National Library of Energy BETA

Sample records for mailing address city

  1. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  2. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  3. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  6. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  7. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  8. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  9. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  10. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  11. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  12. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  13. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  14. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  15. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  16. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  17. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  18. FTCP Site Specific Information - Kansas City | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kansas City FTCP Site Specific Information - Kansas City FTCP Agent Organization Name Phone E-Mail Kansas City Mark L. Holecek 816-488-3920 mark.holecek@nnsa.srs.gov

  19. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  20. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  1. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  2. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  3. ASER Web Addresses and Points of Contact at DOE Sites

    Office of Environmental Management (EM)

    ASER Web Addresses and Points of Contact at DOE Sites March 29, 2013 Site and Web Address ASER Contact Name Phone E-mail Ames Laboratory http:www.ameslab.govoperationsesha...

  4. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  5. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  6. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  7. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  8. Alternative Fuels Data Center: Cities Clean up With Biofuels

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Cities Clean up With Biofuels to someone by E-mail Share Alternative Fuels Data Center: Cities Clean up With Biofuels on Facebook Tweet about Alternative Fuels Data Center: Cities Clean up With Biofuels on Twitter Bookmark Alternative Fuels Data Center: Cities Clean up With Biofuels on Google Bookmark Alternative Fuels Data Center: Cities Clean up With Biofuels on Delicious Rank Alternative Fuels Data Center: Cities Clean up With Biofuels on Digg Find More places to share Alternative Fuels Data

  9. Alternative Fuels Data Center: Clean Cities Celebrates 15th Anniversary

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Cities Celebrates 15th Anniversary to someone by E-mail Share Alternative Fuels Data Center: Clean Cities Celebrates 15th Anniversary on Facebook Tweet about Alternative Fuels Data Center: Clean Cities Celebrates 15th Anniversary on Twitter Bookmark Alternative Fuels Data Center: Clean Cities Celebrates 15th Anniversary on Google Bookmark Alternative Fuels Data Center: Clean Cities Celebrates 15th Anniversary on Delicious Rank Alternative Fuels Data Center: Clean Cities Celebrates 15th

  10. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity Addressing Cybersecurity Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. March 17, 2016 Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. Contact Richard P. Feynman Center for Innovation (505) 665-9090 Email Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the

  11. Northern Colorado Clean Cities | Open Energy Information

    Open Energy Info (EERE)

    Cities Jump to: navigation, search Name: Northern Colorado Clean Cities Address: PO Box 759 Place: Johnstown, Colorado Zip: 80534 Region: Rockies Area Number of Employees:...

  12. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity March 17, 2016 Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the challenges organizations face in trying to protect their data. According to Experian, the risk of a data breach is higher than ever with almost half of organizations suffering at least one security incident in the last 12 months. It's no wonder industry and government are looking for more tools to keep their data safe. To this end, in 2015, Los Alamos

  13. Alternative Fuels Data Center: Alabama City Leads With Biodiesel and

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Ethanol Alabama City Leads With Biodiesel and Ethanol to someone by E-mail Share Alternative Fuels Data Center: Alabama City Leads With Biodiesel and Ethanol on Facebook Tweet about Alternative Fuels Data Center: Alabama City Leads With Biodiesel and Ethanol on Twitter Bookmark Alternative Fuels Data Center: Alabama City Leads With Biodiesel and Ethanol on Google Bookmark Alternative Fuels Data Center: Alabama City Leads With Biodiesel and Ethanol on Delicious Rank Alternative Fuels Data

  14. Alternative Fuels Data Center: Electric Trucks Deliver at Kansas City

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Schools Electric Trucks Deliver at Kansas City Schools to someone by E-mail Share Alternative Fuels Data Center: Electric Trucks Deliver at Kansas City Schools on Facebook Tweet about Alternative Fuels Data Center: Electric Trucks Deliver at Kansas City Schools on Twitter Bookmark Alternative Fuels Data Center: Electric Trucks Deliver at Kansas City Schools on Google Bookmark Alternative Fuels Data Center: Electric Trucks Deliver at Kansas City Schools on Delicious Rank Alternative Fuels

  15. Alternative Fuels Data Center: North Carolina City Expands Alternative Fuel

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fleet North Carolina City Expands Alternative Fuel Fleet to someone by E-mail Share Alternative Fuels Data Center: North Carolina City Expands Alternative Fuel Fleet on Facebook Tweet about Alternative Fuels Data Center: North Carolina City Expands Alternative Fuel Fleet on Twitter Bookmark Alternative Fuels Data Center: North Carolina City Expands Alternative Fuel Fleet on Google Bookmark Alternative Fuels Data Center: North Carolina City Expands Alternative Fuel Fleet on Delicious Rank

  16. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  17. BEST CITIES

    Energy Science and Technology Software Center (OSTI)

    003034MLTPL00 Benchmarking and Energy Saving Tool for Low Carbon Cities (BEST Cities) http://china.lbl.gov/tools-guidebooks/best-cities

  18. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  19. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  20. Alternative Fuels Data Center: Clean Cities Helps National Parks Model

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Sustainable Transportation Clean Cities Helps National Parks Model Sustainable Transportation to someone by E-mail Share Alternative Fuels Data Center: Clean Cities Helps National Parks Model Sustainable Transportation on Facebook Tweet about Alternative Fuels Data Center: Clean Cities Helps National Parks Model Sustainable Transportation on Twitter Bookmark Alternative Fuels Data Center: Clean Cities Helps National Parks Model Sustainable Transportation on Google Bookmark Alternative Fuels

  1. Alternative Fuels Data Center: Propane Vans Keep Kansas City Transportation

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Company Rolling Propane Vans Keep Kansas City Transportation Company Rolling to someone by E-mail Share Alternative Fuels Data Center: Propane Vans Keep Kansas City Transportation Company Rolling on Facebook Tweet about Alternative Fuels Data Center: Propane Vans Keep Kansas City Transportation Company Rolling on Twitter Bookmark Alternative Fuels Data Center: Propane Vans Keep Kansas City Transportation Company Rolling on Google Bookmark Alternative Fuels Data Center: Propane Vans Keep

  2. Alternative Fuels Data Center: Triangle Clean Cities Resource Gives CNG

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Installation a Boost Triangle Clean Cities Resource Gives CNG Installation a Boost to someone by E-mail Share Alternative Fuels Data Center: Triangle Clean Cities Resource Gives CNG Installation a Boost on Facebook Tweet about Alternative Fuels Data Center: Triangle Clean Cities Resource Gives CNG Installation a Boost on Twitter Bookmark Alternative Fuels Data Center: Triangle Clean Cities Resource Gives CNG Installation a Boost on Google Bookmark Alternative Fuels Data Center: Triangle

  3. Alternative Fuels Data Center: Cities Make the Clean Switch to Natural Gas

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Cities Make the Clean Switch to Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Cities Make the Clean Switch to Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Cities Make the Clean Switch to Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Cities Make the Clean Switch to Natural Gas on Google Bookmark Alternative Fuels Data Center: Cities Make the Clean Switch to Natural Gas on Delicious Rank Alternative Fuels Data Center: Cities Make the

  4. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  5. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  6. Alternative Fuels Data Center: Clean Cities Helps Green the National Mall

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Helps Green the National Mall to someone by E-mail Share Alternative Fuels Data Center: Clean Cities Helps Green the National Mall on Facebook Tweet about Alternative Fuels Data Center: Clean Cities Helps Green the National Mall on Twitter Bookmark Alternative Fuels Data Center: Clean Cities Helps Green the National Mall on Google Bookmark Alternative Fuels Data Center: Clean Cities Helps Green the National Mall on Delicious Rank Alternative Fuels Data Center: Clean Cities Helps Green the

  7. Alternative Fuels Data Center: Clean Cities Reflects on 20 Years of

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Alternative Fuels Clean Cities Reflects on 20 Years of Alternative Fuels to someone by E-mail Share Alternative Fuels Data Center: Clean Cities Reflects on 20 Years of Alternative Fuels on Facebook Tweet about Alternative Fuels Data Center: Clean Cities Reflects on 20 Years of Alternative Fuels on Twitter Bookmark Alternative Fuels Data Center: Clean Cities Reflects on 20 Years of Alternative Fuels on Google Bookmark Alternative Fuels Data Center: Clean Cities Reflects on 20 Years of

  8. Alternative Fuels Data Center: Kansas City Greens Its Fleet With Natural

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Gas and Biodiesel Kansas City Greens Its Fleet With Natural Gas and Biodiesel to someone by E-mail Share Alternative Fuels Data Center: Kansas City Greens Its Fleet With Natural Gas and Biodiesel on Facebook Tweet about Alternative Fuels Data Center: Kansas City Greens Its Fleet With Natural Gas and Biodiesel on Twitter Bookmark Alternative Fuels Data Center: Kansas City Greens Its Fleet With Natural Gas and Biodiesel on Google Bookmark Alternative Fuels Data Center: Kansas City Greens Its

  9. Alternative Fuels Data Center: Natural Gas School Buses Help Kansas City

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Save Money Natural Gas School Buses Help Kansas City Save Money to someone by E-mail Share Alternative Fuels Data Center: Natural Gas School Buses Help Kansas City Save Money on Facebook Tweet about Alternative Fuels Data Center: Natural Gas School Buses Help Kansas City Save Money on Twitter Bookmark Alternative Fuels Data Center: Natural Gas School Buses Help Kansas City Save Money on Google Bookmark Alternative Fuels Data Center: Natural Gas School Buses Help Kansas City Save Money on

  10. Alternative Fuels Data Center: New York City Cleans up With Alternative

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fuel Vehicles New York City Cleans up With Alternative Fuel Vehicles to someone by E-mail Share Alternative Fuels Data Center: New York City Cleans up With Alternative Fuel Vehicles on Facebook Tweet about Alternative Fuels Data Center: New York City Cleans up With Alternative Fuel Vehicles on Twitter Bookmark Alternative Fuels Data Center: New York City Cleans up With Alternative Fuel Vehicles on Google Bookmark Alternative Fuels Data Center: New York City Cleans up With Alternative Fuel

  11. Alternative Fuels Data Center: Salt Lake City Fuels Vehicles With Natural

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Gas Salt Lake City Fuels Vehicles With Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Salt Lake City Fuels Vehicles With Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Salt Lake City Fuels Vehicles With Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Salt Lake City Fuels Vehicles With Natural Gas on Google Bookmark Alternative Fuels Data Center: Salt Lake City Fuels Vehicles With Natural Gas on Delicious Rank Alternative Fuels Data

  12. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  13. Sun City Solar Energy | Open Energy Information

    Open Energy Info (EERE)

    Energy Jump to: navigation, search Logo: Sun City Solar Energy Name: Sun City Solar Energy Address: 20227 S. 137th E. Ave. Place: Bixby, Oklahoma Zip: 74008 Sector: Solar Product:...

  14. Alternative Fuels Data Center: City of Chicago Program Encourages Petroleum

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Displacement and Collaboration Between Departments City of Chicago Program Encourages Petroleum Displacement and Collaboration Between Departments to someone by E-mail Share Alternative Fuels Data Center: City of Chicago Program Encourages Petroleum Displacement and Collaboration Between Departments on Facebook Tweet about Alternative Fuels Data Center: City of Chicago Program Encourages Petroleum Displacement and Collaboration Between Departments on Twitter Bookmark Alternative Fuels Data

  15. Sandia National Laboratories: 100 Resilient Cities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    100 Resilient Cities - Sandia Challenge Facebook Twitter YouTube Flickr RSS 100 Resilient Cities - Sandia Challenge 100 Resilient Cities Helping leaders better assess resilience challenges Picture of global map and transportation Providing technical expertise to help cities better address the shocks & stresses of the 21st Century Solar panels Energy Researcher in lab Water Medical image Medical Red and green peppers Food Picture of globe Economy Map of city Risk Analysis Worker and machine

  16. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  17. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  18. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  19. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  20. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  1. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  2. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  3. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  4. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  5. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  6. Alternative Fuels Data Center: Clean Cities Helps the National Mall Cut

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Petroleum Use With Propane Mowers Cities Helps the National Mall Cut Petroleum Use With Propane Mowers to someone by E-mail Share Alternative Fuels Data Center: Clean Cities Helps the National Mall Cut Petroleum Use With Propane Mowers on Facebook Tweet about Alternative Fuels Data Center: Clean Cities Helps the National Mall Cut Petroleum Use With Propane Mowers on Twitter Bookmark Alternative Fuels Data Center: Clean Cities Helps the National Mall Cut Petroleum Use With Propane Mowers on

  7. Alternative Fuels Data Center: Kansas City Home to Nation's Largest Network

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    of EV Charging Stations Kansas City Home to Nation's Largest Network of EV Charging Stations to someone by E-mail Share Alternative Fuels Data Center: Kansas City Home to Nation's Largest Network of EV Charging Stations on Facebook Tweet about Alternative Fuels Data Center: Kansas City Home to Nation's Largest Network of EV Charging Stations on Twitter Bookmark Alternative Fuels Data Center: Kansas City Home to Nation's Largest Network of EV Charging Stations on Google Bookmark Alternative

  8. Clean Cities

    Broader source: Energy.gov [DOE]

    Clean Cities works to reduce U.S. reliance on petroleum in transportation by establishing local coalitions of public- and private-sector stakeholders across the country.

