department of Defense. To aid the program’s efforts and inform the development of blueprint for recovery from a biological incident, this report presents the key issues identified at the symposium.

  3. Addressing Facility Needs for Concrete Assessment Using Ultrasonic Testing: Mid-year Report

    SciTech Connect (OSTI)

    Ulrich, Timothy J. II; Payan, Cedric; Roberts, Peter M.

    2012-03-28

    The UFD Gap Analysis to Support Extended Storage of Used Nuclear Fuel (June 30, 2011) emphasizes the need for the development of monitoring techniques and technologies for dry storage cask materials. A high priority is given to the development of 'systems for early detection of confinement boundary degradation.' This requires both new techniques for monitoring and inspection, as well as new measurable parameters to quantify mechanical degradation. The use of Nonlinear Elastic Wave Spectroscopy (NEWS) has been shown to provide sensitive parameters correlating to mechanical degradation in a wide variety of materials. Herein we report upon recent research performed to address the high priority of concrete degradation using a selection of these techniques and compare to a ASTM standard ultrasonic technique. Also reported are the near term plans to continue this research in the remaining FY and into the coming years. This research was conducted at Los Alamos National Laboratory (LANL) in the Acoustics Lab of the Geophysics group in the Earth and Environmental Sciences division, and in collaboration with the Laboratory for Nondestructive Evaluation at the University of the Mediterranean (Aix en Provence, France) and the Electrical Power Research Institute (EPRI). The objective of this research project was to determine the feasibility of using an NDE technique based on non-linear ultrasound for determining the depth and degree of microcracking in the near surface of concrete and to assess the degree of sensitivity of such technique. This objective is reached by the means of combining linear and nonlinear measurements, associated with numerical simulation. We first study the global effect of thermal damage on concrete's linear and nonlinear properties by resonance inspection techniques. We show that standard pulse wave speed techniques are not relevant to extract mechanical properties of concrete. The high sensitivity of measured nonlinearity is shown and serves as a validation tool for the rest of the study, i.e., probing the material nonlinearity at various depths through the use of Time Reversal Elastic Nonlinearity Diagnostic (TREND). The basic idea of probing the material nonlinearity at various depths by changing the frequency is validated by exhibiting a similar trend as nonlinear resonance measurements. We address at the end of this report, the potentialities of applying these procedures to real concrete structures.

  4. 20% Wind Energy - Diversifying Our Energy Portfolio and Addressing Climate Change (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2008-05-01

    This brochure describes the R&D efforts needed for wind energy to meet 20% of the U.S. electrical demand by 2030. In May 2008, DOE published its report, 20% Wind Energy by 2030, which presents an in-depth analysis of the potential for wind energy in the United States and outlines a potential scenario to boost wind electric generation from its current production of 16.8 gigawatts (GW) to 304 GW by 2030. According to the report, achieving 20% wind energy by 2030 could help address climate change by reducing electric sector carbon dioxide (CO2) emissions by 825 million metric tons (20% of the electric utility sector CO2 emissions if no new wind is installed by 2030), and it will enhance our nation's energy security by diversifying our electricity portfolio as wind energy is an indigenous energy source with stable prices not subject to fuel volatility. According to the report, increasing our nation's wind generation could also boost local rural economies and contribute to significant growth in manufacturing and the industry supply chain. Rural economies will benefit from a substantial increase in land use payments, tax benefits and the number of well-paying jobs created by the wind energy manufacturing, construction, and maintenance industries. Although the initial capital costs of implementing the 20% wind scenario would be higher than other generation sources, according to the report, wind energy offers lower ongoing energy costs than conventional generation power plants for operations, maintenance, and fuel. The 20% scenario could require an incremental investment of as little as $43 billion (net present value) more than a base-case no new wind scenario. This would represent less than 0.06 cent (6 one-hundredths of 1 cent) per kilowatt-hour of total generation by 2030, or roughly 50 cents per month per household. The report concludes that while achieving the 20% wind scenario is technically achievable, it will require enhanced transmission infrastructure, streamlined siting and permitting regimes, improved reliability and operability of wind systems, and increased U.S. wind manufacturing capacity. To meet these challenges, the DOE Wind Energy Program will continue to work with industry partners to increase wind energy system reliability and operability and improve manufacturing processes. The program also conducts research to address transmission and grid integration issues, to better understand wind resources, to mitigate siting and environmental issues, to provide information to industry stakeholders and policy makers, and to educate the future generations.

  5. How ATP3 is Addressing the Challenges of Scale-up in Algae Technology R&D |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy How ATP3 is Addressing the Challenges of Scale-up in Algae Technology R&D How ATP3 is Addressing the Challenges of Scale-up in Algae Technology R&D Breakout Session 2-A: The Future of Algae-Based Biofuels How ATP3 is Addressing the Challenges of Scale-up in Algae Technology R&D Dr. John McGowen, Director of Operations and Program Manager, Arizona Center for Algae Technology and Innovation: Arizona State University PDF icon mcgowen_bioenergy_2015.pdf More

  6. APRIL 30, 2008, HSS/UNION MEETING TO ADDRESS TRAINING INTEGRATED EXECUTIVE SUMMARY AND FINAL ACTION LIST

    Energy Savers [EERE]

    HSS/UNION MEETING TO ADDRESS TRAINING INTEGRATED EXECUTIVE SUMMARY AND FINAL ACTION LIST HSS and the labor unions who participated in the initial 2007 HSS Focus Group meetings agreed to a path forward in which various unions combined to form core working groups to address union identified issues by topical area. The following is a synthesis of actions/activities identified in the April 30 HSS/Union meeting to address training issues with focus in the areas of the development of DOE-wide HAMMER

  7. Architectural Framework for Addressing Legacy Waste from the Cold War - 13611

    SciTech Connect (OSTI)

    Love, Gregory A.; Glazner, Christopher G.; Steckley, Sam

    2013-07-01

    We present an architectural framework for the use of a hybrid simulation model of enterprise-wide operations used to develop system-level insight into the U.S. Department of Energy's (DOE) environmental cleanup of legacy nuclear waste at the Savannah River Site. We use this framework for quickly exploring policy and architectural options, analyzing plans, addressing management challenges and developing mitigation strategies for DOE Office of Environmental Management (EM). The socio-technical complexity of EM's mission compels the use of a qualitative approach to complement a more a quantitative discrete event modeling effort. We use this model-based analysis to pinpoint pressure and leverage points and develop a shared conceptual understanding of the problem space and platform for communication among stakeholders across the enterprise in a timely manner. This approach affords the opportunity to discuss problems using a unified conceptual perspective and is also general enough that it applies to a broad range of capital investment/production operations problems. (authors)

  8. Microsoft Word - Frequency Control 20603.doc

    Office of Scientific and Technical Information (OSTI)

    2544 Engineering Hall, 1415 Engineering Drive, Madison, WI 53706, E-mail: Alvarado@engr.wisc.edu 14. Vikram S. Budhraja, President, Electric Power Group, LLC, 201 South Lake...

  9. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to pf-lepd@osti.gov. Need to change OPMO contact (i.e., e-mail, name, telephone ...

  10. Radiological Control

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2009-06-16

    The Department of Energy (DOE) has developed this Standard to assist line managers in meeting their responsibilities for implementing occupational radiological control programs.

  11. Executive Order 12898: Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations (1994)

    Broader source: Energy.gov [DOE]

    Executive Order 12898: Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations (1994).  Directs each federal agency to make environmental justice part of...

  12. Development and Technology Programs to address research and development needs of the Engineering Test Facility

    SciTech Connect (OSTI)

    1980-10-01

    The following topics are covered in this report: (1) toroidal field system, (2) induction and poloidal field coil systems, (3) neutral beam heating system, (4) rf heating, (5) mm wave rf plasma breakdown, (6) divertors/limiters, (7) fuel injection, (8) tritium system, (9) materials, (10) vacuum, (11) instrumentation and control, (12) neutronics, (13) first wall, blanket and shield, (14) maintenance, and (15) environment and safety. (MOW)

  13. Addressing Uncertainty in Desigh Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF

    Office of Environmental Management (EM)

    Before the Department of Energy Washington, D.C. 20585 In the Matter of Addressing Policy and Logistical Challenges to Smart Grid Implementation Smart Grid RFI: Addressing Policy and Logistical Challenges COMMENTS OF BALTIMORE GAS & ELECTRIC COMPANY I. Introduction BGE is the nation's oldest utility company. It has met the energy needs of Central Maryland for nearly 200 years. Today, it serves more than 1.2 million business and residential electric customers and approximately 650,000 gas

  14. The European Safeguards Research and Development Association Addresses Safeguards and Nonproliferation

    SciTech Connect (OSTI)

    Janssens-Maenhout, Greet; Kusumi, R.; Daures, Pascal A.; Janssens, Willem; Dickman, Deborah A.

    2010-06-16

    The renaissance of efforts to expand the use of nuclear energy requires the parallel development of a renewed and more sophisticated work force. Growth in the nuclear sector with high standard of safety, safeguards and security requires skilled staff for design, operations, inspections etc. High-quality nuclear technology educational programs are diminished from past years, and the ability of universities to attract students and to meet future staffing requirements of the nuclear industry is becoming seriously compromised. Thus, education and training in nuclear engineering and sciences is one of the cornerstones for the nuclear sector. Teaching in the nuclear field still seems strongly influenced by national history but it is time to strengthen resources and collaborate. Moreover with the current nuclear security threats it becomes critical that nuclear technology experts master the basic principles not only of safety, but also of nuclear safeguards, nonproliferation and nuclear security. In Europe the European Nuclear Education Network (ENEN) Association has established the certificate 'European Master of Science in Nuclear Engineering (EMSNE)' as the classic nuclear engineering program covering reactor operation and nuclear safety. However, it does not include courses on nonproliferation, safeguards, or dual-use technologies. The lack of education in nuclear safeguards was tackled by the European Safeguards Research and Development Association (ESARDA), through development and implementation of safeguards course modules. Since 2005 the ESARDA Working Group, called the Training and Knowledge Management Working Group, (TKMWG) has worked with the Joint Research Centre (JRC) in Ispra, Italy to organize a Nuclear Safeguards and Nonproliferation course. This five-day course is held each spring at the JRC, and continues to show increasing interest as evidenced by the positive responses of international lecturers and students. The standard set of lectures covers a broad range of subjects, including nuclear material accountancy principles, legal definitions and the regulatory base and inspection tools and techniques. This 60% core part is given by representatives from regulatory bodies (The International Atomic Energy Agency (IAEA), Institute for Radiological Protection and Nuclear Safety, Directorate General for Nuclear Energy and Transport), industry (AREVA, British Nuclear Group), and research (Stockholm University, Hamburg University, Joint Research Centre-Institute of Transuranic Elements, and Joint Research Centre-Institute for the Protection of the Citizen). The remaining part is completed with topical lectures addressed by invited lecturers, such as from Pacific Northwest National Laboratory and the IAEA addressing topics of physical protection, illicit trafficking, the Iraq case study, exercises, including satellite imagery interpretation etc. With this structure of a stable core plus a variable set of invited lectures, the course will remain sustainable and up-to-date. A syllabus provides the students a homogeneous set of information material in nuclear safeguards and nonproliferation matters at the European and international level. In this way, the ESARDA TKMWG aims to contribute to a two-fold scientific-technical and political-juridical education and training.