  9. Clean Cities: Utah Clean Cities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cities Coalition as the Communications and Northern Coordinator in July 2015. Her formal education is in Organizational Communications and she earned her degree at the University...

  10. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  11. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  12. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  13. Addressing failures in exascale computing

    SciTech Connect (OSTI)

    Snir, Marc; Wisniewski, Robert W.; Abraham, Jacob A.; Adve, Sarita; Bagchi, Saurabh; Balaji, Pavan; Belak, Jim; Bose, Pradip; Cappello, Franck; Carlson, William; Chien, Andrew A.; Coteus, Paul; Debardeleben, Nathan A.; Diniz, Pedro; Engelmann, Christian; Erez, Mattan; Saverio, Fazzari; Geist, Al; Gupta, Rinku; Johnson, Fred; Krishnamoorthy, Sriram; Leyffer, Sven; Liberty, Dean; Mitra, Subhasish; Munson, Todd; Schreiber, Robert; Stearly, Jon; Van Hensbergen, Eric

    2014-05-01

    We present here a report produced by a workshop on Addressing Failures in Exascale Computing held in Park City, Utah, August 411, 2012. The charter of this workshop was to establish a common taxonomy about resilience across all the levels in a computing system; discuss existing knowledge on resilience across the various hardware and software layers of an exascale system; and build on those results, examining potential solutions from both a hardware and software perspective and focusing on a combined approach. The workshop brought together participants with expertise in applications, system software, and hardware; they came from industry, government, and academia; and their interests ranged from theory to implementation. The combination allowed broad and comprehensive discussions and led to this document, which summarizes and builds on those discussions.

  14. change_address_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CHANGE OF ADDRESS and EMERGENCY NOTIFICATION TO: HUMAN RESOURCES DATE: Z Social Security Print First Name Print Middle Name or Initial Print Last Name (Currently in Payroll...

  15. kansas city

    National Nuclear Security Administration (NNSA)

    Kansas City team was singled out for safely and securely relocating to the LEED Gold certified facility from 2012-2014. The move was completed one month ahead of schedule...

  16. City of La Junta, Colorado (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    search Logo: City of La Junta Name: City of La Junta Address: 222 West 1st. Street, PO Box 630 Place: La Junta, Colorado Zip: 81050 Region: Rockies Area Sector: Services Product:...

  17. City of Tyler, Minnesota (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City of Tyler, Minnesota (Utility Company) Jump to: navigation, search Name: City of Tyler Address: 230 North Tyler Street Place: Tyler, MN Zip: 56178 Phone Number: 507-247-5176...

  18. CenterPoint Energy- SCORE and CitySmart Program

    Broader source: Energy.gov [DOE]

    CenterPoint Energy offers the SCORE and CitySmart Programs to help customers address energy costs through energy efficiency. The SCORE and CitySmart Programs provide complimentary tools, services...

  19. Alternative Fuels Data Center: Austin Lays Plans for Carbon-Neutral City

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fleet Austin Lays Plans for Carbon-Neutral City Fleet to someone by E-mail Share Alternative Fuels Data Center: Austin Lays Plans for Carbon-Neutral City Fleet on Facebook Tweet about Alternative Fuels Data Center: Austin Lays Plans for Carbon-Neutral City Fleet on Twitter Bookmark Alternative Fuels Data Center: Austin Lays Plans for Carbon-Neutral City Fleet on Google Bookmark Alternative Fuels Data Center: Austin Lays Plans for Carbon-Neutral City Fleet on Delicious Rank Alternative Fuels

  20. City Utilities of Springfield Missouri Comments on Smart Grid RFI:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Policy and Logistical Challenges | Department of Energy Utilities of Springfield Missouri Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges City Utilities of Springfield Missouri Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges City Utilities of Springfield Missouri provides comments in response to the Smart Grid RFI: Addressing Policy and Logistical Challenges PDF icon Smart Grid RFI: Addressing Policy and Logistical Challenges More

  1. Clean Cities Internships

    Broader source: Energy.gov [DOE]

    Clean Cities offers internships through the Clean Cities University Workforce Development Program, which unites Clean Cities coalitions with students interested in changing the future of onroad...

  2. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  3. City of Hope, Arkansas (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Arkansas (Utility Company) Jump to: navigation, search Name: City of Hope Address: 105 N. Elm St. Place: Hope, AR Zip: 71801 Service Territory: Arkansas Phone Number:...

  4. City of Centralia, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Company) Jump to: navigation, search Name: City of Centralia Address: 500 N Pearl Street Place: Centralia, WA Zip: 98531 Phone Number: 360-330-7657 Website:...

  5. City of Taunton, Massachusetts (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Lighting Plant (TMLP)) Jump to: navigation, search Name: City of Taunton Address: 33 Weir Street Place: Taunton, Massachusetts Zip: 02780 Phone Number: (508) 824 - 5844 Website:...

  6. City of Taunton, Massachusetts (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    (Utility Company) Jump to: navigation, search Name: City of Taunton Address: 33 Weir Street Place: Taunton, Massachusetts Zip: 02780 Phone Number: (508) 824 - 5844 Website:...

  7. City of Ellensburg, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Company) Jump to: navigation, search Name: City of Ellensburg Address: 501 North Anderson Street Place: Ellensburg, WA Zip: 98926 Phone Number: (509) 962-7204 Website:...

  8. City Utilities of Springfield Missouri Comments on Smart Grid...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Utilities of Springfield Missouri Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges City Utilities of Springfield Missouri Comments on Smart Grid RFI: ...

  9. City of Anaheim, California (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    Utilities) Jump to: navigation, search Name: City of Anaheim Address: 201 South Anaheim Boulevard Place: Anaheim, CA Website: www.anaheim.netarticle.asp?id References: EIA Form...

  10. City of Anaheim, California (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    Anaheim) Jump to: navigation, search Name: City of Anaheim Address: 201 South Anaheim Boulevard Place: Anaheim, CA Website: www.anaheim.netarticle.asp?id References: EIA Form...

  11. Clean Cities: Ann Arbor Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Clean Cities Coalition in April 2015. She served as Clean Cities intern for both the Detroit and Ann Arbor Clean Cities Coalitions from the fall 2013 through the winter 2015 and...

  12. City of Tacoma | Open Energy Information

    Open Energy Info (EERE)

    Tacoma Jump to: navigation, search Name: City of Tacoma Address: Department of Public Utilities 3628 South 35th St Place: Tacoma Zip: 98409 Region: United States Sector: Marine and...

  13. Clean Cities: Southern Colorado Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Colorado Clean Cities coalition Contact Information Kyle Lisek 303-847-0271 klisek@lungs.org Coalition Website Clean Cities Coordinator Kyle Lisek Kyle Lisek is coordinator of...

  14. Clean Cities: Denver Metro Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Metro Clean Cities coalition Contact Information Tyler Svitak 303-847-0281 tsvitak@lungs.org Coalition Website Clean Cities Coordinator Tyler Svitak Photo of Tyler Svitak...

  15. Clean Cities: Los Angeles Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    took on the role of Clean Cities Coordinator. His major job duties focus on mobile source air pollution reduction programs. He has managed the City's Interdepartmental Alternative...

  16. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  17. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  18. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  19. Clean Cities: Denver Metro Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Metro Clean Cities coalition Contact Information Tyler Svitak 303-847-0281 tsvitak@lungs.org Janna West-Heiss 303-847-0276 jwheiss@lungs.org Coalition Website Clean Cities...

  20. Clean Cities: Wisconsin Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    as co-director for South Shore Clean Cities of Northern Indiana from 2005-2011. Her dedication to the Clean Cities' mission extends north to Wisconsin where she has served as...

  1. Clean Cities Coalition Regions

    Broader source: Energy.gov [DOE]

    Nearly 100 Clean Cities coalitions work to reduce petroleum use in communities across the country. Led by Clean Cities coordinators, coalitions are composed of businesses, fuel providers, vehicle...

  2. Brinkman Addresses JLab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brinkman Addresses JLab Brinkman Addresses JLab Brinkman Addresses JLab Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. "There is still a lot of interesting nuclear physics that we want to do

  3. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  4. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  5. Clean Cities: North Dakota Clean Cities coalition

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Clean Cities. Moffitt is the communications director for the Clean Fuel & Vehicle Technology program of the American Lung Association of the Upper Midwest. He joined the...

  6. Address:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Additive Manufacturing for Ceramics Citation Details In-Document Search Title: Additive Manufacturing for Ceramics Authors: Peterson, Dominic S. [1] + Show Author Affiliations Los Alamos National Laboratory [Los Alamos National Laboratory Publication Date: 2014-01-29 OSTI Identifier: 1119593 Report Number(s): LA-UR-14-20523 DOE Contract Number: AC52-06NA25396 Resource Type: Technical Report Research Org: Los Alamos National Laboratory (LANL) Sponsoring Org: DOE/LANL Country of Publication:

  7. City of Jewett City, Connecticut (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Jewett City, Connecticut (Utility Company) Jump to: navigation, search Name: Jewett City City of Place: Connecticut Phone Number: (860) 376-2877 Website: jewettcitydpu.com Outage...

  8. City of Cuba City, Wisconsin (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Cuba City, Wisconsin (Utility Company) Jump to: navigation, search Name: City of Cuba City Place: Wisconsin Phone Number: (608) 744-8735 Website: www.cubacitylightandwater.org...

  9. Rapid Assessment of City Emissions (RACE): Case of Batangas City...

    Open Energy Info (EERE)

    Rapid Assessment of City Emissions (RACE): Case of Batangas City, Philippines Jump to: navigation, search Tool Summary Name: Rapid Assessment of City Emissions (RACE): Case of...

  10. City of Webster City, Iowa (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City, Iowa (Utility Company) Jump to: navigation, search Name: City of Webster City Place: Iowa Phone Number: (515) 832-9151 Website: www.webstercity.comindex.php Twitter:...

  11. Keynote Address | Department of Energy

    Office of Environmental Management (EM)

    40PM to 2:05PM PDT Pacific Ballroom Wednesday keynote address by Dan Arvizu, Director, National Renewable Energy Laboratory

  12. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  13. Clean Cities Program Contacts

    SciTech Connect (OSTI)

    2015-07-31

    Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

  14. Global Cool Cities Alliance

    Broader source: Energy.gov [DOE]

    The Department of Energy (DOE) is currently supporting the Global Cool Cities Alliance (GCCA), a non-profit organization that works with cities, regions, and national governments to speed the...

  15. Bioenergy & Clean Cities

    Broader source: Energy.gov [DOE]

    DOE's Bioenergy Technologies Office and the Clean Cities program regularly conduct a joint Web conference for state energy office representatives and Clean Cities coordinators. The Web conferences...

  16. What is Clean Cities?

    SciTech Connect (OSTI)

    Not Available

    2008-09-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions.

  17. What Is Clean Cities?

    SciTech Connect (OSTI)

    Not Available

    2008-04-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions.

  18. City of Tacoma, Washington (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Tacoma City of Address: 3628 South 35th Street Place: Tacoma, WA Zip: 98409 Phone Number: (800) 752-6745 Website: www.mytpu.orgtacomapower...

  19. City of Tacoma, Washington (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Power) Jump to: navigation, search Name: Tacoma City of Address: 3628 South 35th Street Place: Tacoma, WA Zip: 98409 Phone Number: (800) 752-6745 Website: www.mytpu.org...

  20. City of Anaheim, California (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    City of Anaheim Address: 201 South Anaheim Boulevard Place: Anaheim, CA Website: www.anaheim.netarticle.asp?id References: EIA Form EIA-861 Final Data File for 2010 - File1a1...

  1. Keynote Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    10PM to 1:40PM PDT Pacific Ballroom Wednesday's keynote address by Dr. David Danielson, Assistant Secretary for Energy Efficiency and Renewable Energy, U.S. Department of Energy

  2. Clean Cities: Clean Cities-Georgia

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Atlanta was designated as the first Clean Cities coalition in the nation at the Georgia Dome in 1993. Prior to being elected as the coalition's executive director, Francis served...

  3. Clean Cities: Long Beach Clean Cities coalition

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    15 years. Tedtaotao was appointed co-coordinator of Long Beach Clean Cities in January, 2014. LA County Public Works 2275 Alcazar St Los Angeles, CA 90033 Search Coalitions Search...

  4. Clean Cities: Honolulu Clean Cities coalition

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    County; City of Honolulu Designated: August 29, 1995 Alternative Fueling Stations: Biodiesel (B20 and above): 3 Natural Gas: 1 Ethanol (E85): 3 Electric: 250 Hydrogen: 2 Propane:...

  5. Kansas City Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Kansas City Field Office

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  7. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  8. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  9. Future City Competition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Future City Competition The New Mexico Regional Competition is an unique opportunity for middle school children to combine skills in engineering, environmental science, and art to create a vision for the future. Exercising your imagination and sharing your ideas are not only fun but essential for ensuring sustainable growth for our communities. Students work as a team with an educator and engineer mentor to plan cities using SimCity(tm) software: research and write solutions to an engineering

  10. Future City Competition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Future City Competition The New Mexico Regional Competition is an unique opportunity for middle school children to combine skills in engineering, environmental science, and art to...

  11. Clean Cities & Transportation Tools

    Broader source: Energy.gov [DOE]

    This presentation, presented on July 28, 2010, was on the DOE Clean Cities program to promote the use of alternative fuels and reduce petroleum consumption.

  12. State of the Lab Address

    ScienceCinema (OSTI)

    King, Alex

    2013-03-01

    In his third-annual State of the Lab address, Ames Laboratory Director Alex King called the past year one of "quiet but strong progress" and called for Ames Laboratory to continue to build on its strengths while responding to changing expectations for energy research.

  13. City of Big Stone City, South Dakota (Utility Company) | Open...

    Open Energy Info (EERE)

    City, South Dakota (Utility Company) Jump to: navigation, search Name: City of Big Stone City Place: South Dakota Phone Number: (605) 862-8121 Website: www.bigstonecitysd.govoffice...

  14. City of Phoenix- Design Standards for City Buildings

    Broader source: Energy.gov [DOE]

    The City of Phoenix has had energy standards for public buildings in place since 2005. In June 2005, the Phoenix City Council adopted a policy requiring all new city buildings built with 2006 bond...

  15. City of Hill City, Kansas (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Hill City, Kansas (Utility Company) Jump to: navigation, search Name: City of Hill City Place: Kansas Phone Number: (785) 421-3438 Website: www.discoverhillcity.comBusin Outage...

  16. City of Elizabeth City, North Carolina (Utility Company) | Open...

    Open Energy Info (EERE)

    Elizabeth City, North Carolina (Utility Company) Jump to: navigation, search Name: City of Elizabeth City Place: North Carolina Phone Number: (252) 337-6870 or (252) 335-2196...

  17. City of Central City, Nebraska (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    City of Central City, Nebraska (Utility Company) Jump to: navigation, search Name: Central City Municipal Power Place: Nebraska Phone Number: 308.946.3806 Website: www.cc-ne.com...

  18. Addressing Deferred Maintenance, Infrastructure Costs, and Excess...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities at Portsmouth and Paducah Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities ...

  19. Clean Cities: Connecticut Southwestern Area Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Connecticut Southwestern Area Clean Cities Coalition The Connecticut Southwestern Area Clean Cities coalition works with vehicle fleets, fuel providers, community leaders, and...

  20. Clean Cities: Capitol Clean Cities of Connecticut coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Capitol Clean Cities of Connecticut Coalition The Capitol Clean Cities of Connecticut coalition works with vehicle fleets, fuel providers, community leaders, and other stakeholders...

  1. City of David City, Nebraska (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    David City, Nebraska (Utility Company) Jump to: navigation, search Name: David City Municipal Power Place: Nebraska Phone Number: 402.367.3135 Website: davidcityne.comutilities...

  2. Clean Cities: Alamo Area Clean Cities (San Antonio) coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alamo Area Clean Cities (San Antonio) Coalition The Alamo Area Clean Cities (San Antonio) coalition works with vehicle fleets, fuel providers, community leaders, and other...

  3. Addressing the workforce pipeline challenge

    SciTech Connect (OSTI)

    Leonard Bond; Kevin Kostelnik; Richard Holman

    2006-11-01

    A secure and affordable energy supply is essential for achieving U.S. national security, in continuing U.S. prosperity and in laying the foundations to enable future economic growth. To meet this goal the next generation energy workforce in the U.S., in particular those needed to support instrumentation, controls and advanced operations and maintenance, is a critical element. The workforce is aging and a new workforce pipeline, to support both current generation and new build has yet to be established. The paper reviews the challenges and some actions being taken to address this need.

  4. POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Addressing Missclassified Positions POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions This memorandum provides policy guidance on how to consistently address misclassified positions within the Department and is effective immediately. There are several different circumstances that affect how a misclassified position will be addressed. PDF icon POLICY GUIDANCE MEMORANDUM #3A Addressing Missclassified Positions Responsible Contacts Jennifer Ackerman

  5. Clean Cities: Coalition Contacts

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Ficicchia Empire Clean Cities Northeast 212-839-7728 Christina Ficicchia See Bio 55 Water St, 9th Fl New York, NY 10041 Website New York David Keefe Genesee Region Clean...

  6. kansas city plant

    National Nuclear Security Administration (NNSA)

    accolades for an outstanding safety record during the move to its new, state-of-the art facility in Kansas City, Mo. In 2013, the NSC achieved its best safety performance on...

  7. Smart Cities Innovation Summit

    Broader source: Energy.gov [DOE]

    The Smart Cities Innovation Summit is the leading summit for policy, technology, and resource management to meet with leading solution providers in transportation, energy, water, healthcare, education, and more.

  8. City of Houston Joins Better Buildings Challenge, Partners with Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department to Reduce Energy Waste and Boost Efficiency | Department of Energy City of Houston Joins Better Buildings Challenge, Partners with Energy Department to Reduce Energy Waste and Boost Efficiency City of Houston Joins Better Buildings Challenge, Partners with Energy Department to Reduce Energy Waste and Boost Efficiency January 26, 2012 - 2:05pm Addthis Washington, D.C. - Building on President Obama's call in the State of the Union address earlier this week for a new era for American

  9. What is Clean Cities? (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2011-03-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 87 coalitions.

  10. Addressing Chromium in Groundwater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Chromium in Groundwater Addressing Chromium in Groundwater From 1956 to 1972, a non-nuclear power plant at Los Alamos National Laboratory periodically flushed water out ...

  11. Deputy Secretary Poneman Addresses Nuclear Deterrence Summit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Nuclear Deterrence Summit Deputy Secretary Poneman Addresses Nuclear Deterrence Summit February 17, 2010 - 12:00am Addthis Alexandria, VA - U.S. Deputy Secretary of ...

  12. EPA -- Addressing Children's Health through Reviews Conducted...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EPA -- Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act EPA -- Addressing Children's ...

  13. Expanding Opportunity and Addressing Unique Challenges Facing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color ...

  14. CCEI REU Program Application | University of Delaware

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Street: City: State: Zip: Contact Information: Cell Phone: Email: Demographics Gender: Male Female Housing: Will you need campus housing? Yes No Citizenship:...

  15. Los Alamos National Laboratory Postdoctoral Career Fair 2015

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form August 25 - 27, 2015 Company Name Mailing Address City State Zip Code Contact Person: Name Telephone email Recruiter 1 Name Recruiter 2 Name Recruiter 3 Name Recruiter...

  16. BPA-2015-00051-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Carrie Henderson Email Organiz ation Mailing Address City State Phone FAX Ex. xxx-xxx-xxxx Date Redd: 1082014 Due Date: 1162014 Tracking Number;...

  17. BPA-2013-01459-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Charles Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street Suite 1050 City Portland...

  18. BPA-2013-01457-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Charles Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street Suite 1050 City Portland...

  19. BPA-2015-01211-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Number: BPA-2015-0121 1-F Email chuckoregonpsr.org Organization Oregon Physicians for Social Responsibility Mailing 812 SW Washington Street, Suite 1050 Address City Portland...

  20. BPA-2013-01495-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Chuck Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street, Suite 1050 City Portland...

  1. Clean Cities Program Contacts

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Coordinators Each Clean Cities coalition is led by a coordinator. Contact a coordinator to find out more about Clean Cities activities in your area. AL-Alabama Mark Bentley 205-402-2755 mark@alabamacleanfuels.org AR-Arkansas Patti Springs 501-682-8065 psprings@arkansasedc.com AZ-Valley of the Sun (Phoenix) Bill Sheaffer 480-314-0360 bill@cleanairaz.org AZ-Tucson Colleen Crowninshield 520-792-1093, x426 ccrowninshield@pagregion.com CA-Central Coast (San Luis Obispo) Melissa Guise 805-305-5491

  2. Address conversion unit for multiprocessor system

    SciTech Connect (OSTI)

    Fava, T.F.; Lary, R.F.; Blackledge, R.

    1987-03-03

    An address conversion unit is described for use in one processor in a multi-processor data processing system including a common memory, the processors and common memory being interconnected by a common bus including means for transferring address signals defining a common address space. The processor includes private bus means including means for transferring signals including address signals defining a private address space. A processor unit means is connected to the private bus means and includes means for transmitting and receiving signals including address signals over the private bus means for engaging in data transfers thereover. The address conversion unit is connected to the private bus means and common bus means for receiving address signals over the private bus means from the processor unit means in the private address space. The unit comprises: A. pointer storage means for storing a pointer identifying a portion of the common bus memory space; B. pointer generation means connected to receive a common bus address and for generating a pointer in response thereto for storage in the pointer storage means; and C. common bus address generation means connected to the private bus and the pointer storage means for receiving an address from the processor unit means and for generating a common bus address in response thereto. The common bus address is used to initiate transfers between the processor unit means and the common memory over the common bus.

  3. City of Tipp City, Ohio (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Facebook: https:www.facebook.compagesCity-of-Tipp-City-Government141547651651?refts&frefts Outage Hotline: 937-667-8424 References: EIA Form EIA-861 Final Data File...

  4. City of Forest City, Iowa (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    .cityofforestcity.comdepar Facebook: https:www.facebook.compagesCity-of-Forest-City-IA142928346092 Outage Hotline: (641) 585-3574 or (641) 585-4343 References: EIA Form...

  5. City of Asheville- Efficiency Standards for City Buildings

    Broader source: Energy.gov [DOE]

    In April 2007, the Asheville City Council adopted carbon emission reduction goals and set LEED standards for new city buildings. The council committed to reducing carbon emissions by 2% per year...

  6. City of Baldwin City, Kansas (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Kansas Phone Number: 785-594-6907 or (785) 594-6427 Website: www.baldwincity.orgcity-hall Facebook: https:www.facebook.compagesCity-of-Baldwin-City-KS65411212171 Outage...

  7. What is Clean Cities? Clean Cities, March 2010 (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2010-03-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions.

  8. What Is Clean Cities? Clean Cities, November 2009 (Revised) (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2009-11-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions.

  9. Cities Leading through Energy Analysis and Planning

    Broader source: Energy.gov [DOE]

    The Cities Leading through Energy Analysis and Planning (Cities-LEAP) project delivers standardized, localized energy data and analysis that enables cities to lead clean energy innovation and...

  10. Clean Cities Tools

    SciTech Connect (OSTI)

    2014-12-19

    The U.S. Department of Energy's Clean Cities offers a large collection of Web-based tools on the Alternative Fuels Data Center. These calculators, interactive maps, and data searches can assist fleets, fuels providers, and other transportation decision makers in their efforts to reduce petroleum use.