  15. CONTROL ROD

    DOE Patents [OSTI]

    Walker, D.E.; Matras, S.

    1963-04-30

    This patent shows a method of making a fuel or control rod for a nuclear reactor. Fuel or control material is placed within a tube and plugs of porous metal wool are inserted at both ends. The metal wool is then compacted and the tube compressed around it as by swaging, thereby making the plugs liquid- impervious but gas-pervious. (AEC)

  16. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  17. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  18. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  19. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  20. Radiological Control

    National Nuclear Security Administration (NNSA)

    RADIOLOGICAL CONTROL U.S. Department of Energy SAFT Washington, D.C. 20585 DISTRIBUTION ... DOE-STD-1098-2008 ii This document is available on the Department of Energy Technical ...

  1. REACTOR CONTROL

    DOE Patents [OSTI]

    Fortescue, P.; Nicoll, D.

    1962-04-24

    A control system employed with a high pressure gas cooled reactor in which a control rod is positioned for upward and downward movement into the neutron field from a position beneath the reactor is described. The control rod is positioned by a coupled piston cylinder releasably coupled to a power drive means and the pressurized coolant is directed against the lower side of the piston. The coolant pressure is offset by a higher fiuid pressure applied to the upper surface of the piston and means are provided for releasing the higher pressure on the upper side of the piston so that the pressure of the coolant drives the piston upwardly, forcing the coupled control rod into the ncutron field of the reactor. (AEC)

  2. CONTROL SYSTEM

    DOE Patents [OSTI]

    Shannon, R.H.; Williamson, H.E.

    1962-10-30

    A boiling water type nuclear reactor power system having improved means of control is described. These means include provisions for either heating the coolant-moderator prior to entry into the reactor or shunting the coolantmoderator around the heating means in response to the demand from the heat engine. These provisions are in addition to means for withdrawing the control rods from the reactor. (AEC)

  3. Using Solar Hot Water to Address Piping Heat Losses in Multifamily Buildings

    SciTech Connect (OSTI)

    Springer, David; Seitzler, Matt; Backman, Christine; Weitzel, Elizabeth

    2015-10-01

    Solar thermal water heating is most cost effective when applied to multifamily buildings and some states offer incentives or other inducements to install them. However, typical solar water heating designs do not allow the solar generated heat to be applied to recirculation losses, only to reduce the amount of gas or electric energy needed for hot water that is delivered to the fixtures. For good reasons, hot water that is recirculated through the building is returned to the water heater, not to the solar storage tank. The project described in this report investigated the effectiveness of using automatic valves to divert water that is normally returned through the recirculation piping to the gas or electric water heater instead to the solar storage tank. The valves can be controlled so that the flow is only diverted when the returning water is cooler than the water in the solar storage tank.

  4. Feasibility of EGS Well Control Systems

    SciTech Connect (OSTI)

    Norann, Randy A; Darlow, Richard

    2015-02-03

    This report covers the 8th major objective listed in Grant DE-FG36-08GO18185. This objective takes the information and experience gained from the development of 300°C well monitoring system and applies them to concepts envisioned for future geothermal well control systems supporting EGS power production. This report covers a large number of instrumentation and control system engineering issues for EGS wells while also providing a window into existing technology to address those issues.

  5. Addressing the Challenges of Anomaly Detection for Cyber Physical Energy Grid Systems

    SciTech Connect (OSTI)

    Ferragut, Erik M; Laska, Jason A; Melin, Alexander M; Czejdo, Bogdan

    2013-01-01

    The consolidation of cyber communications networks and physical control systems within the energy smart grid introduces a number of new risks. Unfortunately, these risks are largely unknown and poorly understood, yet include very high impact losses from attack and component failures. One important aspect of risk management is the detection of anomalies and changes. However, anomaly detection within cyber security remains a difficult, open problem, with special challenges in dealing with false alert rates and heterogeneous data. Furthermore, the integration of cyber and physical dynamics is often intractable. And, because of their broad scope, energy grid cyber-physical systems must be analyzed at multiple scales, from individual components, up to network level dynamics. We describe an improved approach to anomaly detection that combines three important aspects. First, system dynamics are modeled using a reduced order model for greater computational tractability. Second, a probabilistic and principled approach to anomaly detection is adopted that allows for regulation of false alerts and comparison of anomalies across heterogeneous data sources. Third, a hierarchy of aggregations are constructed to support interactive and automated analyses of anomalies at multiple scales.

  6. ADDRESSING POLLUTION PREVENTION ISSUES IN THE DESIGN OF A NEW NUCLEAR RESEARCH FACILITY

    SciTech Connect (OSTI)

    Cournoyer, Michael E.; Corpion, Juan; Nelson, Timothy O.

    2003-02-27

    The Chemistry and Metallurgical Research (CMR) Facility was designed in 1949 and built in 1952 at Los Alamos National Laboratory (LANL) to support analytical chemistry, metallurgical studies, and actinide research and development on samples of plutonium and other nuclear materials for the Atomic Energy Commission's nuclear weapons program. These primary programmatic uses of the CMR Facility have not changed significantly since it was constructed. In 1998, a seismic fault was found to the west of the CMR Facility and projected to extend beneath two wings of the building. As part of the overall Risk Management Strategy for the CMR Facility, the Department of Energy (DOE) proposed to replace it by 2010 with what is called the CMR Facility Replacement (CMRR). In an effort to make this proposed new nuclear research facility environmentally sustainable, several pollution prevention/waste minimization initiatives are being reviewed for potential incorporation during the design phase. A two-phase approach is being adopted; the facility is being designed in a manner that integrates pollution prevention efforts, and programmatic activities are being tailored to minimize waste. Processes and procedures that reduce waste generation compared to current, prevalent processes and procedures are identified. Some of these ''best practices'' include the following: (1) recycling opportunities for spent materials; (2) replacing lithium batteries with alternate current adaptors; (3) using launderable contamination barriers in Radiological Control Areas (RCAs); (4) substituting mercury thermometers and manometers in RCAs with mercury-free devices; (5) puncturing and recycling aerosol cans; (6) using non-hazardous low-mercury fluorescent bulbs where available; (7) characterizing low-level waste as it is being generated; and (8) utilizing lead alternatives for radiological shielding. Each of these pollution prevention initiatives are being assessed for their technical validity, relevancy, and cost effectiveness. These efforts partially fulfill expectations of the DOE, other federal agencies, and the State of New Mexico for waste minimization. If the improvements discussed here are implemented, an estimated 1.8 million dollars in cost savings is expected.

  7. Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF

    Broader source: Energy.gov [DOE]

    Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF Tom Houston, Greg Mertz, Carl Costantino, Michael Costantino, Andrew Maham Carl J. Costantino & Associates DOE NPH Conference Germantown, Maryland October 25-26 2011

  8. Celebration of DOE's 35th Anniversary and the Secretary of Energy's Honor Awards, Keynote Address: Energy Secretary, Dr. Steven Chu

    ScienceCinema (OSTI)

    Chu, Steven (U.S. Energy Secretary)

    2012-10-18

    Dr. Steven Chu gives a keynote address marking the thirty-fifth anniversary of the Department of Energy (DOE). He highlights outstanding achievements of the Department and its scientists. Several of the Department's many Nobel Prize winners over the years are mentioned.

  9. REACTOR CONTROL

    DOE Patents [OSTI]

    Ruano, W.J.

    1957-12-10

    This patent relates to nuclear reactors of the type which utilize elongited rod type fuel elements immersed in a liquid moderator and shows a design whereby control of the chain reaction is obtained by varying the amount of moderator or reflector material. A central tank for containing liquid moderator and fuel elements immersed therein is disposed within a surrounding outer tank providing an annular space between the two tanks. This annular space is filled with liquid moderator which functions as a reflector to reflect neutrons back into the central reactor tank to increase the reproduction ratio. Means are provided for circulating and cooling the moderator material in both tanks and additional means are provided for controlling separately the volume of moderator in each tank, which latter means may be operated automatically by a neutron density monitoring device. The patent also shows an arrangement for controlling the chain reaction by injecting and varying an amount of poisoning material in the moderator used in the reflector portion of the reactor.

  10. Centralized Stochastic Optimal Control of Complex Systems

    SciTech Connect (OSTI)

    Malikopoulos, Andreas

    2015-01-01

    In this paper we address the problem of online optimization of the supervisory power management control in parallel hybrid electric vehicles (HEVs). We model HEV operation as a controlled Markov chain using the long-run expected average cost per unit time criterion, and we show that the control policy yielding the Pareto optimal solution minimizes the average cost criterion online. The effectiveness of the proposed solution is validated through simulation and compared to the solution derived with dynamic programming using the average cost criterion.

  11. Kinetic advantage of controlled intermediate nuclear fusion

    SciTech Connect (OSTI)

    Guo Xiaoming

    2012-09-26

    The dominated process of controlled fusion is to let nuclei gain enough kinetic energy to overcome Coulomb barrier. As a result, a fusion scheme can consider two factors in its design: to increase kinetic energy of nuclei and to alter the Coulomb barrier. Cold Fusion and Hot fusion are all one-factor schemes while Intermediate Fusion is a twofactors scheme. This made CINF kinetically superior. Cold Fusion reduces deuteron-deuteron distance, addressing Coulomb barrier, and Hot Fusion heat up plasma into extreme high temperature, addressing kinetic energy. Without enough kinetic energy made Cold Fusion skeptical. Extreme high temperature made Hot Fusion very difficult to engineer. Because CIFN addresses both factors, CIFN is a more promising technique to be industrialized.