  11. Letter Temple

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 06/04/15 Note: Form must be filled out completely and signed prior to submittal to the following address: Nuclear Waste Partnership LLC PO Box 2078 GSA-207 Carlsbad, NM 88221 FAX: (575) 234-7050 Company Name: Address: Phone: City: State: Zip(+4): e-Mail: REMITTANCE ADDRESS (if different) Address: City: State: Zip(+4): e-Mail: Other: Address: City: State: Zip(+4): Country Code: COMPANY CONTACTS Manager Name: Sales Name: Phone: Cell: Phone: Cell: e-Mail e-Mail Service Name: Accounts Payable

  12. New Mexico Future City Competition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Mexico Future City Competition New Mexico Future City Competition WHEN: Jan 24, 2015 8:00 AM - 4:00 PM WHERE: National Museum of Nuclear Science and History 601 Eubank,...

  13. City of Eugene- Solar Standards

    Broader source: Energy.gov [DOE]

    The purpose of Eugene's Solar Standards, as described in sections 9.2780 through 9.2795 of the City of Eugene's City Code, is to create lot divisions, layouts and building configurations in a...

  14. cities | OpenEI Community

    Open Energy Info (EERE)

    cities CO2 emissions OpenEI suburbs US New research from the University of California-Berkeley shows that those who live in cities in the United States have significantly smaller...

  15. Keynote Address: Future Vision | Department of Energy

    Office of Environmental Management (EM)

    Future Vision Keynote Address: Future Vision May 20, 2014 1:00PM to 1:30PM PDT Pacific Ballroom Tuesday's keynote address by Raffi Garabedian, Chief Technology Officer, First Solar

  16. EA-1137: Nonnuclear Consolidation Weapons Production Support Project for the Kansas City Plant, Kansas City, Missouri

    Broader source: Energy.gov [DOE]

    Nonnuclear Consolidation Weapons Production Support Project for the Kansas City Plant, Kansas City, Missouri

  17. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  18. Reviewing the City of Milwaukee's Solar Financing Options

    Broader source: Energy.gov [DOE]

    This memo was originally written and delivered in draft form to the city in July 2009. Based on comments received, an addendum was added to address additional issues. Rebate levels, taxes and other information were updated as necessary in this current version.

  19. City of Phoenix- Renewable Energy Goal

    Broader source: Energy.gov [DOE]

    In 2008, the Phoenix City Council approved a renewable energy goal for the city. The city aims for 15% of the electricity used by the city to come from renewable energy sources by 2025. This goal...

  20. Understanding Energy Use in Cities Infographic

    Broader source: Energy.gov [DOE]

    This Cities Leading through Energy Analysis and Planning (Cities-LEAP) infographic describes the key points from the report, City-Level Energy Decision Making: Data Use in Energy Planning, Implementation, and Evaluation in U.S. Cities.

  1. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  2. What is Clean Cities?; Clean Cities Fact Sheet (September 2008 Update) |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy is Clean Cities?; Clean Cities Fact Sheet (September 2008 Update) What is Clean Cities?; Clean Cities Fact Sheet (September 2008 Update) Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions. PDF icon What is Clean Cities?; Clean Cities Fact Sheet (September 2008 Update) More Documents & Publications What is Clean Cities?; Clean Cities Fact Sheet (September 2008 Update) Clean Cities & Transportation Tools

  3. 350 City County Building

    Office of Legacy Management (LM)

    (. - ,- Department of Eilqgy Washington, DC20585 ,. i x \ .The Honorable Wellington E. Webb .' '. ' 350 City County Building / Denver, Colorado 80202 ., ; Dear Mayor Webb: ., ~, Secretary of Energy' Hazel O'Leary has announced's new approach to openness in the Department of Energy,(OOE) and its communications with the public. In support of this initiative, we,are pleased to forward the'enclosed'information related to the former Uhiversity of Denver Research Institute site in your, jurisdiction

  4. The INL Seismic Risk Assessment Project: Requirements for Addressing DOE

    Office of Environmental Management (EM)

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  5. Research Projects Addressing Technical Challenges to Environmentally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acceptable Shale Gas Development Selected by DOE | Department of Energy Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE Research Projects Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE November 28, 2012 - 12:00pm Addthis Washington, DC - Fifteen research projects aimed at addressing the technical challenges of producing natural gas from shales and tight sands, while simultaneously

  6. Recommendations to Address Power Reliability Concerns Raised...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a ...

  7. Energy Department Assistant Secretary Patricia Hoffman Addresses...

    Broader source: Energy.gov (indexed) [DOE]

    for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the ... In addition, whatever local reliability challenges that could arise should be manageable ...

  8. Addressing Challenges of Identifying Geometrically Diverse Sets...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Challenges of Identifying Geometrically Diverse Sets of Crystalline Porous Materials Previous Next List R. L. Martin, B. Smit, and M. Haranczyk, J. Chem Inf. Model. 52...

  9. Clean Cities: Greater New Haven Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    alternative vehicle and fuel consultation and assistance to many organizations in Connecticut and outside the state, including several towns and cities, metropolitan transit...

  10. The City of Union City | Open Energy Information

    Open Energy Info (EERE)

    Sector Wind energy Facility Type Community Wind Facility Status In Service Owner Performance Services Energy Purchaser AEP - Indiana Michigan Power Location Union City IL...

  11. City of Berkeley - Green Building Standards for City Owned and...

    Broader source: Energy.gov (indexed) [DOE]

    State California Program Type Energy Standards for Public Buildings Summary The Berkeley City Council adopted Resolution 62284 on November 18, 2003 requiring that all...

  12. Clean Cities: San Diego Regional Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Kevin Wood Kevin Wood is an associate program manager for transportation at the California Center for Sustainable Energy. He joined the San Diego Regional Clean Cities...

  13. Clean Cities: Greater Lansing Area Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Calnin has worked with the Clean Cities initiative since 2007, having supported the Detroit Area coalition as well as the Greater Lansing Area coalition. With a background that...

  14. ElectroCity Lesson

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Woodward Unit Title: Solar/Renewable Energy. Subject: Engineering Lesson Title: ElectroCity Grade Level(s): 9-10 Lesson Length: 1 day (50 Minutes) Date(s): 07/17/14 * Learning Goal(s) [What should students know, understand, or be able to do as a result of this lab or activity.] By the end of this lesson, students will have a deeper understanding of Energy Management, Policy, and Decision Making. Students will be able to discuss Energy management in the context of urban planning. * Energy

  15. * City, State, Country:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 2015 Information and/or Documents NEEDED to CREATE a NEW Event: Information needed: * Official Name of the Event * Name of Organizing Institution * Organizer Contact Name, email and phone number * Event's web site * Date(s) of event * Location the event will take place at * City, State, Country: * Per Diem amounts for lodging and M&IE (meals) * Three to four sentences on how this event is in support of SLAC/DOE and/or the Office of Science mission, therefore representation from SLAC

  16. NREL: Technology Deployment - Clean Cities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Clean Cities NREL assists the U.S. Department of Energy's Clean Cities program in supporting local actions to reduce petroleum use in transportation by providing technical assistance, educational and outreach publications, and coordinator support. Clean Cities is a national network of nearly 100 coalitions that bring together stakeholders in the public and private sectors to deploy alternative and renewable fuels, advanced vehicles, fuel economy improvements, idle-reduction measures, and new

  17. falls-city2.cdr

    Office of Legacy Management (LM)

    ... for human consumption or agricultural purposes. For more information about the LTSM Program or about the Falls City Disposal Site, contact U.S. Department of Energy Grand ...

  18. Clean Cities Around the World

    SciTech Connect (OSTI)

    Not Available

    2005-01-01

    This 2-page fact sheet provides general information regarding Clean Cities International, including background, successful activities, importance of partnerships, accomplishments, and plans.

  19. 2015 State of Indian Nations Address

    Broader source: Energy.gov [DOE]

    The President of the National Congress of American Indians will deliver his annual State of the Indian Nations address to Member of Congress, government officials, tribal leaders and citizens, and...

  20. Federal Actions to Address Impacts of Uranium

    Office of Legacy Management (LM)

    Federal Actions to Address Impacts of Uranium Contamination in the Navajo Nation 2014 Page | i TABLE OF CONTENTS Executive Summary ....................................................................................................................... 1 Introduction .................................................................................................................................... 2 Summary of Work Completed 2008-2012

  1. Addressing Water Consumption of Evaporative Coolers with Greywater

    SciTech Connect (OSTI)

    Sahai, Rashmi; Shah, Nihar; Phadke, Amol

    2012-07-01

    Evaporative coolers (ECs) provide significant gains in energy efficiency compared to vapor compression air conditioners, but simultaneously have significant onsite water demand. This can be a major barrier to deployment in areas of the world with hot and arid climates. To address this concern, this study determined where in the world evaporative cooling is suitable, the water consumption of ECs in these cities, and the potential that greywater can be used reduce the consumption of potable water in ECs. ECs covered 69percent of the cities where room air conditioners are may be deployed, based on comfort conditions alone. The average water consumption due to ECs was found to be 400 L/household/day in the United States and Australia, with the potential for greywater to provide 50percent this amount. In the rest of the world, the average water consumption was 250 L/household/day, with the potential for greywater to supply 80percent of this amount. Home size was the main factor that contributed to this difference. In the Mediterranean, the Middle East, Northern India, and the Midwestern and Southwestern United States alkalinity levels are high and water used for bleeding will likely contribute significantly to EC water consumption. Although technically feasible, upfront costs for household GW systems are currently high. In both developed and developing parts of the world, however, a direct EC and GW system is cost competitive with conventional vapor compression air conditioners. Moreover, in regions of the world that face problems of water scarcity the benefits can substantially outweigh the costs.

  2. Solar America Cities | Open Energy Information

    Open Energy Info (EERE)

    Cities Jump to: navigation, search Logo: Solar America Cities Name Solar America Cities AgencyCompany Organization U.S. Department of Energy Sector Energy Focus Area Solar Topics...

  3. Corbin City Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Corbin City Utilities Comm Jump to: navigation, search Name: Corbin City Utilities Comm Place: Kentucky Phone Number: 606-528-4026 Website: corbinutilities.com Outage Hotline:...

  4. City of Geneseo | Open Energy Information

    Open Energy Info (EERE)

    Type Community Wind Facility Status In Service Owner City of Geneseo Developer Johnson Controls City of Geneseo Location Geneseo IL Coordinates 41.42597968,...

  5. Clean Cities Expands and Strengthens Nationwide Partnerships...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Expands and Strengthens Nationwide Partnerships Clean Cities Expands and Strengthens ... Speedway as part of the inaugural Clean Cities Stakeholder Summit The Clean Energy Race

  6. China City Investment Group | Open Energy Information

    Open Energy Info (EERE)

    China City Investment Group Jump to: navigation, search Name: China City Investment Group Place: Nanjing, Jiangsu Province, China Sector: Renewable Energy Product: China-based...

  7. Climate Financing for Cities | Open Energy Information

    Open Energy Info (EERE)

    Framework1 "Cities in a Post-2012 Climate Policy Framework: Climate Financing for City Development? Views from Local Governments, Experts, and Businesses" This study...

  8. GE Global Research in Oklahoma City

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Oklahoma City, USA Oklahoma City, USA GE's first sector-specific global research center is dedicated to developing and accelerating innovative oil and gas technologies. Click to ...

  9. Story City Wind | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name Story City Wind Facility Story City Wind Sector Wind energy Facility Type Community Wind Facility Status In Service Owner Hamilton Wind Energy...

  10. Mandaluyong City, Philippines: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Mandaluyong City, Philippines: Energy Resources Jump to: navigation, search Name Mandaluyong City, Philippines Equivalent URI DBpedia GeoNames ID 1701966 Coordinates 14.5832,...

  11. City of Lake City, Minnesota (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Place: Minnesota Phone Number: (651) 345 - 5383 (8am to 4:30pm weekdays) Website: www.ci.lake-city.mn.usindex.a Outage Hotline: After Hours: (651) 345 - 4711 or (651) 345 -...

  12. City of Port Townsend Office of City Manager

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Port Townsend Office of City Manager 250 Madison Street, 2, Port Townsend, WA 98368 Telephone: (360) 379-5047 Fax: (360) 385-4290 June 27, 2008 Mr. Mark Gendron Vice President...

  13. Clean Cities: Valley of the Sun Clean Cities coalition (Phoenix...

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Photo of Bill Sheaffer Bill Sheaffer began serving as coordinator of the Valley of the Sun Clean Cities coalition in 2002 and now serves as the executive director of this...