  12. Version Control

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Control at NERSC Jack Deslippe Options at NERSC SVN Great for small projects with few developers working on a single branch. GIT Great for big projects with many developers working on a variety of branches. Options at NERSC SVN Great for small projects with few developers working on a single branch. GIT Great for big projects with many developers working on a variety of branches. Other options (mercurial, bazaar, CVS) can be used at NERSC to some extent. But you are on your own. Why host at

  13. Assistant Secretary Patricia Hoffman to Deliver Keynote Address at IEEE PES Conference on Innovative Smart Grid Technologies

    Broader source: Energy.gov [DOE]

    Assistant Secretary Patricia Hoffman will give the keynote address at the 4th annual IEEE PES Conference on Innovative Smart Grid Technologies (ISGT 2013) on Monday, February 25. The conference, which will be held from February 24 through February 27 in Washington, DC, is a forum to discuss state-of-the-art innovations in smart grid technologies. The event will feature tutorials, panel sessions and paper presentations by international experts.

  14. In-Situ Radiological Surveys to Address Nuclear Criticality Safety Requirements During Remediation Activities at the Shallow Land Disposal Area, Armstrong County, Pennsylvania - 12268

    SciTech Connect (OSTI)

    Norris, Phillip; Mihalo, Mark; Eberlin, John; Lambert, Mike; Matthews, Brian

    2012-07-01

    Cabrera Services Inc. (CABRERA) is the remedial contractor for the Shallow Land Disposal Area (SLDA) Site in Armstrong County Pennsylvania, a United States (US) Army Corps of Engineers - Buffalo District (USACE) contract. The remediation is being completed under the USACE's Formerly Utilized Sites Remedial Action Program (FUSRAP) which was established to identify, investigate, and clean up or control sites previously used by the Atomic Energy Commission (AEC) and its predecessor, the Manhattan Engineer District (MED). As part of the management of the FUSRAP, the USACE is overseeing investigation and remediation of radiological contamination at the SLDA Site in accordance with the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), 42 US Code (USC), Section 9601 et. seq, as amended and, the National Oil and Hazardous Substance Pollution Contingency Plan (NCP), Title 40 of the Code of Federal Regulations (CFR) Section 300.430(f) (2). The objective of this project is to clean up radioactive waste at SLDA. The radioactive waste contains special nuclear material (SNM), primarily U-235, in 10 burial trenches, Cabrera duties include processing, packaging and transporting the waste to an offsite disposal facility in accordance with the selected remedial alternative as defined in the Final Record of Decision (USACE, 2007). Of particular importance during the remediation is the need to address nuclear criticality safety (NCS) controls for the safe exhumation and management of waste containing fissile materials. The partnership between Cabrera Services, Inc. and Measutronics Corporation led to the development of a valuable survey tool and operating procedure that are essential components of the SLDA Criticality Safety and Material Control and Accountability programs. Using proven existing technologies in the design and manufacture of the Mobile Survey Cart, the continued deployment of the Cart will allow for an efficient and reliable methodology to allow for the safe exhumation of the Special Nuclear Material in existing SLDA trenches. (authors)

  15. Heliostat control

    DOE Patents [OSTI]

    Kaehler, James A.

    1984-01-01

    An improvement in a system and method of controlling heliostat in which the heliostat is operable in azimuth and elevation by respective stepper motors and including the respective steps or means for calculating the position for the heliostat to be at a commanded position, determining the number of steps in azimuth and elevation for each respective motor to get to the commanded position and energizing both the azimuth and elevation stepper motors to run in parallel until predetermined number of steps away from the closest commanded position in azimuth and elevation so that the closest position has been achieved, and thereafter energizing only the remaining motor to bring it to its commanded position. In this way, the heliostat can be started from a stowed position in the morning and operated by a computer means to its commanded position and kept correctly oriented throughout the day using only the time of the day without requiring the usual sensors and feedback apparatus. A computer, or microprocessor, can then control a plurality of many heliostats easily and efficiently throughout the day.

  16. Nanoengineered membranes for controlled transport

    DOE Patents [OSTI]

    Doktycz, Mitchel J. [Oak Ridge, TN; Simpson, Michael L. [Knoxville, TN; McKnight, Timothy E. [Greenback, TN; Melechko, Anatoli V. [Oak Ridge, TN; Lowndes, Douglas H. [Knoxville, TN; Guillorn, Michael A. [Knoxville, TN; Merkulov, Vladimir I. [Oak Ridge, TN

    2010-01-05

    A nanoengineered membrane for controlling material transport (e.g., molecular transport) is disclosed. The membrane includes a substrate, a cover definining a material transport channel between the substrate and the cover, and a plurality of fibers positioned in the channel and connected to an extending away from a surface of the substrate. The fibers are aligned perpendicular to the surface of the substrate, and have a width of 100 nanometers or less. The diffusion limits for material transport are controlled by the separation of the fibers. In one embodiment, chemical derivitization of carbon fibers may be undertaken to further affect the diffusion limits or affect selective permeability or facilitated transport. For example, a coating can be applied to at least a portion of the fibers. In another embodiment, individually addressable carbon nanofibers can be integrated with the membrane to provide an electrical driving force for material transport.

  17. Stormwater Control Structures

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stormwater Control Structures Stormwater Control Structures Stormwater control structures are engineered to control run-on and runoff water from suspected contaminated sites. ...

  18. Power Control System

    Energy Science and Technology Software Center (OSTI)

    1995-02-24

    Power Control System (PCS) is used as a real time control software package for Supervisory Control and Data Acquistion (SCADA) in an electric utility control center environment.

  19. Control Systems Security News Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News Archive Control Systems Security News Archive Control Systems Security News Archive September 2010 - Secretary Chu Announces Latest Efforts to Address Cybersecurity August 2010: - DOE 2010 Cybersecurity Peer Review Update March 2010 - DOE and Industry Showcase New Control Systems Security Technologies at DistribuTECH Feb. 2010 - DOE Issues National Energy Sector Cyber Organization Notice of Intent Nov. 2009 - New TCIPG Research Program Builds on Past Successes with Nearly $18.8 Million DOE

  20. Process Control System Cyber Security Standards - An Overview

    SciTech Connect (OSTI)

    Robert P. Evans

    2006-05-01

    The use of cyber security standards can greatly assist in the protection of process control systems by providing guidelines and requirements for the implementation of computer-controlled systems. These standards are most effective when the engineers and operators, using the standards, understand what each standard addresses. This paper provides an overview of several standards that deal with the cyber security of process measurements and control systems.

  1. ADVANCED COMPRESSOR ENGINE CONTROLS TO ENHANCE OPERATION, RELIABILITY AND INTEGRITY

    SciTech Connect (OSTI)

    Gary D. Bourn; Jess W. Gingrich; Jack A. Smith

    2004-03-01

    This document is the final report for the ''Advanced Compressor Engine Controls to Enhance Operation, Reliability, and Integrity'' project. SwRI conducted this project for DOE in conjunction with Cooper Compression, under DOE contract number DE-FC26-03NT41859. This report addresses an investigation of engine controls for integral compressor engines and the development of control strategies that implement closed-loop NOX emissions feedback.

  2. Addressing Common Subsurface Challenges

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    geophysical and geochemical technologies quantitatively inferring subsurface evolution under current and future engineered conditions finding viable, low-risk resources...

  3. ARM - People Address Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govAboutPerson Information About Become a User Recovery Act Mission FAQ Outreach Displays History Organization Participants Facility Statistics Forms Contacts Facility Documents...

  4. Addressing Big Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Big Data Challenges in Simulation-based Science Prof. Manish Parashar Rutgers University Tuesday, Jan 28, 2014 - 4:15PM MBG AUDITORIUM Refreshments at 4:00PM The PrinceTon Plasma Physics laboraTory is a U.s. DeParTmenT of energy faciliTy Data-related challenges are quickly dominating computational and data-enabled sciences, and are limiting the potential impact of end-to-end coupled application formulations enabled by cur- rent high-performance distributed computing environments. These

  5. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  12. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  13. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  14. ALS Beamlines Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0.05-1.2 eV This e-mail address is being protected from spambots. You need JavaScript enabled to view it (510) 495-2231 This e-mail address is being protected from...

  15. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read more... Contact: This e-mail address is being protected from spambots. You need JavaScript enabled to view it and This e-mail address is being protected from spambots. You...

  16. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Proposals: This e-mail address is being protected from spambots....

  17. Advanced concepts for controlling energy surety microgrids.

    SciTech Connect (OSTI)

    Menicucci, David F.; Ortiz-Moyet, Juan

    2011-05-01

    Today, researchers, engineers, and policy makers are seeking ways to meet the world's growing demand for energy while addressing critical issues such as energy security, reliability, and sustainability. Many believe that distributed generators operating within a microgrid have the potential to address most of these issues. Sandia National Laboratories has developed a concept called energy surety in which five of these 'surety elements' are simultaneously considered: energy security, reliability, sustainability, safety, and cost-effectiveness. The surety methodology leads to a new microgrid design that we call an energy surety microgrid (ESM). This paper discusses the unique control requirement needed to produce a microgrid system that has high levels of surety, describes the control system from the most fundamental level through a real-world example, and discusses our ideas and concepts for a complete system.

  18. Energy Secretary Steven Chu to Travel to Bay Area to Highlight State of the Union Address, Commitment to Clean Energy

    Broader source: Energy.gov [DOE]

    As part of the Energy Department’s ongoing efforts to highlight President Obama’s State of the Union address and discuss the Obama Administration’s commitment to American energy resources and innovation, U.S. Energy Secretary Steven Chu will headline a groundbreaking ceremony for Lawrence Berkeley National Laboratory’s new Computational Research and Theory Facility, a cutting-edge supercomputing facility. Secretary Chu will also host a State of the Union Town Hall and take questions from students and faculty at San Francisco State University.

  19. Electrostatically focused addressable field emission array chips (AFEA's) for high-speed massively parallel maskless digital E-beam direct write lithography and scanning electron microscopy

    DOE Patents [OSTI]

    Thomas, Clarence E.; Baylor, Larry R.; Voelkl, Edgar; Simpson, Michael L.; Paulus, Michael J.; Lowndes, Douglas H.; Whealton, John H.; Whitson, John C.; Wilgen, John B.

    2002-12-24

    Systems and methods are described for addressable field emission array (AFEA) chips. A method of operating an addressable field-emission array, includes: generating a plurality of electron beams from a pluralitly of emitters that compose the addressable field-emission array; and focusing at least one of the plurality of electron beams with an on-chip electrostatic focusing stack. The systems and methods provide advantages including the avoidance of space-charge blow-up.

  20. Safety Staff Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety Staff Contact Information Print Contact Extension Location CONTROL ROOM (24/7) 4969 80-140 Floor Operations Floor Operators 7464 (RING) 80-159 Building Manager Jeff Troutman 7358 80-151 Building Emergency Team (BET) This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Leader) Karen Nunez (Deputy) 8658 6535 7-210H 80-160 Work Planning, Facility Specialists This e-mail address is being protected from spambots. You need JavaScript enabled to view it

  1. Safety Staff Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety Staff Contact Information Print Contact Extension Location CONTROL ROOM (24/7) 4969 80-140 Floor Operations Floor Operators 7464 (RING) 80-159 Building Manager Jeff Troutman 7358 80-151 Building Emergency Team (BET) This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Leader) Karen Nunez (Deputy) 8658 6535 7-210H 80-160 Work Planning, Facility Specialists This e-mail address is being protected from spambots. You need JavaScript enabled to view it

  2. A Multiobjective Optimization Framework for Stochastic Control of Complex Systems

    SciTech Connect (OSTI)

    Malikopoulos, Andreas; Maroulas, Vasileios; Xiong, Professor Jie

    2015-01-01

    This paper addresses the problem of minimizing the long-run expected average cost of a complex system consisting of subsystems that interact with each other and the environment. We treat the stochastic control problem as a multiobjective optimization problem of the one-stage expected costs of the subsystems, and we show that the control policy yielding the Pareto optimal solution is an optimal control policy that minimizes the average cost criterion for the entire system. For practical situations with constraints consistent to those we study here, our results imply that the Pareto control policy may be of value in deriving online an optimal control policy in complex systems.

  3. EPA-- Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act

    Broader source: Energy.gov [DOE]

    Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act

  4. Microsoft Word - Current Contact Information2.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information: Name: Date: Z Number: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Mailing Address: Street or PO Box Apt...

  5. Process Control System Cyber Security Standards - An Overview

    SciTech Connect (OSTI)

    Robert P. Evans; V Stanley Scown; Rolf Carlson; Shabbir Shamsuddin; George Shaw; Jeff Dagle; Paul W Oman; Jeannine Schmidt

    2005-10-01

    The use of cyber security standards can greatly assist in the protection of critical infrastructure by providing guidelines and requisite imperatives in the implementation of computer-controlled systems. These standards are most effective when the engineers and operators using the standards understand what each of the standards addresses and does not address. This paper provides a review and comparison of ten documents dealing with control system cyber security. It is not meant to be a complete treatment of all applicable standards; rather, this is an exemplary analysis showing the benefits of comparing and contrasting differing documents.

  6. Thermal Control & System Integration

    Broader source: Energy.gov [DOE]

    The thermal control and system integration activity focuses on issues such as the integration of motor and power control technologies and the development of advanced thermal control technologies....

  7. Safety and licensing issues that are being addressed by the Power Burst Facility test programs. [PWR; BWR

    SciTech Connect (OSTI)

    McCardell, R.K.; MacDonald, P.E.

    1980-01-01

    This paper presents an overview of the results of the experimental program being conducted in the Power Burst Facility and the relationship of these results to certain safety and licensing issues. The safety issues that were addressed by the Power-Cooling-Mismatch, Reactivity Initiated Accident, and Loss of Coolant Accident tests, which comprised the original test program in the Power Burst Facility, are discussed. The resolution of these safety issues based on the results of the thirty-six tests performed to date, is presented. The future resolution of safety issues identified in the new Power Burst Facility test program which consists of tests which simulate BWR and PWR operational transients, anticipated transients without scram, and severe fuel damage accidents, is described.

  8. Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels

    SciTech Connect (OSTI)

    Hamilton, Cyd E.

    2014-03-25

    This white paper briefly reviews the research literature exploring complex algal communities as a means of increasing algal biomass production via increased tolerance, resilience, and resistance to a variety of abiotic and biotic perturbations occurring within harvesting timescales. This paper identifies what data are available and whether more research utilizing complex communities is needed to explore the potential of complex algal community stability (CACS) approach as a plausible means to increase biomass yields regardless of ecological context and resulting in decreased algal-based fuel prices by reducing operations costs. By reviewing the literature for what we do and do not know, in terms of CACS methodologies, this report will provide guidance for future research addressing pond crash phenomena.

  9. Comparison of Routable Control System Security Approaches

    SciTech Connect (OSTI)

    Edgar, Thomas W.; Hadley, Mark D.; Carroll, Thomas E.; Manz, David O.; Winn, Jennifer D.

    2011-06-01

    This document is an supplement to the 'Secure and Efficient Routable Control Systems.' It addressed security in routable control system communication. The control system environment that monitors and manages the power grid historically has utilized serial communication mechanisms. Leased-line serial communication environments operating at 1200 to 9600 baud rates are common. However, recent trends show that communication media such as fiber, optical carrier 3 (OC-3) speeds, mesh-based high-speed wireless, and the Internet are becoming the media of choice. In addition, a dichotomy has developed between the electrical transmission and distribution environments, with more modern communication infrastructures deployed by transmission utilities. The preceding diagram represents a typical control system. The Communication Links cloud supports all of the communication mechanisms a utility might deploy between the control center and devices in the field. Current methodologies used for security implementations are primarily led by single vendors or standards bodies. However, these entities tend to focus on individual protocols. The result is an environment that contains a mixture of security solutions that may only address some communication protocols at an increasing operational burden for the utility. A single approach is needed that meets operational requirements, is simple to operate, and provides the necessary level of security for all control system communication. The solution should be application independent (e.g., Distributed Network Protocol/Internet Protocol [DNP/IP], International Electrotechnical Commission [IEC] C37.118, Object Linking and Embedding for Process Control [OPC], etc.) and focus on the transport layer. In an ideal setting, a well-designed suite of standards for control system communication will be used for vendor implementation and compliance testing. An expected outcome of this effort is an international standard.

  10. Technical Study Addresses a Key Challenge to Harmonizing U.S. and International PV Module Standards (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-07-01

    NREL builds community and industry support by addressing concerns voiced by key standards organizations. Photovoltaic (PV) manufacturers in the United States test the safety of their products using standards developed through consensus processes. Because U.S. PV module safety standards are not aligned with international standards, manufacturers must test their modules twice - and sometimes maintain separate product lines. By meeting with standards organizations such as the Solar ABCs and Underwriters Laboratories (UL), National Renewable Energy Laboratory (NREL) leaders have worked to identify different stakeholders priorities and concerns. UL, specifically, has expressed concern that the international standards do not address all possible risks. For example, new encapsulant materials could soften at high temperatures and frameless modules could slide apart, exposing live electrical parts or allowing glass to fall on a person below. The deformation of a solid material under the influence of mechanical stresses is known as 'creep.' Current module qualification tests are limited to 85 C, whereas modules can, for short times, reach 105 C outdoors. In response to UL's concern, NREL designed and executed an experiment to compare on-sun and accelerated rates of creep for modules fabricated with various encapsulants, including some that have low melting points. Objectives were to (1) evaluate the potential for creep in outdoor exposure, (2) provide guidance on the risks and design needs with thermoplastic materials, and (3) provide a basis for modifying standards to account for materials with potential to creep. The study tested experimental materials with eight representative encapsulants in both outdoor and indoor (chamber) exposure. The study found that modules with materials that were expected to creep did so in the indoor exposure, but not in most outdoor environments and mounting configurations. The results provide a basis for defining an accelerated test needed to give confidence that the modules will not slide apart on hot days. The proposal for IEC 61730 Part 1 exposes modules for 200 hours to a temperature between 105 C and 110 C. NREL is collaborating with UL representatives, and U.S. and international standards appear to be closer to harmonization.

  11. Top 10 Vulnerabilities of Control Systems and Their Associated Migitations

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (2006) | Department of Energy Top 10 Vulnerabilities of Control Systems and Their Associated Migitations (2006) Top 10 Vulnerabilities of Control Systems and Their Associated Migitations (2006) This document addresses potential risks that can apply to some electricity sector organizations and provides practices that can help mitigate the risks. Each organization decides for itself the risks it can accept and the practices it deems appropriate to manage those risks. PDF icon Top 10

  12. COLLOQUIUM: Controlling the Production and Performance of Materials at the

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mesoscale: The Matter-Radiation Interactions in Extremes (MaRIE) Capability | Princeton Plasma Physics Lab January 27, 2016, 4:15pm to 5:30pm Colloquia MBG Auditorium COLLOQUIUM: Controlling the Production and Performance of Materials at the Mesoscale: The Matter-Radiation Interactions in Extremes (MaRIE) Capability Dr. Cris Barnes Los Alamos National Laboratory The Matter-Radiation Interactions in Extremes (MaRIE) project will provide capability that will address the control of performance

  13. Energy Frontier Research Centers: Helping Win the Energy Innovation Race (2011 EFRC Summit Keynote Address, Secretary of Energy Chu)

    ScienceCinema (OSTI)

    Chu, Steven (DOE Secretary of Energy)

    2012-03-14

    Secretary of Energy Steven Chu gave the keynote address at the 2011 EFRC Summit and Forum. In his talk, Secretary Chu highlighted the need to "unleash America's science and research community" to achieve energy breakthroughs. The 2011 EFRC Summit and Forum brought together the EFRC community and science and policy leaders from universities, national laboratories, industry and government to discuss "Science for our Nation's Energy Future." In August 2009, the Office of Science established 46 Energy Frontier Research Centers. The EFRCs are collaborative research efforts intended to accelerate high-risk, high-reward fundamental research, the scientific basis for transformative energy technologies of the future. These Centers involve universities, national laboratories, nonprofit organizations, and for-profit firms, singly or in partnerships, selected by scientific peer review. They are funded at $2 to $5 million per year for a total planned DOE commitment of $777 million over the initial five-year award period, pending Congressional appropriations. These integrated, multi-investigator Centers are conducting fundamental research focusing on one or more of several ?grand challenges? and use-inspired ?basic research needs? recently identified in major strategic planning efforts by the scientific community. The purpose of the EFRCs is to integrate the talents and expertise of leading scientists in a setting designed to accelerate research that transforms the future of energy and the environment.

  14. OFFSITE USE FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OFFSITE USE FORM Fill form out in triplicate, send original to Property Control, m/s 85A, give a copy to the Gate Guard and keep a copy for your files. This form needs to be updated once a year. Stanford Linear Accelerator Center Authorization Record Form: Stanford University Removal of Government Property from SLAC PO Box 4349 premises for Official Use Elsewhere (*) Date: To: Property Control, m/s 85A From: Name E Mail Address Group and Mail Stop SLAC Extension This is to notify you that I have

  15. DOE Sustainability Support Information Brief on Executive Order 12898, Federal Actions to Address Environmental Justice in Minority and Low-Income Populations

    Broader source: Energy.gov [DOE]

    This Sustainability Support Information Brief provides background information on Executive Order 12898, Federal Actions to Address Environmental Justice in Minority and Low-Income Populations as well as the Department of Energy’s environmental justice goals, strategy, and implementation.

  16. Superconducting fault current controller/current controller

    DOE Patents [OSTI]

    Cha, Yung S.