  14. Shared address collectives using counter mechanisms

    DOE Patents [OSTI]

    Blocksome, Michael; Dozsa, Gabor; Gooding, Thomas M; Heidelberger, Philip; Kumar, Sameer; Mamidala, Amith R; Miller, Douglas

    2014-02-18

    A shared address space on a compute node stores data received from a network and data to transmit to the network. The shared address space includes an application buffer that can be directly operated upon by a plurality of processes, for instance, running on different cores on the compute node. A shared counter is used for one or more of signaling arrival of the data across the plurality of processes running on the compute node, signaling completion of an operation performed by one or more of the plurality of processes, obtaining reservation slots by one or more of the plurality of processes, or combinations thereof.

  15. Cheaper Adjoints by Reversing Address Computations

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hascoët, L.; Utke, J.; Naumann, U.

    2008-01-01

    The reverse mode of automatic differentiation is widely used in science and engineering. A severe bottleneck for the performance of the reverse mode, however, is the necessity to recover certain intermediate values of the program in reverse order. Among these values are computed addresses, which traditionally are recovered through forward recomputation and storage in memory. We propose an alternative approach for recovery that uses inverse computation based on dependency information. Address storage constitutes a significant portion of the overall storage requirements. An example illustrates substantial gains that the proposed approach yields, and we show use cases in practical applications.

  16. Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy ...

  17. Financing Innovation to Address Global Climate Change

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy’s Loan Programs Office (LPO) is helping address the global challenge of climate change by providing critical financing needed to deploy some of the world’s largest and most innovative clean energy and advanced technology vehicles manufacturing projects, preventing more than 25 million metric tons of CO2 emissions to date.

  18. Mapping virtual addresses to different physical addresses for value disambiguation for thread memory access requests

    DOE Patents [OSTI]

    Gala, Alan; Ohmacht, Martin

    2014-09-02

    A multiprocessor system includes nodes. Each node includes a data path that includes a core, a TLB, and a first level cache implementing disambiguation. The system also includes at least one second level cache and a main memory. For thread memory access requests, the core uses an address associated with an instruction format of the core. The first level cache uses an address format related to the size of the main memory plus an offset corresponding to hardware thread meta data. The second level cache uses a physical main memory address plus software thread meta data to store the memory access request. The second level cache accesses the main memory using the physical address with neither the offset nor the thread meta data after resolving speculation. In short, this system includes mapping of a virtual address to a different physical addresses for value disambiguation for different threads.

  19. Washington City Power- Net Metering

    Broader source: Energy.gov [DOE]

    Washington City adopted a net-metering program, including interconnection procedures, in January 2008, and updated the policy in December 2014.* Net metering is available to any customer of...

  20. City of Sebastopol- Solar Access

    Broader source: Energy.gov [DOE]

    As a condition of approval of a property subdivision parcel map, the City of Sebastopol has the right to ask for dedication of solar easements for the purpose of assuring that each parcel or unit...

  1. LBNL SEED for Cities Overview

    Broader source: Energy.gov [DOE]

    One page overview produced by Lawrence Berkeley National Lab detailing the use of the Standard Energy Efficiency Data (SEED) Platform for cities interested in using it for data collection and management.

  2. NREL: Energy Systems Integration - SolarCity and the Hawaiian Electric

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Companies SolarCity and the Hawaiian Electric Companies NREL is collaborating with solar energy company SolarCity at the ESIF to address the safety, reliability, and stability challenges of interconnecting high penetrations of distributed photovoltaics (PV) with the electric power system. The work includes collaboration with the Hawaiian Electric Companies to analyze high-penetration solar scenarios using advanced modeling and inverter testing at the ESIF. Download the project fact sheet and

  3. NREL Teams with SolarCity to Maximize Solar Power on Electrical Grids -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL Teams with SolarCity to Maximize Solar Power on Electrical Grids Both are working together with the Hawaiian Electric Companies to analyze and enable higher penetrations of distributed solar energy systems in Hawaii November 20, 2014 The Energy Department's National Renewable Energy Laboratory (NREL) and SolarCity have entered into a cooperative research agreement to address the operational issues associated with large amounts of distributed solar energy on electrical

  4. NREL: MIDC/Elizabeth City State University (36.28 N, 76.22 W, 26 m, GMT-5)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth City State University

  5. What is Clean Cities? May 2011 (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2011-05-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 87 coalitions.

  6. Clean Cities Now, Vol. 10, No. 4

    SciTech Connect (OSTI)

    Not Available

    2006-10-01

    Official Publication of Clean Cities and the Alternative Fuels Data Center (Newsletter) volume 10, number 4

  7. Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session. The meeting will be livestreamed at energy.gov/live

  8. Multithreaded Global Address Space Communication Techniques

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Multithreaded Global Address Space Communication Techniques for Gyrokinetic Fusion Applications on Ultra-Scale Platforms Robert Preissl Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 rpreissl@lbl.gov Nathan Wichmann CRAY Inc. St. Paul, MN, USA, 55101 wichmann@cray.com Bill Long CRAY Inc. St. Paul, MN, USA, 55101 longb@cray.com John Shalf Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 jshalf@lbl.gov Stephane Ethier Princeton Plasma Physics Laboratory Princeton, NJ,

  9. Global-Address Space Networking (GASNet) Library

    Energy Science and Technology Software Center (OSTI)

    2011-04-06

    GASNet (Global-Address Space Networking) is a language-independent, low-level networking layer that provides network-independent, high-performance communication primitives tailored for implementing parallel global address space SPMD languages such as UPC and Titanium. The interface is primarily intended as a compilation target and for use by runtime library writers (as opposed to end users), and the primary goals are high performance, interface portability, and expressiveness. GASNet is designed specifically to support high-performance, portable implementations of global address spacemore » languages on modern high-end communication networks. The interface provides the flexibility and extensibility required to express a wide variety of communication patterns without sacrificing performance by imposing large computational overheads in the interface. The design of the GASNet interface is partitioned into two layers to maximize porting ease without sacrificing performance: the lower level is a narrow but very general interface called the GASNet core API - the design is basedheavily on Active Messages, and is implemented directly on top of each individual network architecture. The upper level is a wider and more expressive interface called GASNet extended API, which provides high-level operations such as remote memory access and various collective operations. This release implements GASNet over MPI, the Quadrics "elan" API, the Myrinet "GM" API and the "LAPI" interface to the IBM SP switch. A template is provided for adding support for additional network interfaces.« less

  10. City of Auburn Hills (Text Version) | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Clean Energy Coalition is working under a grant from the United States Department of Energy in collaboration with Clean Cities of Greater Lansing, NextEnergy, and over forty other project partners (Aker Wade, Ann Arbor DDA, City of Ann Arbor, City of Auburn Hills, Chrysler, City of Dearborn, City of Detroit, City of Flint, City of Grand Rapids, City of Houghton, City of Lansing, City of Warren, Clipper Creek, Consumers Energy, Coulomb Technologies, DTE, Eaton, Ecology Center, Ford Motor Company,

  11. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    April 2009 Clean Cities Alternative Fuel Price Report CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT APRIL 2009 Page 2 WELCOME! Welcome to the April 2009 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between April 1, 2009 and April 15, 2009 from Clean Cities Coordinators, fuel providers, and other Clean Cities

  12. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    January 2009 Clean Cities Alternative Fuel Price Report CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT JANUARY 2009 Page 2 WELCOME! Welcome to the January 2009 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between January 12, 2009 and January 30, 2009 from Clean Cities Coordinators, fuel providers, and other Clean Cities

  13. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Clean Cities Alternative Fuel Price Report July 2009 CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT JULY 2009 WELCOME! Welcome to the July 2009 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between July 20, 2009 and July 31, 2009 from Clean Cities Coordinators, fuel providers, and other Clean Cities stakeholders.

  14. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    July 2008 Clean Cities Alternative Fuel Price Report CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT JULY 2008 Page 2 WELCOME! Welcome to the July 2008 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between July 21, 2008 and July 31, 2008 from Clean Cities Coordinators, fuel providers, and other Clean Cities stakeholders.

  15. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    October 2008 Clean Cities Alternative Fuel Price Report CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT OCTOBER 2008 Page 2 WELCOME! Welcome to the October 2008 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between October 2, 2008 and October 16, 2008 from Clean Cities Coordinators, fuel providers, and other Clean Cities

  16. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    9 Clean Cities Alternative Fuel Price Report CLEAN CITIES ALTERNATIVE FUEL PRICE REPORT OCTOBER 2009 Page 2 WELCOME! Welcome to the October 2009 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between October 16, 2009 and October 26, 2009 from Clean Cities Coordinators, fuel providers, and other Clean Cities

  17. Brigham City Hydro Generation Project

    SciTech Connect (OSTI)

    Ammons, Tom B.

    2015-10-31

    Brigham City owns and operates its own municipal power system which currently includes several hydroelectric facilities. This project was to update the efficiency and capacity of current hydro production due to increased water flow demands that could pass through existing generation facilities. During 2006-2012, this project completed efficiency evaluation as it related to its main objective by completing a feasibility study, undergoing necessary City Council approvals and required federal environmental reviews. As a result of Phase 1 of the project, a feasibility study was conducted to determine feasibility of hydro and solar portions of the original proposal. The results indicated that the existing Hydro plant which was constructed in the 1960’s was running at approximately 77% efficiency or less. Brigham City proposes that the efficiency calculations be refined to determine the economic feasibility of improving or replacing the existing equipment with new high efficiency equipment design specifically for the site. Brigham City completed the Feasibility Assessment of this project, and determined that the Upper Hydro that supplies the main culinary water to the city was feasible to continue with. Brigham City Council provided their approval of feasibility assessment’s results. The Upper Hydro Project include removal of the existing powerhouse equipment and controls and demolition of a section of concrete encased penstock, replacement of penstock just upstream of the turbine inlet, turbine bypass, turbine shut-off and bypass valves, turbine and generator package, control equipment, assembly, start-up, commissioning, Supervisory Control And Data Acquisition (SCADA), and the replacement of a section of conductors to the step-up transformer. Brigham City increased the existing 575 KW turbine and generator with an 825 KW turbine and generator. Following the results of the feasibility assessment Brigham City pursued required environmental reviews with the DOE and the U.S. Fish and Wildlife Services (USFWS) concurring with the National Environmental Policy Act of 1969 (NEPA) It was determined that Brigham City’s Upper Hydroelectric Power Plant upgrade would have no effect to federally listed or candidate species. However Brigham City has contributed a onetime lump sum towards Bonneville cutthroat trout conservation in the Northern Bonneville Geographic Management Unit with the intention to offset any impacts from the Upper Hydro Project needed to move forward with design and construction and is sufficient for NEPA compliance. No work was done in the river or river bank. During construction, the penstock was disconnected and water was diverted through and existing system around the powerhouse and back into the water system. The penstock, which is currently a 30-inch steel pipe, would be removed and replaced with a new section of 30-inch pipe. Brigham City worked with the DOE and was awarded a new modification and the permission to proceed with Phase III of our Hydro Project in Dec. 2013; with the exception to the modification of the award for the construction phase. Brigham City developed and issued a Request for Proposal for Engineer and Design vendor. Sunrise Engineering was selected for the Design and throughout the Construction Phase of the Upper Hydroelectric Power Plant. Brigham City conducted a Kickoff Meeting with Sunrise June 28, 2013 and received a Scope of Work Brigham City along with engineering firm sent out a RFP for Turbine, Generator and Equipment for Upper Hydro. We select Turbine/Generator Equipment from Canyon Industries located in Deming, WA. DOE awarded Brigham City a new modification and the permission to proceed with Phase III Construction of our Hydro Project. Brigham City Crews removed existing turbine/generator and old equipment alone with feeder wires coming into the building basically giving Caribou Construction an empty shell to begin demolition. Brigham City contracted with Caribou Construction from Jerome, Idaho for the Upper Power Plant construction. A kickoff meeting was June 24, 2014 and demolition was immediately started on building. Because of a delivery delay of Turbine, Generator and Equipment from Canyon Brigham City had to request another extension for the final date of completion. DOE awarded modification (.007) to Brigham City with a new completion date of August 1, 2015. The Turbine has had a few adjustments to help with efficiency; but the Generator had a slight vibration when generator got hot so Canyon Industries had U S Motor’s that manufactured the generator come to check out the issue. The other Equipment seems to be running normal. Brigham City, Sunrise Engineering and Canyon Industries met to determine what the vibration in the generator was and how to solve the issue Us Motor’s found some welds that failed: they have been repaired. U S Motor’s delivered the repaired generator Feb. 17, 2015. Canyon Industries arranged for a crane to installed generator in Power Plant. U S Motor’s balanced and wired generator. Plant Operators put the generator back on line. Canyon Industries returned and gave their approval to keep Hydro online. After Hydro was put back into operations it kept going off line because of overheating issues. Canyon Industries returned and replaced sensors and adjusted them to the proper settings for normal operations. Brigham City added additional steel screens to windows to increase air flow in Power Plant Building. After construction phase of the Upper Hydro Plant some landscaping has been restored around the building additional gravel brought in and leveled out and the road that was cut through for conduits to run wires. A retaining wall was installed to protect penstock. The Upper Hydro Plant is complete and in full operations. The final reimbursement was submitted.