    2004-06-15

    A superconducting fault current controller/current controller employs a superconducting-shielded core reactor (SSCR) with a variable impedance in a secondary circuit to control current in a primary circuit such as an electrical distribution system. In a second embodiment, a variable current source is employed in a secondary circuit of an SSCR to control current in the primary circuit. In a third embodiment, both a variable impedance in one secondary circuit and a variable current source in a second circuit of an SSCR are employed for separate and independent control of current in the primary circuit.

  17. Contact Us - SRSCRO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    contact Contact Us For further information concerning the SRS Community Reuse Organization, contact: Mailing Address: SRSCRO P. O. Box 696 Aiken, SC 29802 Physical Address: SRSCRO...

  18. Enhancing Railroad Hazardous Materials Transportation Safety

    Office of Environmental Management (EM)

    * Two Options * Two Options * Fusion Centers * Direct Hazmat * Carriers must provide name, title, telephone number, and e-mail address to fusion centers and those address to...

  19. Superconducting VAR control

    DOE Patents [OSTI]

    Boenig, Heinrich J.; Hassenzahl, William V.

    1982-01-01

    Static VAR control means employing an asymmetrically controlled Graetz bridge and a superconducting direct current coil having low losses and low cost characteristics.

  20. Sediment Control: Willows

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sediment Control: Willows Sediment Control: Willows LANL recently planted 10,000 willows and constructed wing ditches to increase sediment retention in Pueblo and Los Alamos...

  1. CONTROL LIMITER DEVICE

    DOE Patents [OSTI]

    DeShong, J.A.

    1960-03-01

    A control-limiting device for monltoring a control system is described. The system comprises a conditionsensing device, a condition-varying device exerting a control over the condition, and a control means to actuate the condition-varying device. A control-limiting device integrates the total movement or other change of the condition-varying device over any interval of time during a continuum of overlapping periods of time, and if the tothl movement or change of the condition-varying device exceeds a preset value, the control- limiting device will switch the control of the operated apparatus from automatic to manual control.

  2. Recommended Practice for Securing Control System Modems

    SciTech Connect (OSTI)

    James R. Davidson; Jason L. Wright

    2008-01-01

    This paper addresses an often overlooked backdoor into critical infrastructure control systems created by modem connections. A modems connection to the public telephone system is similar to a corporate network connection to the Internet. By tracing typical attack paths into the system, this paper provides the reader with an analysis of the problem and then guides the reader through methods to evaluate existing modem security. Following the analysis, a series of methods for securing modems is provided. These methods are correlated to well-known networking security methods.

  3. Control Systems Security Test Center - FY 2004 Program Summary

    SciTech Connect (OSTI)

    Robert E. Polk; Alen M. Snyder

    2005-04-01

    In May 2004, the US-CERT Control Systems Security Center (CSSC) was established at Idaho National Laboratory to execute assessment activities to reduce the vulnerability of the nations critical infrastructure control systems to terrorist attack. The CSSC implements a program to accomplish the five goals presented in the US-CERT National Strategy for Control Systems Security. This report summarizes the first year funding of startup activities and program achievements that took place in FY 2004 and early FY 2005. This document was prepared for the US-CERT Control Systems Security Center of the National Cyber Security Division of the Department of Homeland Security (DHS). DHS has been tasked under the Homeland Security Act of 2002 to coordinate the overall national effort to enhance the protection of the national critical infrastructure. Homeland Security Presidential Directive HSPD-7 directs federal departments to identify and prioritize the critical infrastructure and protect it from terrorist attack. The US-CERT National Strategy for Control Systems Security was prepared by the National Cyber Security Division to address the control system security component addressed in the National Strategy to Secure Cyberspace and the National Strategy for the Physical Protection of Critical Infrastructures and Key Assets. The US-CERT National Strategy for Control Systems Security identified five high-level strategic goals for improving cyber security of control systems.

  4. Experimental Validation of a Resilient Monitoring and Control System

    SciTech Connect (OSTI)

    Wen-Chiao Lin; Kris R. E. Villez; Humberto E. Garcia

    2014-05-01

    Complex, high performance, engineering systems have to be closely monitored and controlled to ensure safe operation and protect public from potential hazards. One of the main challenges in designing monitoring and control algorithms for these systems is that sensors and actuators may be malfunctioning due to malicious or natural causes. To address this challenge, this paper addresses a resilient monitoring and control (ReMAC) system by expanding previously developed resilient condition assessment monitoring systems and Kalman filter-based diagnostic methods and integrating them with a supervisory controller developed here. While the monitoring and diagnostic algorithms assess plant cyber and physical health conditions, the supervisory controller selects, from a set of candidates, the best controller based on the current plant health assessments. To experimentally demonstrate its enhanced performance, the developed ReMAC system is then used for monitoring and control of a chemical reactor with a water cooling system in a hardware-in-the-loop setting, where the reactor is computer simulated and the water cooling system is implemented by a machine condition monitoring testbed at Idaho National Laboratory. Results show that the ReMAC system is able to make correct plant health assessments despite sensor malfunctioning due to cyber attacks and make decisions that achieve best control actions despite possible actuator malfunctioning. Monitoring challenges caused by mismatches between assumed system component models and actual measurements are also identified for future work.

  5. Secure Control Systems for the Energy Sector

    SciTech Connect (OSTI)

    Smith, Rhett; Campbell, Jack; Hadley, Mark

    2012-03-31

    Schweitzer Engineering Laboratories (SEL) will conduct the Hallmark Project to address the need to reduce the risk of energy disruptions because of cyber incidents on control systems. The goals is to develop solutions that can be both applied to existing control systems and designed into new control systems to add the security measures needed to mitigate energy network vulnerabilities. The scope of the Hallmark Project contains four primary elements: 1. Technology transfer of the Secure Supervisory Control and Data Acquisition (SCADA) Communications Protocol (SSCP) from Pacific Northwest National Laboratories (PNNL) to Schweitzer Engineering Laboratories (SEL). The project shall use this technology to develop a Federal Information Processing Standard (FIPS) 140-2 compliant original equipment manufacturer (OEM) module to be called a Cryptographic Daughter Card (CDC) with the ability to directly connect to any PC enabling that computer to securely communicate across serial to field devices. Validate the OEM capabilities with another vendor. 2. Development of a Link Authenticator Module (LAM) using the FIPS 140-2 validated Secure SCADA Communications Protocol (SSCP) CDC module with a central management software kit. 3. Validation of the CDC and Link Authenticator modules via laboratory and field tests. 4. Creation of documents that record the impact of the Link Authenticator to the operators of control systems and on the control system itself. The information in the documents can assist others with technology deployment and maintenance.

  6. Electrically Addressable Optical Devices Using A System Of Composite Layered Flakes Suspended In A Fluid Host To Obtain Angularly Depende

    DOE Patents [OSTI]

    Kosc, Tanya Z.; Marshall, Kenneth L.; Jacobs, Stephen D.

    2004-12-07

    Composite or layered flakes having a plurality of layers of different materials, which may be dielectric materials, conductive materials, or liquid crystalline materials suspended in a fluid host and subjected to an electric field, provide optical effects dependent upon the angle or orientation of the flakes in the applied electric field. The optical effects depend upon the composition and thickness of the layers, producing reflectance, interference, additive and/or subtractive color effects. The composition of layered flakes may also be selected to enhance and/or alter the dielectric properties of flakes, whereby flake motion in an electric field is also enhanced and/or altered. The devices are useful as active electro-optical displays, polarizers, filters, light modulators, and wherever controllable polarizing, reflecting and transmissive optical properties are desired.

  7. Furnace Pressure Controllers

    Broader source: Energy.gov [DOE]

    This tip sheet highlights the benefits of precise furnace pressure control in process heating systems.

  8. Extending Fuzzy System Concepts for Control of a Vitrification Melter

    SciTech Connect (OSTI)

    Whitehouse, J.C.; Sorgel, W.; Garrison, A.; Schalkoff, R.J.

    1995-08-16

    Fuzzy systems provide a mathematical framework to capture uncertainty. The complete description of real, complex systems or situations often requires far more detail and information than could ever be obtained (or understood). Fuzzy approaches are an alternative technology for both system control and information processing and management. In this paper, we present the design of a fuzzy control system for a melter used in the vitrification of hazardous waste. Design issues, especially those related to melter shutdown and obtaining smooth control surfaces, are addressed. Several extensions to commonly-applied fuzzy techniques, notably adaptive defuzzification and modified rule structures are developed.

  9. INL Control System Situational Awareness Technology Annual Report 2012

    SciTech Connect (OSTI)

    Gordon Rueff; Bryce Wheeler; Todd Vollmer; Tim McJunkin; Robert Erbes

    2012-10-01

    The overall goal of this project is to develop an interoperable set of tools to provide a comprehensive, consistent implementation of cyber security and overall situational awareness of control and sensor network implementations. The operation and interoperability of these tools will fill voids in current technological offerings and address issues that remain an impediment to the security of control systems. This report provides an FY 2012 update on the Sophia, Mesh Mapper, Intelligent Cyber Sensor, and Data Fusion projects with respect to the year-two tasks and annual reporting requirements of the INL Control System Situational Awareness Technology report (July 2010).

  10. A duality framework for stochastic optimal control of complex systems

    SciTech Connect (OSTI)

    Malikopoulos, Andreas A.

    2016-01-01

    In this study, we address the problem of minimizing the long-run expected average cost of a complex system consisting of interactive subsystems. We formulate a multiobjective optimization problem of the one-stage expected costs of the subsystems and provide a duality framework to prove that the control policy yielding the Pareto optimal solution minimizes the average cost criterion of the system. We provide the conditions of existence and a geometric interpretation of the solution. For practical situations having constraints consistent with those studied here, our results imply that the Pareto control policy may be of value when we seek to derive online the optimal control policy in complex systems.

  11. Pareto Efficient Policy for Supervisory Power Management Control

    SciTech Connect (OSTI)

    Malikopoulos, Andreas

    2015-01-01

    n this paper we address the problem of online optimization of the supervisory power management control in parallel hybrid electric vehicles (HEVs). We model HEV opera- tion as a controlled Markov chain using the long-run expected average cost per unit time criterion, and we show that the control policy yielding the Pareto optimal solution minimizes the average cost criterion online. The effectiveness of the proposed solution is validated through simulation and compared to the solution derived with dynamic programming using the average cost criterion.

  12. Nuclear reactor control apparatus

    DOE Patents [OSTI]

    Sridhar, Bettadapur N.