  18. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  19. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  20. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    com Genifuel Genifuel Carrigan Cir Salt Lake City Utah Biofuels Renewable Natural Gas http www genifuel com Rockies Area Gevo Inc Gevo Inc Inverness Drive South Englewood...

  1. Framework for Address Cooperative Extended Transactions

    Energy Science and Technology Software Center (OSTI)

    1997-12-01

    The Framework for Addressing Cooperative Extended Transactions (FACET) is an object-oriented software framework for building models of complex, cooperative behaviors of agents. it can be used to implement simulation models of societal processes such as the complex interplay of participating individuals and organizations engaged in multiple concurrent transactions in pursuit of their various goals. These transactions can be patterned on, for example, clinical guidelines and procedures, business practices, government and corporate policies, etc. FACET canmore » also address other complex behaviors such as biological life cycles or manufacturing processes. FACET includes generic software objects representing the fundamental classes of agent -- Person and Organization - with mechanisms for resource management, including resolution of conflicting requests for participation and/or use of the agent's resources. The FACET infrastructure supports stochastic behavioral elements and coping mechanisms by which specified special conditions and events can cause an active cooperative process to be preempted, diverting the participants onto appropriate alternative behavioral pathways.« less

  2. Jersey City, New Jersey, Site Fact Sheet

    Office of Legacy Management (LM)

    Jersey City, New Jersey, Site. This site is managed by the U.S. Department of Energy Office of Legacy Management under the Formerly Utilized Sites Remedial Action Program. Jersey City, New Jersey, Site Elizabeth Jersey City Newark New York City NEW JERSEY NEW YORK 1 22 46 1 278 280 95 80 78 495 95 Atlantic Ocean Jersey City Site M:\LTS\111\0001\10\S03060\S0306000.mxd smithw 09/15/2011 10:38:58 AM 0 5 10 Miles Trenton NEW JERSEY Location of the Jersey City, New Jersey, Site Site Description and

  3. City of Fort Collins Comment on Information Collection Extension...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    City of Fort Collins Comment on Information Collection Extension, October 2011 City of Fort Collins Comment on Information Collection Extension, October 2011 The City of Fort ...

  4. Jiangxi Province Ruijin City Liujinba Hydro Development Co Ltd...

    Open Energy Info (EERE)

    Ruijin City Liujinba Hydro Development Co Ltd Jump to: navigation, search Name: Jiangxi Province Ruijin City Liujinba Hydro Development Co,. Ltd. Place: Ruijin city, Jiangxi...

  5. Minnkota Power Cooperative Wind Turbine (Valley City) | Open...

    Open Energy Info (EERE)

    Valley City) Jump to: navigation, search Name Minnkota Power Cooperative Wind Turbine (Valley City) Facility Minnkota Power Cooperative Wind Turbine (Valley City) Sector Wind...

  6. Traverse City Light & Power Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    City Light & Power Wind Farm Jump to: navigation, search Name Traverse City Light & Power Wind Farm Facility Traverse City Light & Power Sector Wind energy Facility Type Community...

  7. Kansas City Summary of Reported Data | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Summary of Reported Data Kansas City Summary of Reported Data Summary of data reported by Better Buildings Neighborhood Program partner Kansas City, Missouri. PDF icon Kansas City ...

  8. DOE - Office of Legacy Management -- Falls City Mill Site - TX...

    Office of Legacy Management (LM)

    Also see Falls City, Texas, Disposal Site Documents Related to Falls City Mill Site Data Validation Package for the April 2009 Groundwater Sampling at the Falls City, Texas, ...

  9. Windy City Renewable Energy LLC | Open Energy Information

    Open Energy Info (EERE)

    Windy City Renewable Energy LLC Jump to: navigation, search Logo: Windy City Renewable Energy LLC Name: Windy City Renewable Energy LLC Place: Chicago, Illinois Zip: 60606 Sector:...

  10. City of Holyoke, Massachusetts (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    City of Holyoke, Massachusetts (Utility Company) Jump to: navigation, search Logo: Holyoke City of Name: Holyoke City of Abbreviation: HGED Place: Massachusetts Phone Number: (413)...

  11. Routine environment audit of the Kansas City Plant, Kansas City, Missouri

    SciTech Connect (OSTI)

    1994-11-01

    This report documents the results of the routine environmental audit of the Kansas City Plant, Kansas City, Missouri. During this audit the activities the audit team conducted included reviews of internal documents and reports from previous audits and assessments; interviews with U.S. Department of Energy (DOE) and contractor personnel; and inspections and observations of selected facilities and operations. The onsite portion of the audit was conducted October 24-November 4, 1994, by the DOE Office of Environmental Audit (EH-24), located within the Office of Environment, Safety, and Health (EH). DOE 5482.1 B, {open_quotes}Environment, Safety, and Health Appraisal Program,{close_quotes} establishes the mission of EH-24, which is to provide comprehensive, independent oversight of Department-wide environmental programs on behalf of the Secretary of Energy. The ultimate goal of EH-24 is enhancement of environmental protection and minimization of risk to public health and the environment. EH-24 accomplishes its mission by conducting systematic and periodic evaluations of the Department`s environmental programs within line organizations and by using supplemental activities that strengthen self-assessment and oversight functions within program, field, and contractor organizations. The audit evaluated the status of programs to ensure compliance with Federal, state, and local environmental laws and regulations; compliance with DOE Orders, guidance, and directives; and conformance with accepted industry practices and standards of performance. The audit also evaluated the status and adequacy of the management systems developed to address environmental requirements.

  12. AeroCity LLC | Open Energy Information

    Open Energy Info (EERE)

    Name: AeroCity LLC Place: Lake Katrine, New York Sector: Wind energy Product: Micro urban wind turbine maker based in New York State. References: AeroCity LLC1 This article...

  13. Clean Cities Now Vol. 16.1

    SciTech Connect (OSTI)

    2012-05-01

    Biannual newsletter for the U.S. Department of Energy's Clean Cities initiative. The newsletter includes feature stories on advanced vehicle deployment, idle reduction, and articles on Clean Cities coalition successes across the country.

  14. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-12-01

    Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

  15. City of Philadelphia- Green Power Purchasing

    Broader source: Energy.gov [DOE]

    *In contrast to renewable energy purchasing goals of many local governments, Philadelphia's initiative targets total electricity use within the city as opposed to only purchases made by the city ...

  16. City of Gainesville- Public Facilities Siting

    Broader source: Energy.gov [DOE]

    The City of Gainesville requires the design process for public facilities within city limits to take into consideration current and future solar access. In addition, regulated trees may be removed...

  17. La Porte City Utilities | Open Energy Information

    Open Energy Info (EERE)

    Porte City Utilities Jump to: navigation, search Name: La Porte City Utilities Place: Iowa Phone Number: (319)342-3139 or (319) 342-3160 Website: lpcia.comservices Facebook:...

  18. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-03-01

    This fact sheet provides contact information for program staff of the U.S. Department of Energy's Clean Cities program, as well as contact information for the nearly 100 local Clean Cities coalitions across the country.

  19. City of Ann Arbor- PACE Financing

    Broader source: Energy.gov [DOE]

    The City of Ann Arbor offers Property Assessed Clean Energy (PACE) financing for commercial properties located within the city. Projects will undergo a voluntary special assessment and may range ...

  20. Clean Cities Now Vol. 17, No. 1

    SciTech Connect (OSTI)

    2013-05-24

    Biannual newsletter for the U.S. Department of Energy's Clean Cities initiative. The newsletter includes feature stories on advanced vehicle deployment, idle reduction, and articles on Clean Cities coalition successes across the country.

  1. Salt Lake City- High Performance Buildings Requirement

    Broader source: Energy.gov [DOE]

    Salt Lake City's mayor issued an executive order in July 2005 requiring that all public buildings owned and controlled by the city be built or renovated to meet the requirements of LEED "silver"...

  2. City Solar AG | Open Energy Information

    Open Energy Info (EERE)

    services for large-scale PV power plants, also has a division called City Solar Invest to develop its own plants. References: City Solar AG1 This article is a stub. You...

  3. City of Santa Monica- Green Power Purchasing

    Broader source: Energy.gov [DOE]

    The City of Santa Monica made history June 1, 1999, as green electricity began powering all municipal facilities -- including the Santa Monica Airport, City Hall and the Santa Monica Pier -- making...

  4. SolarCity Corp | Open Energy Information

    Open Energy Info (EERE)

    Place: Foster City, California Zip: 94404 Sector: Solar Product: US-based designer and installer of solar systems for domestic and commercial use. References: SolarCity Corp1...

  5. City of Jacksonville- Sustainable Public Buildings

    Broader source: Energy.gov [DOE]

    In 2009, the Jacksonville City Office of Sustainability Initiatives announced the creation of the Sustainable Building Program. As part of the program, all new city-owned buildings must meet...

  6. City of Ann Arbor- Green Power Purchasing

    Broader source: Energy.gov [DOE]

    The city came short of its 2010 goal, achieving 19.8% renewables by 2010. In April 2011, the City Council passed a new goal to reach 30% renewables by 2015 (compared to 2000 levels) in municipal...

  7. Protocol for Addressing Induced Seismicity Associated with Enhanced...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems (EGS) Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems...

  8. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the...

  9. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of ...

  10. Addressing Uncertainties in Design Inputs: A Case Study of Probabilist...

    Office of Environmental Management (EM)

    Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF Addressing Uncertainties in Design Inputs: A Case...

  11. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy ...

  12. Opportunities for Building America Research to Address Energy...

    Energy Savers [EERE]

    Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address...

  13. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change...

  14. Energy Department Addresses Largest Gathering of Geothermal Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Largest Gathering of Geothermal Energy Stakeholders Energy Department Addresses Largest Gathering of Geothermal Energy Stakeholders October 4, 2012 - 1:00pm Addthis Photo ...

  15. DOE Convenes Multi-stakeholder Process to Address Privacy for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by Smart Grid Technologies DOE Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by ...

  16. Strategies to Address Split Incentives in Multifamily Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily Low-Income Peer Exchange Call: Strategies to Address Split ...

  17. Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen...

    Open Energy Info (EERE)

    Agenda for Addressing Climate Change in Bangladesh: Copenhagen and Beyond Jump to: navigation, search Name Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen and...

  18. Indonesia National Action Plan Addressing Climate Change | Open...

    Open Energy Info (EERE)

    National Action Plan Addressing Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Indonesia National Action Plan Addressing Climate Change AgencyCompany...

  19. New partnership uses advanced computer science modeling to address...

    National Nuclear Security Administration (NNSA)

    computer science modeling to address climate change | National Nuclear Security ... New partnership uses advanced computer science modeling to address climate change Several ...

  20. NBP RFI-Addressing Policy and Logistical Challenges to Smart...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid ...

  1. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: ...

  2. New York Independent System Operator, Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. New York Independent System Operator, Smart Grid RFI: Addressing Policy and ...

  3. Response to Request for Information titled "Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and ...

  4. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American ...

  5. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical ...

  6. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation ...

  7. Progress Energy draft regarding Smart Grid RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical ...

  8. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. ...

  9. Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges ...

  10. Assistant Secretary Patricia Hoffman to Deliver Keynote Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Patricia Hoffman to Deliver Keynote Address at IEEE PES Conference on Innovative Smart Grid Technologies Assistant Secretary Patricia Hoffman to Deliver Keynote Address at IEEE PES ...

  11. Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District Smart Grid RFI: Addressing Policy and ...