    1983-11-01

    Nuclear reactor core safety rod release apparatus comprises a control rod having a detent notch in the form of an annular peripheral recess at its upper end, a control rod support tube for raising and lowering the control rod under normal conditions, latches pivotally mounted on the control support tube with free ends thereof normally disposed in the recess in the control rod, and cam means for pivoting the latches out of the recess in the control rod when a scram condition occurs. One embodiment of the invention comprises an additional magnetically-operated latch for releasing the control rod under two different conditions, one involving seismic shock.

  13. HYDRAULIC SERVO CONTROL MECHANISM

    DOE Patents [OSTI]

    Hussey, R.B.; Gottsche, M.J. Jr.

    1963-09-17

    A hydraulic servo control mechanism of compact construction and low fluid requirements is described. The mechanism consists of a main hydraulic piston, comprising the drive output, which is connected mechanically for feedback purposes to a servo control piston. A control sleeve having control slots for the system encloses the servo piston, which acts to cover or uncover the slots as a means of controlling the operation of the system. This operation permits only a small amount of fluid to regulate the operation of the mechanism, which, as a result, is compact and relatively light. This mechanism is particuiarly adaptable to the drive and control of control rods in nuclear reactors. (auth)

  14. Retrofit Diesel Emissions Control System Providing 50% NOxControl...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Diesel Emissions Control System Providing 50% NOxControl Retrofit Diesel Emissions Control System Providing 50% NOxControl 2005 Diesel Engine Emissions Reduction (DEER) Conference ...

  15. Chapter 19: HVAC Controls (DDC/EMS/BAS) Evaluation Protocol

    SciTech Connect (OSTI)

    Romberger, J.

    2014-11-01

    The HVAC Controls Evaluation Protocol is designed to address evaluation issues for direct digital controls/energy management systems/building automation systems (DDC/EMS/BAS) that are installed to control heating, ventilation, and air-conditioning (HVAC) equipment in commercial and institutional buildings. (This chapter refers to the DDC/EMS/BAS measure as HVAC controls.) This protocol may also be applicable to industrial facilities such as clean rooms and labs, which have either significant HVAC equipment or spaces requiring special environmental conditions. This protocol addresses only HVAC-related equipment and the energy savings estimation methods associated with installing such control systems as an energy efficiency measure. The affected equipment includes: Air-side equipment (air handlers, direct expansion systems, furnaces, other heating- and cooling-related devices, terminal air distribution equipment, and fans); Central plant equipment (chillers, cooling towers, boilers, and pumps). These controls may also operate or affect other end uses, such as lighting, domestic hot water, irrigation systems, and life safety systems such as fire alarms and other security systems. Considerable nonenergy benefits, such as maintenance scheduling, system component troubleshooting, equipment failure alarms, and increased equipment lifetime, may also be associated with these systems. When connected to building utility meters, these systems can also be valuable demand-limiting control tools. However, this protocol does not evaluate any of these additional capabilities and benefits.

  16. Control rod drive

    DOE Patents [OSTI]

    Hawke, Basil C.

    1986-01-01

    A control rod drive uses gravitational forces to insert one or more control rods upwardly into a reactor core from beneath the reactor core under emergency conditions. The preferred control rod drive includes a vertically movable weight and a mechanism operatively associating the weight with the control rod so that downward movement of the weight is translated into upward movement of the control rod. The preferred control rod drive further includes an electric motor for driving the control rods under normal conditions, an electrically actuated clutch which automatically disengages the motor during a power failure and a decelerator for bringing the control rod to a controlled stop when it is inserted under emergency conditions into a reactor core.

  17. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  18. Subscribe to Energy-Efficient Product Procurement Updates

    Broader source: Energy.gov [DOE]

    FEMP offers e-mail updates covering energy-efficient product procurement requirements, guidance, and assistance. Enter your e-mail address below to begin the registration process. After you...

  19. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: alexander.melkozernov@asu.edu Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  20. CONTROL ROD DRIVE

    DOE Patents [OSTI]

    Chapellier, R.A.; Rogers, I.

    1961-06-27

    Accurate and controlled drive for the control rod is from an electric motor. A hydraulic arrangement is provided to balance a piston against which a control rod is urged by the application of fluid pressure. The electric motor drive of the control rod for normal operation is made through the aforementioned piston. In the event scramming is required, the fluid pressure urging the control rod against the piston is relieved and an opposite fluid pressure is applied. The lack of mechanical connection between the electric motor and control rod facilitates the scramming operation.

  1. Control system design method

    DOE Patents [OSTI]

    Wilson, David G.; Robinett, III, Rush D.

    2012-02-21

    A control system design method and concomitant control system comprising representing a physical apparatus to be controlled as a Hamiltonian system, determining elements of the Hamiltonian system representation which are power generators, power dissipators, and power storage devices, analyzing stability and performance of the Hamiltonian system based on the results of the determining step and determining necessary and sufficient conditions for stability of the Hamiltonian system, creating a stable control system based on the results of the analyzing step, and employing the resulting control system to control the physical apparatus.

  2. Nuclear Controls Checklist

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... or typed) Signature: Date: Rev. 5262015 Page 2 Export Control Questions: please call LANL export control, +1-505-665-2194 Please return the completed form to nda@lanl.gov

  3. Sediment Control: Willows

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sediment Control: Willows Sediment Control: Willows LANL recently planted 10,000 willows and constructed wing ditches to increase sediment retention in Pueblo and Los Alamos canyons. August 1, 2013 Willows: Fall 2010 Willows: Fall 2010

  4. Control of Test Conduct

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Revision 1 Effective June 2008 Control of Test Conduct Prepared by Electric ......... 4 6.1 Test Activities ......

  5. Stormwater Control Structures

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stormwater Control Structures Stormwater Control Structures Stormwater control structures are engineered to control run-on and runoff water from suspected contaminated sites. Structures trap sediment, keep water on-site, slow water flow and redirect water around problem areas. Rock check dams Rock check dams Silt tence Silt fence Sediment trap Sediment trap Wood mulch and native seed Wood mulch and native seed Gabion Gabion Concrete lined swales Concrete lined swales Hydroseeding Hydroseeding

  6. System for controlling apnea

    DOE Patents [OSTI]

    Holzrichter, John F

    2015-05-05

    An implanted stimulation device or air control device are activated by an external radar-like sensor for controlling apnea. The radar-like sensor senses the closure of the air flow cavity, and associated control circuitry signals (1) a stimulator to cause muscles to open the air passage way that is closing or closed or (2) an air control device to open the air passage way that is closing or closed.

  7. Fuel control system

    SciTech Connect (OSTI)

    Detweiler, C.A.

    1980-12-30

    A fuel control system for a turbocharged engine having fuel delivered to the carburetor under the control of a vacuum operated device which is under the further control of a device sensing pressures upstream and downstream of the turbo charger compressor and delivering a vacuum signal to the fuel control device in proportion to the manifold pressure even though the latter pressure may be a positive pressure.

  8. Floating Point Control Library

    Energy Science and Technology Software Center (OSTI)

    2007-08-02

    Floating Point Control is a Library that allows for the manipulation of floating point unit exception masking funtions control exceptions in both the Streaming "Single Instruction, Multiple Data" Extension 2 (SSE2) unit and the floating point unit simultaneously. FPC also provides macros to set floating point rounding and precision control.

  9. Control and optimization system

    DOE Patents [OSTI]

    Xinsheng, Lou

    2013-02-12

    A system for optimizing a power plant includes a chemical loop having an input for receiving an input parameter (270) and an output for outputting an output parameter (280), a control system operably connected to the chemical loop and having a multiple controller part (230) comprising a model-free controller. The control system receives the output parameter (280), optimizes the input parameter (270) based on the received output parameter (280), and outputs an optimized input parameter (270) to the input of the chemical loop to control a process of the chemical loop in an optimized manner.

  10. CONTROL FOR NEUTRONIC REACTOR

    DOE Patents [OSTI]

    Lichtenberger, H.V.; Cameron, R.A.

    1959-03-31

    S>A control rod operating device in a nuclear reactor of the type in which the control rod is gradually withdrawn from the reactor to a position desired during stable operation is described. The apparatus is comprised essentially of a stop member movable in the direction of withdrawal of the control rod, a follower on the control rod engageable with the stop and means urging the follower against the stop in the direction of withdrawal. A means responsive to disengagement of the follower from the stop is provided for actuating the control rod to return to the reactor shut-down position.

  11. Water heater control module

    DOE Patents [OSTI]

    Hammerstrom, Donald J

    2013-11-26

    An advanced electric water heater control system that interfaces with a high temperature cut-off thermostat and an upper regulating thermostat. The system includes a control module that is electrically connected to the high-temperature cut-off thermostat and the upper regulating thermostat. The control module includes a switch to open or close the high-temperature cut-off thermostat and the upper regulating thermostat. The control module further includes circuitry configured to control said switch in response to a signal selected from the group of an autonomous signal, a communicated signal, and combinations thereof.

  12. Integrated Biological Control

    SciTech Connect (OSTI)

    JOHNSON, A.R.

    2002-09-01

    Biological control is any activity taken to prevent, limit, clean up, or remediate potential environmental, health and safety, or workplace quality impacts from plants, animals, or microorganisms. At Hanford the principal emphasis of biological control is to prevent the transport of radioactive contamination by biological vectors (plants, animals, or microorganisms), and where necessary, control and clean up resulting contamination. Other aspects of biological control at Hanford include industrial weed control (e.g.; tumbleweeds), noxious weed control (invasive, non-native plant species), and pest control (undesirable animals such as rodents and stinging insects; and microorganisms such as molds that adversely affect the quality of the workplace environment). Biological control activities may be either preventive (apriori) or in response to existing contamination spread (aposteriori). Surveillance activities, including ground, vegetation, flying insect, and other surveys, and apriori control actions, such as herbicide spraying and placing biological barriers, are important in preventing radioactive contamination spread. If surveillance discovers that biological vectors have spread radioactive contamination, aposteriori control measures, such as fixing contamination, followed by cleanup and removal of the contamination to an approved disposal location are typical response functions. In some cases remediation following the contamination cleanup and removal is necessary. Biological control activities for industrial weeds, noxious weeds and pests have similar modes of prevention and response.

  13. Integrated Biological Control

    SciTech Connect (OSTI)

    JOHNSON, A.R.

    2003-10-09

    Biological control is any activity taken to prevent, limit, clean up, or remediate potential environmental, health and safety, or workplace quality impacts from plants, animals, or microorganisms. At Hanford the principal emphasis of biological control is to prevent the transport of radioactive contamination by biological vectors (plants, animals, or microorganisms), and where necessary, control and clean up resulting contamination. Other aspects of biological control at Hanford include industrial weed control (e.g.; tumbleweeds), noxious weed control (invasive, non-native plant species), and pest control (undesirable animals such as rodents and stinging insects, and microorganisms such as molds that adversely affect the quality of the workplace environment). Biological control activities may be either preventive (a priori) or in response to existing contamination spread (a posteriori). Surveillance activities, including ground, vegetation, flying insect, and other surveys, and a priori control actions, such as herbicide spraying and placing biological barriers, are important in preventing radioactive contamination spread. If surveillance discovers that biological vectors have spread radioactive contamination, a posteriori control measures, such as fixing contamination, followed by cleanup and removal of the contamination to an approved disposal location are typical response functions. In some cases remediation following the contamination cleanup and removal is necessary. Biological control activities for industrial weeds, noxious weeds and pests have similar modes of prevention and response.

  14. CRUCIFORM CONTROL ROD JOINT

    DOE Patents [OSTI]

    Thorp, A.G. II

    1962-08-01

    An invention is described which relates to nuclear reactor control rod components and more particularly to a joint between cruciform control rod members and cruciform control rod follower members. In one embodiment this invention provides interfitting crossed arms at adjacent ends of a control rod and its follower in abutting relation. This holds the members against relative opposite longitudinal movement while a compression member keys the arms against relative opposite rotation around a common axis. Means are also provided for centering the control rod and its follower on a common axis and for selectively releasing the control rod from its follower for the insertion of a replacement of the control rod and reuse of the follower. (AEC)

  15. All Other Editions Are Obsolete OMB Control No.

    Energy Savers [EERE]

    1.29 (10/92) All Other Editions Are Obsolete OMB Control No. 1910-1800 OMB Burden Disclosure Statement below U.S. Department of Energy (Facility or Installation Where Terminated) SECURITY TERMINATION STATEMENT NAME AND TITLE (Print all blocks) EMPLOYER YOU ARE LEAVING FUTURE RESIDENCE NAME AND ADDRESS OF FUTURE EMPLOYER REASON FOR TERMINATION SOCIAL SECURITY NUMBER DATE OF BIRTH DATE OF TERMINATION DOE NUMBER (IF KNOWN) I make the following statement in connection with the forthcoming

  16. Fuzzy logic controller optimization

    DOE Patents [OSTI]

    Sepe, Jr., Raymond B; Miller, John Michael

    2004-03-23

    A method is provided for optimizing a rotating induction machine system fuzzy logic controller. The fuzzy logic controller has at least one input and at least one output. Each input accepts a machine system operating parameter. Each output produces at least one machine system control parameter. The fuzzy logic controller generates each output based on at least one input and on fuzzy logic decision parameters. Optimization begins by obtaining a set of data relating each control parameter to at least one operating parameter for each machine operating region. A model is constructed for each machine operating region based on the machine operating region data obtained. The fuzzy logic controller is simulated with at least one created model in a feedback loop from a fuzzy logic output to a fuzzy logic input. Fuzzy logic decision parameters are optimized based on the simulation.

  17. Nuclear reactor control

    DOE Patents [OSTI]

    Cawley, William E.; Warnick, Robert F.

    1982-01-01

    1. In a nuclear reactor incorporating a plurality of columns of tubular fuel elements disposed in horizontal tubes in a mass of graphite wherein water flows through the tubes to cool the fuel elements, the improvement comprising at least one control column disposed in a horizontal tube including fewer fuel elements than in a normal column of fuel elements and tubular control elements disposed at both ends of said control column, and means for varying the horizontal displacement of the control column comprising a winch at the upstream end of the control column and a cable extending through the fuel and control elements and attached to the element at the downstream end of the column.

  18. Radiological Control Technician Training

    Energy Savers [EERE]

    Part 6 of 9 Radiological Control Technician Training Site Academic Training Study Guide Phase I Coordinated and Conducted for the Office of Health, Safety and Security U.S. Department of Energy DOE-HDBK-1122-2009 Radiological Control Technician Study Guide ii This page intentionally left blank DOE-HDBK-1122-2009 Radiological Control Technician Study Guide iii Table of Contents Page Module 2.01 Radiological Documentation

  19. Controlled Unclassified Information

    Energy Savers [EERE]

    3-1 Chapter 13 Controlled Unclassified Information This chapter describes the security procedures adopted by DOE HQ to implement the requirements of the following DOE regulations and directives: 10 CFR Part 1017, Identification and Protection of Unclassified Controlled Nuclear Information DOE Order 471.1B, Identification and Protection of Unclassified Controlled Nuclear Information DOE Order 471.3, Identifying and Protecting Official Use Only Information DOE Manual 471.3-1, Manual for

  20. Management Control Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2002-04-18

    To establish requirements and responsibilities for the Department of Energy Management Control Program. Cancels DOE O 413.1. Canceled by DOE O 413.1B.

  1. Sun tracking controller

    SciTech Connect (OSTI)

    Menser, H.K.; Newcomb, R.D.

    1981-11-24

    An apparatus is described which controls the electric tracking motors of solar energy collectors and other solar devices which are adapted to be aimed at the sun.

  2. Internal Controls Evaluations

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Thus, an internal control evaluation can show how well risk mitigation strategies are working and ... Information and Communication - The quality of information used to support the ...

  3. Controlling Graphene's Electronic Structure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    spectroscopy (ARPES) at ALS Beamline 7.0.1, a team of scientists from the ALS and Germany characterized the electronic band structure and successfully controlled the gap...

  4. Control system design guide

    SciTech Connect (OSTI)

    Sellers, David; Friedman, Hannah; Haasl, Tudi; Bourassa, Norman; Piette, Mary Ann

    2003-05-01

    The ''Control System Design Guide'' (Design Guide) provides methods and recommendations for the control system design process and control point selection and installation. Control systems are often the most problematic system in a building. A good design process that takes into account maintenance, operation, and commissioning can lead to a smoothly operating and efficient building. To this end, the Design Guide provides a toolbox of templates for improving control system design and specification. HVAC designers are the primary audience for the Design Guide. The control design process it presents will help produce well-designed control systems that achieve efficient and robust operation. The spreadsheet examples for control valve schedules, damper schedules, and points lists can streamline the use of the control system design concepts set forth in the Design Guide by providing convenient starting points from which designers can build. Although each reader brings their own unique questions to the text, the Design Guide contains information that designers, commissioning providers, operators, and owners will find useful.

  5. Cooled, temperature controlled electrometer

    DOE Patents [OSTI]

    Morgan, John P.

    1992-08-04

    A cooled, temperature controlled electrometer for the measurement of small currents. The device employs a thermal transfer system to remove heat from the electrometer circuit and its environment and dissipate it to the external environment by means of a heat sink. The operation of the thermal transfer system is governed by a temperature regulation circuit which activates the thermal transfer system when the temperature of the electrometer circuit and its environment exceeds a level previously inputted to the external variable temperature control circuit. The variable temperature control circuit functions as subpart of the temperature control circuit. To provide temperature stability and uniformity, the electrometer circuit is enclosed by an insulated housing.

  6. Cooled, temperature controlled electrometer

    DOE Patents [OSTI]

    Morgan, John P.

    1992-01-01

    A cooled, temperature controlled electrometer for the measurement of small currents. The device employs a thermal transfer system to remove heat from the electrometer circuit and its environment and dissipate it to the external environment by means of a heat sink. The operation of the thermal transfer system is governed by a temperature regulation circuit which activates the thermal transfer system when the temperature of the electrometer circuit and its environment exceeds a level previously inputted to the external variable temperature control circuit. The variable temperature control circuit functions as subpart of the temperature control circuit. To provide temperature stability and uniformity, the electrometer circuit is enclosed by an insulated housing.

  7. Advanced Rooftop Unit Control

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Advanced-Rooftop-Unit-Control Sign In About | Careers | Contact | Investors | bpa.gov Search Policy & Reporting Expand Policy & Reporting EE Sectors Expand EE Sectors...

  8. Hydraulic control rod

    DOE Patents [OSTI]

    Treshow, Michael

    1976-01-01

    Apparatus for shifting a control rod into and out of a nuclear reactor utilizing as pressure fluid the fluid employed as coolant moderator in the reactor.

  9. Unclassified Controlled Nuclear Information

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1995-09-25

    To prevent unauthorized dissemination of Unclassified Controlled Nuclear Information (UCNI). Cancels DOE 5635.4 and DOE 5650.3A

  10. Controlling Graphene's Electronic Structure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Controlling Graphene's Electronic Structure Print Graphene, because of its unusual electron properties, reduced dimensionality, and scale, has enormous potential for use in...

  11. Controlling Graphene's Electronic Structure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Controlling Graphene's Electronic Structure Print Wednesday, 25 April 2007 00:00 Graphene, because of its unusual electron properties, reduced dimensionality, and scale,...

  12. Voltage Control Technical Conference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1-08-Voltage-Control-Technical-Conference Sign In About | Careers | Contact | Investors | bpa.gov Search News & Us Expand News & Us Projects & Initiatives Expand Projects &...

  13. Detonation command and control

    DOE Patents [OSTI]

    Mace, Jonathan L.; Seitz, Gerald J.; Echave, John A.; Le Bas, Pierre-Yves

    2015-11-10

    The detonation of one or more explosive charges and propellant charges by a detonator in response to a fire control signal from a command and control system comprised of a command center and instrumentation center with a communications link therebetween. The fire control signal is selectively provided to the detonator from the instrumentation center if plural detonation control switches at the command center are in a fire authorization status, and instruments, and one or more interlocks, if included, are in a ready for firing status. The instrumentation and command centers are desirably mobile, such as being respective vehicles.

  14. Subscribe Today to E-mail Alerts from GTO

    Broader source: Energy.gov [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  15. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  16. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  17. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Interactions.org Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  18. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  19. Protections: Sediment Control = Contaminant Retention

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sediment Control Protections: Sediment Control Contaminant Retention LANL maintains hundreds of wells, stream sampling stations and stormwater control structures to protect...

  20. Moisture Control | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Weatherize Moisture Control Moisture Control Controlling moisture can make your home more energy-efficient, less costly to heat and cool, more comfortable, and prevent mold ...

  1. Stepping motor controller

    DOE Patents [OSTI]

    Bourret, Steven C. (Los Alamos, NM); Swansen, James E. (Los Alamos, NM)

    1984-01-01

    A stepping motor is microprocessingly controlled by digital circuitry which monitors the output of a shaft encoder adjustably secured to the stepping motor and generates a subsequent stepping pulse only after the preceding step has occurred and a fixed delay has expired. The fixed delay is variable on a real-time basis to provide for smooth and controlled deceleration.

  2. Sensors and Controls Reports

    Broader source: Energy.gov [DOE]

    Reports from the sensors, controls, and transactional network program. The transactional network is between appliances, buildings, and utilities, and can enable Smart Buildings -- buildings with technologies and control systems that can not only optimize energy performance and comfort, but also support energy-related transactions outside the building envelope.