  12. DOE Action Plan Addressing the Electricity Transmission System

    Broader source: Energy.gov (indexed) [DOE]

    U.S. DEPARTMENT OF ENERGY ACTION PLAN ADDRESSING THE ELECTRICITY TRANSMISSION SYSTEM DRAFT DOE Action Plan Addressing the Electricity Transmission System 1 Table of Contents * ...

  13. U.S. Leads International Collaborative to Address Wind Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife Challenges U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife ...

  14. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials 2013 DOE ...

  15. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. ...

  16. Addressable morphology control of silica structures by manipulating...

    Office of Scientific and Technical Information (OSTI)

    Addressable morphology control of silica structures by manipulating the reagent addition time Citation Details In-Document Search Title: Addressable morphology control of silica ...

  17. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    1 Clean Cities Alternative Fuel Price Report April 2011 Page 2 WELCOME! Welcome to the April 2011 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between April 1, 2011 and April 15, 2011 from Clean Cities Coordinators, fuel providers, and other Clean Cities stakeholders. METHODOLOGY In order to collect price information

  18. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    0 Clean Cities Alternative Fuel Price Report January 2010 Page 2 WELCOME! Welcome to the January 2010 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between January 19, 2010 and January 29, 2010 from Clean Cities Coordinators, fuel providers, and other Clean Cities stakeholders. METHODOLOGY In order to collect price

  19. Clean Cities Alternative Fuel Price Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    1 Clean Cities Alternative Fuel Price Report October 2011 Page 2 WELCOME! Welcome to the October 2011 issue of the Clean Cities Alternative Fuel Price Report, a quarterly report designed to keep you up to date on the prices of alternative fuels and conventional fuels in the U.S. This issue summarizes prices that were collected between September 30, 2011 and October 14, 2011 from Clean Cities Coordinators, fuel providers, and other Clean Cities stakeholders. METHODOLOGY In order to collect price

  20. SSL Demonstration: Central Park, New York City

    SciTech Connect (OSTI)

    2012-11-01

    GATEWAY program report brief summarizing an SSL pathway lighting demonstration in Central Park in New York City.

  1. (Consultecnia, Guatemala City (Guatemala)); Altseimer, J.; Thayer...

    Office of Scientific and Technical Information (OSTI)

    Desarrollo Geotermico, Guatemala City (Guatemala). Inst. Nacional de Electrificacion) 15 GEOTHERMAL ENERGY; 60 APPLIED LIFE SCIENCES; DEHYDRATORS; DESIGN; OPERATION; PERFORMANCE;...

  2. PRELIMINARY SURVEY OF TEXAS CITY CHEMICALS, INC.

    Office of Legacy Management (LM)

    TEXAS CITY CHEMICALS, INC. (BORDEN ct1Er4IcAL DIVISION 0~ BORDEN, INC.) TEXAS CITY, TEXAS Work performed by the Health and Safety Research Division Oak Ridge National Laboratory Oak Ridge, Tennessee 37830 March 1980 OAK RIDGE NATIONAL LABORATORY operated by UNION CARBIDE CORPORATION for the DEPARTMENT OF ENERGY as part of the Formerly Utilized Sites-- Remedial Action Program TEXAS CITY CHEMICALS, INC. (BORDEN CHEMICAL DIVISION 0~ BORDEN, INC. > TEXAS CITY, TEXAS At the request of the

  3. kansas city plant | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    kansas city plant KCNSC leader recognized as community role model Allen Brown, senior production scheduler at the Kansas City National Security Campus (KCNSC) in Kansas City, Mo., was recently selected as a 2016 Black Achiever Award recipient. Brown was nominated by the operator of the NSC and his employer, Honeywell Federal Manufacturing & Technologies, for... Cold weather encourages warm hearts in Kansas City Most of us just reach into the closet to pull on a warm coat to shield us from

  4. Falls City, Texas, Disposal Site Fact Sheet

    Office of Legacy Management (LM)

    Falls City, Texas, Disposal Site This fact sheet provides information about the Uranium Mill Tailings Radiation Control Act of 1978 Title I disposal site located at Falls City, Texas. The site is managed by the U.S. Department of Energy Office of Legacy Management. Location of the Falls City Disposal Site Site Description and History The Falls City disposal site is the location of a former uranium-ore processing facility in Karnes County, Texas, approximately 40 miles southeast of San Antonio

  5. Clean Cities Reaches Across the Sea

    Broader source: Energy.gov [DOE]

    Clean Cities International collaborates with leaders from Kazakhstan and Sweden share best practices and accomplish mutual goals.

  6. What is Clean Cities? July 2010 (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2010-07-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 87 active coalitions.

  7. What is Clean Cities? December 2010 (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2010-12-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 87 active coalitions.

  8. SSL Demonstration: Street Lighting, Kansas City, MO

    SciTech Connect (OSTI)

    2013-08-01

    GATEWAY program report brief summarizing an SSL street lighting demonstration at nine separate installations in Kansas City, MO.

  9. National Engineers Week: Future City Competition

    ScienceCinema (OSTI)

    None

    2012-06-14

    2011 Future Cities Competition inspires students all across South Carolina to pursue careers in environmental protection and engineering.

  10. Clean Cities Now, Vol. 18, No. 2

    SciTech Connect (OSTI)

    2015-01-19

    This is version 18.2 of Clean Cities Now, the official biannual newsletter of the Clean Cities program. Clean Cities is an initiative designed to reduce petroleum consumption in the transportation sector by advancing the use of alternative and renewable fuels, fuel economy improvements, idle-reduction measures, and new technologies, as they emerge.

  11. Kansas City Data Dashboard | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Dashboard Kansas City Data Dashboard The data dashboard for Kansas City, a partner in the Better Buildings Neighborhood Program. File Kansas City Data Dashboard More Documents & Publications Camden, New Jersey Data Dashboard Washington -- SEP Data Dashboard Nevada -- SEP Data Dashboard

  12. Clean Cities Designation Guide: A Resource for Developing, Implementing, and Sustaining Your Clean Cities Coalition

    SciTech Connect (OSTI)

    Not Available

    2008-04-01

    Document serves as an instruction manual for developing, implementing, and running a Clean Cities coalition.

  13. Energy Systems Integration: NREL + SolarCity and the Hawaiian Electric Companies (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2015-02-01

    This fact sheet describes the collaboration between NREL, SolarCity, and the Hawaiian Electric Companies at the Energy Systems Integration Facility (ESIF) to address the safety, reliability, and stability challenges of interconnecting high penetrations of distributed photovoltaics with the electric power system.

  14. EA-358 Twin Cities Energy, LLC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order authorizing Twin Cities Energy, LLC to export electric energy to Canada PDF icon ... EA-358 Twin Cities Energy, LLC EA-344 Twin Cities Power-Canada, LLC EA-344-A Twin Cities ...

  15. Final Report on Internet Addressable Lightswitch

    SciTech Connect (OSTI)

    Rubinstein, Francis; Pettler, Peter

    2001-08-27

    This report describes the work performed to develop and test a new switching system and communications network that is useful for economically switching lighting circuits in existing commercial buildings. The first section of the report provides the general background of the IBECS (Integrated Building Environmental Communications System) research and development work as well as the context for the development of the new switching system. The research and development effort that went into producing the first proof-of-concept (the IBECS Addressable Power Switch or APS) and the physical prototype of that concept is detailed in the second section. In the third section of the report, we detail the refined Powerline Carrier Based IBECS Title 24 Wall Switch system that evolved from the APS prototype. The refined system provided a path for installing IBECS switching technology in existing buildings that may not be already wired for light level switching control. The final section of the report describes the performance of the IBECS Title 24 Switch system as applied to a small demonstration in two offices at LBNL's Building 90. We learned that the new Powerline Carrier control systems (A-10 technology) that have evolved from the early X-10 systems have solved most of the noise problems that dogged the successful application of X-10 technologies in commercial buildings. We found that the new A-10 powerline carrier control technology can be reliable and effective for switching lighting circuits even in electrically noisy office environments like LBNL. Thus we successfully completed the task objectives by designing, building and demonstrating a new switching system that can provide multiple levels of light which can be triggered either from specially designed wall switches or from a digital communications network. By applying commercially available powerline carrier based technologies that communicate over the in-place lighting wiring system, this type of control can be economi cally installed even in existing buildings that were not wired for dual-level lighting.

  16. Keynote Address: Ali Zaidi, the White House Domestic Policy Council

    Broader source: Energy.gov [DOE]

    Keynote address by Ali Zaidi, Deputy Director for Energy Policy, the White House Domestic Policy Council.

  17. Utah Clean Cities Transportation Sector Petroleum Reduction Technologi...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Utah Clean Cities Transportation Sector Petroleum Reduction Technologies Program Utah Clean Cities Transportation Sector Petroleum Reduction ...

  18. City Code Non-Transferable

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    City Code Non-Transferable If the sales tax permit at this location becomes invalid then all associated permits will become invalid. If the business changes location or ownership or is discontinued for any reason, this permit must be returned to the Oklahoma Tax Commission for cancellation WITH AN EXPLANATION ON THE REVERSE SIDE. PLEASE POST IN CONSPICUOUS PLACE GENERAL ELECTRIC COMPANY 4211 METRO PKWY FORT MYERS FL 33916-9406 443111 8010 March 6, 2014 2102181888 Effective Expires Business

  19. Future City The Right Stuff

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    City The Right Stuff NvE steps up for future technology. Marty Glasser takes over the security force. NSTec's Intellectual Property getting kudos. See page 6. See pages 4. New NNSS Weather Website Puts Site Conditions Center Stage On Jan. 7, the Nevada National Security Site (NNSS) weather organization, ARL/SORD, launched its new website, www.sord.nv.doe.gov. ARL/SORD is a Department of Commerce organization under the National Oceanic and Atmospheric Administration, Office of Oceanic and

  20. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  1. Technology Plan to Address the EM Mercury Challenge

    Broader source: Energy.gov [DOE]

    EM’s Technology Plan to Address the EM Mercury Challenge addresses mercury contamination, and advocates for research and technology development to resolve key technical uncertainties with the pollutant in environmental remediation, facility deactivation and decommissioning, and tank waste processing.

  2. Moving Forward to Address Nuclear Waste Storage and Disposal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Moving Forward to Address Nuclear Waste Storage and Disposal Moving Forward to Address Nuclear Waste Storage and Disposal March 24, 2015 - 2:15pm Addthis Three trucks transport ...

  3. Keynote Address: Billy Parish of Mosaic | Department of Energy

    Office of Environmental Management (EM)

    Billy Parish of Mosaic Keynote Address: Billy Parish of Mosaic May 20, 2014 3:00PM to 3:30PM PDT Pacific Ballroom Billy Parish, President and Founder of Mosaic, will address Summit attendees

  4. National Nuclear Security Administration Kansas City Field Office

    National Nuclear Security Administration (NNSA)

    Department of Energy National Nuclear Security Administration Kansas City Field Office 14520 Botts Road Kansas City, Missouri 64147 Kansas City Plant Related Web Pages Kansas City Plant Home Page - Provides background information and related news on the Kansas City Plant. Links to local site web page which contains information on plant history, technologies, and other related topics. http://www.nnsa.energy.gov/aboutus/ourlocations/kansas-city-plant Kansas City Plant Contracts - Contains the

  5. Method for the electro-addressable functionalization of electrode arrays

    Office of Scientific and Technical Information (OSTI)

    (Patent) | SciTech Connect Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of electrode arrays A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable

  6. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges. Pepco Holdings, Inc. (PHI) is pleased to respond to the US Department of Energy (DOE) request for information regarding addressing policy and logistical challenges to smart grid implementation. This follows on the heels of

  7. Progress Energy draft regarding Smart Grid RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges | Department of Energy Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges PDF icon Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges More Documents & Publications Comments of DRSG to DOE Smart Grid RFI:

  8. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges. Southern recognizes that many policy and logistical concerns must be addressed for the promises of smart grid technologies and applications to be fully realized in ways that are beneficial, secure, and cost-effective

  9. Keynote Address: Update on Environmental Management | Department of Energy

    Energy Savers [EERE]

    Address: Update on Environmental Management Keynote Address: Update on Environmental Management Keynote presentation made by David G. Huizenga for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY. PDF icon Keynote Address: Update on Environmental Management More Documents & Publications Chairs Meeting - November 2013 Chairs Meeting - April 2014 Chairs Meeting - April 2013

  10. Individually addressable cathodes with integrated focusing stack or detectors

    DOE Patents [OSTI]

    Thomas, Clarence E.; Baylor, Larry R.; Voelkl, Edgar; Simpson, Michael L.; Paulus, Michael J.; Lowndes, Douglas; Whealton, John; Whitson, John C.; Wilgen, John B.