  3. NUCLEAR REACTOR CONTROL SYSTEM

    DOE Patents [OSTI]

    Epler, E.P.; Hanauer, S.H.; Oakes, L.C.

    1959-11-01

    A control system is described for a nuclear reactor using enriched uranium fuel of the type of the swimming pool and other heterogeneous nuclear reactors. Circuits are included for automatically removing and inserting the control rods during the course of normal operation. Appropriate safety circuits close down the nuclear reactor in the event of emergency.

  4. Plating Tank Control Software

    Energy Science and Technology Software Center (OSTI)

    1998-03-01

    The Plating Tank Control Software is a graphical user interface that controls and records plating process conditions for plating in high aspect ratio channels that require use of low current and long times. The software is written for a Pentium II PC with an 8 channel data acquisition card, and the necessary shunt resistors for measuring currents in the millampere range.

  5. Use of Institutional Controls

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2003-04-09

    The Policy ensures that the Department of Energy will use institutional controls in the management of resources, facilities and properties under its control, and in implementing its programmatic responsibilities. Certified 1-28-11. Supersedes DOE P 454.1, dated 4-9-03.

  6. Novel microsatellite control system

    SciTech Connect (OSTI)

    Moore, K.R.; Frigo, J.R.; Tilden, M.W.

    1996-12-31

    The authors are developing extremely simple yet quite capable analog pulse-coded neural networks for smaller-faster-cheaper spacecraft attitude and control systems. They will demonstrate a prototype microsatellite that uses the novel control system to autonomously stabilize itself in the ambient magnetic field and point itself at the brightest available light source.

  7. Fluid delivery control system

    DOE Patents [OSTI]

    Hoff, Brian D.; Johnson, Kris William; Algrain, Marcelo C.; Akasam, Sivaprasad

    2006-06-06

    A method of controlling the delivery of fluid to an engine includes receiving a fuel flow rate signal. An electric pump is arranged to deliver fluid to the engine. The speed of the electric pump is controlled based on the fuel flow rate signal.

  8. Control the Present

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Control the Present Image of water sampling trip embarking downstream from Otowi Bridge onto the Rio Grande with text overlay of 'How does LANL minimize the impacts from ongoing activities?' Control the Present Home Integrating Environmental Stewardship Something in the air? Protections: Sediment Protections: Sampling

  9. Stepping motor controller

    DOE Patents [OSTI]

    Bourret, S.C.; Swansen, J.E.

    1982-07-02

    A stepping motor is microprocessor controlled by digital circuitry which monitors the output of a shaft encoder adjustably secured to the stepping motor and generates a subsequent stepping pulse only after the preceding step has occurred and a fixed delay has expired. The fixed delay is variable on a real-time basis to provide for smooth and controlled deceleration.

  10. Use of Institutional Controls

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2003-04-09

    The Policy ensures that the Department of Energy will use institutional controls in the management of resources, facilities and properties under its control, and in implementing its programmatic responsibilities. Certified 1-28-11. Superseded by Chg 1 (Admin Chg), dated 12-7-15.

  11. Cyclic control stick

    DOE Patents [OSTI]

    Whitaker, Charles N.; Zimmermann, Richard E.

    1989-01-01

    A cyclic control stick of the type used in helicopters for reducing the safety hazards associated with such a mechanism in the event of a crewman being thrown violently into contact with the cyclic control stick resulting from a crash or the like. The cyclic control stick is configured to break away upon the exertion of an impact force which exceeds a predetermined value and/or is exerted for more than a momentary time duration. The cyclic control stick is also configured to be adjustable so as to locate the grip thereof as far away from the crewman as possible for safety reasons without comprising the comfort of the crewman or the use of the control stick, and a crushable pad is provided on the top of the grip for impact energy absorbing purposes.

  12. 2013 Director's New Year Address

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    has in store for the ALS. An immediate answer is - a celebration - as the ALS marks its 20th year of operation. We'll spend some time this year looking back at what we've...

  13. Addresses and Phone Numbers | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Additions to natural gas in underground storage to be nearly 50% higher this summer Although it's still spring, natural gas supply companies and utilities are already preparing for next winter and are building their inventories of natural gas to meet future heating demand. About 2.1 trillion cubic feet of natural gas will be added to gas inventories in underground storage over the summer months to get ready for the winter heating season, which starts November 1. That is significantly higher than

  14. Addressing Plug and Process Loads

    Broader source: Energy.gov [DOE]

    Presenters: Rois Langer, National Renewable Energy Laboratory (NREL); Moira Hafer, Stanford University; Jason Sielcken, U.S. General Services Administration (GSA)

  15. Letter Temple

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 06/04/15 Note: Form must be filled out completely and signed prior to submittal to the following address: Nuclear Waste Partnership LLC PO Box 2078 GSA-207 Carlsbad, NM 88221 FAX: (575) 234-7050 Company Name: Address: Phone: City: State: Zip(+4): e-Mail: REMITTANCE ADDRESS (if different) Address: City: State: Zip(+4): e-Mail: Other: Address: City: State: Zip(+4): Country Code: COMPANY CONTACTS Manager Name: Sales Name: Phone: Cell: Phone: Cell: e-Mail e-Mail Service Name: Accounts Payable

  16. Common Control System Vulnerability

    SciTech Connect (OSTI)

    Trent Nelson

    2005-12-01

    The Control Systems Security Program and other programs within the Idaho National Laboratory have discovered a vulnerability common to control systems in all sectors that allows an attacker to penetrate most control systems, spoof the operator, and gain full control of targeted system elements. This vulnerability has been identified on several systems that have been evaluated at INL, and in each case a 100% success rate of completing the attack paths that lead to full system compromise was observed. Since these systems are employed in multiple critical infrastructure sectors, this vulnerability is deemed common to control systems in all sectors. Modern control systems architectures can be considered analogous to today's information networks, and as such are usually approached by attackers using a common attack methodology to penetrate deeper and deeper into the network. This approach often is composed of several phases, including gaining access to the control network, reconnaissance, profiling of vulnerabilities, launching attacks, escalating privilege, maintaining access, and obscuring or removing information that indicates that an intruder was on the system. With irrefutable proof that an external attack can lead to a compromise of a computing resource on the organization's business local area network (LAN), access to the control network is usually considered the first phase in the attack plan. Once the attacker gains access to the control network through direct connections and/or the business LAN, the second phase of reconnaissance begins with traffic analysis within the control domain. Thus, the communications between the workstations and the field device controllers can be monitored and evaluated, allowing an attacker to capture, analyze, and evaluate the commands sent among the control equipment. Through manipulation of the communication protocols of control systems (a process generally referred to as ''reverse engineering''), an attacker can then map out the control system processes and functions. With the detailed knowledge of how the control data functions, as well as what computers and devices communicate using this data, the attacker can use a well known Man-in-the-Middle attack to perform malicious operations virtually undetected. The control systems assessment teams have used this method to gather enough information about the system to craft an attack that intercepts and changes the information flow between the end devices (controllers) and the human machine interface (HMI and/or workstation). Using this attack, the cyber assessment team has been able to demonstrate complete manipulation of devices in control systems while simultaneously modifying the data flowing back to the operator's console to give false information of the state of the system (known as ''spoofing''). This is a very effective technique for a control system attack because it allows the attacker to manipulate the system and the operator's situational awareness of the perceived system status. The three main elements of this attack technique are: (1) network reconnaissance and data gathering, (2) reverse engineering, and (3) the Man-in-the-Middle attack. The details of this attack technique and the mitigation techniques are discussed.

  17. Controlling NOx emission from industrial sources

    SciTech Connect (OSTI)

    Srivastava, R.K.; Nueffer, W.; Grano, D.; Khan, S.; Staudt, J.E.; Jozewicz, W.

    2005-07-01

    A number of regulatory actions focused on reducing NOx emissions from stationary combustion sources have been taken in the United States in the last decade. These actions include the Acid Rain NOx regulations, the Ozone Transport Commission's NOx Budget Program, and the NOx SIP Call rulemakings. In addition to these regulations, the recent Interstate Air Quality Rulemaking proposal and other bills in the Congress are focusing on additional reductions of NOx. Industrial combustion sources accounted for about 18016 of NOx emissions in the United States in 2000 and constituted the second largest emitting source category within stationary sources, only behind electric utility sources. Based on these data, reduction of NOx emissions from industrial combustion sources is an important consideration in efforts undertaken to address the environmental concerns associated with NOx. This paper discusses primary and secondary NOx control technologies applicable to various major categories of industrial sources. The sources considered in this paper include large boilers, furnaces and fired heaters, combustion turbines, large IC engines, and cement kilns. For each source category considered in this paper, primary NOx controls are discussed first, followed by a discussion of secondary NOx controls.

  18. Gemini Scout Control Software

    Energy Science and Technology Software Center (OSTI)

    2010-11-23

    The Gemini Scout Control Software consists of two Windows applications that allow the Gemini Scout vehicle to be controlled by an operator. The Embedded application runs on the vehicle's Gemini Scout Control Software onboard computer and controls the vehicle's various motors and sensors. This application reports the vehicle's status and receives vehicle commands overthe local-area-network. The Embedded applicationalso allows the user to control the vehicle using a USB game-pad connected directly to the vehicle. Themore » Operator Control Unit (OCU) application runs on an external PC and communicates with the vehicle via an Ethernet connection. The OCU application sends commands to and receives data from the Embedded application running on the vehicle. The OCU application also communicates directly with the digital video encoders and radios in order to display video from the vehicle's cameras and the status of the radio link. The OCU application has a graphical user interface (GUI) that displays the vehicle's status and allows the user to change various vehicle settings. Finally, the OCU application receives input from a USB game-pad connected to the PC in order to control the vehicle's functions.« less

  19. Introduction to Control Part 1

    SciTech Connect (OSTI)

    Scheinker, Alexander

    2015-07-13

    Presentation that offers an introduction to Control Theory, sponsored by the Los Alamos National Laboratory, Low Level RF Control Group.

  20. Upcoming Webinars to Focus on Topics Addressed in the National Academies of Sciences’ "Analytical Foundations for the Next Generation Electric Grid" Report

    Broader source: Energy.gov [DOE]

    The National Academies of Sciences’ Board of Mathematical Sciences and Their Application will conduct two webinars in April, 2016 in conjunction with the recent release of its report entitled Analytical Foundations for the Next Generation Electric Grid. The focus of the study, which was funded in part by the Office of Electricity Delivery and Energy Reliability, was to identify the critical areas of mathematical and computational research that must be addressed for the next-generation electric transmission and distribution system. The report also includes a series of recommendations.