    2005-07-12

    Systems and method are described for addressable field emission array (AFEA) chips. A plurality of individually addressable cathodes are integrated with an electrostatic focusing stack and/or a plurality of detectors on the addressable field emission array. The systems and methods provide advantages including the avoidance of space-charge blow-up.

  11. Addressing Barriers to Upgrade Projects at Affordable Multifamily

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Properties (201) | Department of Energy Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Better Buildings Residential Network Peer Exchange Call Series: Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201), call slides and discussion summary. PDF icon Call Slides and Discussion Summary More Documents & Publications Incorporating Energy

  12. Addressing Climate Change with Next Generation Energy Storage Technology -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joint Center for Energy Storage Research March 19, 2015, Videos Addressing Climate Change with Next Generation Energy Storage Technology George Crabtree gives keynote at Loyola University In March 2015, George Crabtree gave the keynote address, "Addressing Climate Change with Next Generation Energy Storage Technology" at the Institute of Environmental Sustainability Climate Change Conference at Loyola University

  13. Koyukuk City/Tribal Office Rehabilitation Project

    SciTech Connect (OSTI)

    Folger, Kathryn Kristi; Lolnitz, Darlene

    2015-09-30

    The goal of this project is to reduce energy costs at the City office Building in Koyukuk by at least 50% through Energy Efficiency and Weatherization measures.

  14. Clean Cities Recovery Act: Vehicle & Infrastructure Deployment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Recovery Act: Vehicle & Infrastructure Deployment Clean Cities Recovery Act: Vehicle & Infrastructure Deployment 2010 DOE Vehicle Technologies and Hydrogen Programs Annual Merit...

  15. Alice Solar City Consortium | Open Energy Information

    Open Energy Info (EERE)

    search Name: Alice Solar City Consortium Place: Alice Springs, Northern Territory, Australia Zip: NT 0871 Sector: Solar Product: A consortium repsonsible for developing the...

  16. Boise Buses Running Strong with Clean Cities

    Broader source: Energy.gov [DOE]

    A local Clean Cities coalition helped Idaho's Valley Regional Transit switch to compressed natural gas buses, allowing the transit authority to maintain its service while reducing harmful emissions.

  17. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-10-01

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  18. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-01-01

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  19. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-09-01

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  20. Property:GBIG/City | Open Energy Information

    Open Energy Info (EERE)

    City Jump to: navigation, search This is a property of type String. Retrieved from "http:en.openei.orgwindex.php?titleProperty:GBIGCity&oldid509335...

  1. City of Aspen- Energy Assessment Rebate Program

    Broader source: Energy.gov [DOE]

    The City of Aspen encourages interested residents and businesses to increase the energy efficiency of homes and offices through the Energy Assessment Program. Participating homes and offices must...

  2. Oklahoma City- Green Home Loan Program

    Broader source: Energy.gov [DOE]

    The loan program is administered through the city's Community Action Agency. Apply by calling the Agency at (405) 232-0199.

  3. PermaCity Corp | Open Energy Information

    Open Energy Info (EERE)

    search Name: PermaCity Corp Place: Commerce, California Zip: 90040 Sector: Buildings Product: US-based provider of turnkey PV and passive system installation for...

  4. Clean Cities Now, Vol. 10, No. 3

    SciTech Connect (OSTI)

    Not Available

    2006-07-01

    Newsletter features articles on Clean Cities, such as coalition news, stakeholder success stories, and Technical Assistance projects. Industry news, EPAct updates, and new resources are also covered.

  5. City of Scottsdale- Green Building Incentives

    Broader source: Energy.gov [DOE]

    Incentives include expedited plan review, green building inspections, lectures, workshops, a homeowner’s manual, recognition on the city web site, and free promotional green building materials,...

  6. Reaching 100% Renewable Energy, City of Aspen

    SciTech Connect (OSTI)

    2015-08-01

    This brochure describes the analysis and process used by NREL to assist the City of Aspen in attaining its 100% renewable energy goal.

  7. Clean Cities Regional Support & Petroleum Displacement Awards...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regional Support & Petroleum Displacement Awards Clean Cities Regional Support & Petroleum Displacement Awards 2009 DOE Hydrogen Program and Vehicle Technologies Program Annual ...

  8. City of Tallahassee Utilities- Grant Programs

    Broader source: Energy.gov [DOE]

    The City of Tallahassee Utilities offers multiple grant programs for e residents to improve the energy efficiency of homes and businesses. 

  9. City of Ellensburg Renewable Energy Park

    Broader source: Energy.gov [DOE]

    This presentation was given at the March 19, 2013, CommRE webinar on Renewable Energy Parks by Robert Titus, City of Ellensburg, Washington special projects manager.

  10. Prairie City Biomass Facility | Open Energy Information

    Open Energy Info (EERE)

    Biomass National Map Retrieved from "http:en.openei.orgwindex.php?titlePrairieCityBiomassFacility&oldid397964" Feedback Contact needs updating Image needs updating...

  11. Granite City, Illinois, Site Fact Sheet

    Office of Legacy Management (LM)

    Granite City, Illinois, Site. This site is managed by the U.S. Department of Energy Office of Legacy Management under the Formerly Utilized Sites Remedial Action Program. Granite City, Illinois, Site ILLINOIS MISSOURI Alton Belleville East St. Louis Granite City Florissant Oakville St. Louis 67 50 67 55 70 255 170 270 64 44 270 55 64 61 Granite City Site M:\LTS\111\0001\10\S03057\S0305700.mxd smithw 09/16/2011 7:56:57 AM 0 7.5 15 Miles Springfield ILLINOIS M i s s i s s i p p i R i v e r

  12. Forest City Enterprises | Open Energy Information

    Open Energy Info (EERE)

    Enterprises Jump to: navigation, search Name: Forest City Enterprises Place: Denver, CO Zip: 80238 Website: www.forestcity.net Coordinates: 39.7564482, -104.8863279 Show Map...

  13. Building Green in Greensburg: City Hall Building

    Broader source: Energy.gov [DOE]

    This poster highlights energy efficiency, renewable energy, and sustainable features of the high-performing City Hall building in Greensburg, Kansas.

  14. City of St. George- Net Metering

    Broader source: Energy.gov [DOE]

    The City of St. George Energy Services Department (SGESD) offers a net metering program to its customers, and updated program guidelines and fees in September 2015.* 

  15. Kansas City Completes Innovative Business Incubator | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The partners helped transform this once abandoned building on a brownfield site in the city's urban core into a LEED Gold certified and ENERGY STAR qualified structure. The ...

  16. SolarCity | Open Energy Information

    Open Energy Info (EERE)

    Drive Place: Foster City, California Zip: 94404 Region: Bay Area Sector: Solar Product: Solar installer Website: www.solarcity.com Coordinates: 37.563247, -122.277403 Show...

  17. Clean Cities Now, Vol. 10, No. 2

    SciTech Connect (OSTI)

    Not Available

    2006-05-01

    Newsletter features articles on Clean Cities, such as coalition news, stakeholder success stories, and Technical Assistance projects. Industry news, EPAct updates, and new resources are also covered.

  18. Energy Saver Heroes: Clean Cities Coordinators

    Broader source: Energy.gov [DOE]

    Clean Cities, the deployment arm of EERE’s Vehicle Technology Program, works to support local decisions to reduce petroleum consumption in transportation.

  19. City of Charleston- CharlestonWISE Program

    Broader source: Energy.gov [DOE]

    CharlestonWISE is an energy efficiency program for homeowners within the City of Charleston. The program offers rebates on completed home performance improvements for qualified residential...

  20. Rebuilding It Better: Greensburg, Kansas, City Hall

    SciTech Connect (OSTI)

    D. Egan

    2010-04-13

    This document showcases the LEED-Platinum designed Greensburg City Hall, which was rebuilt green, after a massive tornado destroyed Greensburg, Kansas in May 2007.

  1. City of Denver- Green Building Requirement for City-Owned Buildings

    Broader source: Energy.gov [DOE]

    The updated Executive Order 123 states that “all buildings constructed, renovated, or maintained with City funds or using City bonding capacity are to be designed, constructed, operated, and main...

  2. Elizabeth City State University: Elizabeth City, North Carolina (Data)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Stoffel, T.; Andreas, A.

    The Historically Black Colleges and Universities (HBCU) Solar Radiation Monitoring Network operated from July 1985 through December 1996. Funded by DOE, the six-station network provided 5-minute averaged measurements of direct normal, global, and diffuse horizontal solar irradiance. The data were processed at NREL to improve the assessment of the solar radiation resources in the southeastern United States. Historical HBCU data available online include quality assessed 5-min data, monthly reports, and plots. In January 1997 the HBCU sites became part of the CONFRRM solar monitoring network and data from the two remaining active stations, Bluefield State College and Elizabeth City State University, are collected by the NREL Measurement & Instrumentation Data Center (MIDC).

  3. Elizabeth City State University: Elizabeth City, North Carolina (Data)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Stoffel, T.; Andreas, A.

    1985-09-25

    The Historically Black Colleges and Universities (HBCU) Solar Radiation Monitoring Network operated from July 1985 through December 1996. Funded by DOE, the six-station network provided 5-minute averaged measurements of direct normal, global, and diffuse horizontal solar irradiance. The data were processed at NREL to improve the assessment of the solar radiation resources in the southeastern United States. Historical HBCU data available online include quality assessed 5-min data, monthly reports, and plots. In January 1997 the HBCU sites became part of the CONFRRM solar monitoring network and data from the two remaining active stations, Bluefield State College and Elizabeth City State University, are collected by the NREL Measurement & Instrumentation Data Center (MIDC).

  4. City-Level Energy Decision Making. Data Use in Energy Planning, Implementation, and Evaluation in U.S. Cities

    SciTech Connect (OSTI)

    Aznar, Alexandra; Day, Megan; Doris, Elizabeth; Mathur, Shivani; Donohoo-Vallett, Paul

    2015-07-08

    The Cities-LEAP technical report, City-Level Energy Decision Making: Data Use in Energy Planning, Implementation, and Evaluation in U.S. Cities, explores how a sample of cities incorporates data into making energy-related decisions. This report provides the foundation for forthcoming components of the Cities-LEAP project that will help cities improve energy decision making by mapping specific city energy or climate policies and actions to measurable impacts and results.

  5. What Is Clean Cities? Clean Cities Fact Sheet April 2009 (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2009-04-01

    Fact sheet describes the Clean Cities program and includes the contact information for its 86 active coalitions.

  6. BPA-2014-01713-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kiley Scott Email Kiley.Scott@SNCLavalin.com Organizatio SNC Lavalin T&D n Mailing 150 Whitten Rd Address City Augusta State ME Phone 315-842-0999 Ex. xxx-xxx-xxxx FAX Ex....

  7. BPA-2015-01591-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    o n this form. Name Email Organization Mailing Address City State Phone FAX William Campbell I 'b' '6' J J Zip Reasonably Describe Records Describe the specific record(s) you...

  8. BPA-2015-01341-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Act must be signed and, therefore, cannot be submitted on this form. Name William Campbell Email Organization Mailing Ex 6 Address City State Date Recd 5202015 Due Date: 6...

  9. EXPO 2014 Exhibitor Booth Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Request - Attachment 2 EXPO 2014 Exhibitor Booth Request May 13-14, 2014 Exhibitor/Organization _______________________________________________________________ Address: __________________________________ E-mail:___________________________________ City & State _________________________________________________________________________ Point of Contact ________________________________ Phone Number: ( ) _______________ Topic of Exhibit

  10. BPA-20105-00094-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Act must be signed and, therefore, cannot be submitted on this form. Name Steven B. Goff Email Organization Mailing Ex 6 Address City Slate Zip Date Recd: 10202014 Due Date:...

  11. BPA-2016-00034-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Privacy Act must be signed and, therefore, cannot be submitted on this form. Name Marina Brassfield Email (b)(6) Organization Mailing Address City State Phone FAX Ex. XXX*...

  12. BPA-2013-00104-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Organization Gradient Mailing Address 20 University Road 5th Floor City Cambridge State MA Zip 02138 Phone 617-395-5570 Ex. xxx-xxx-xxxx FAX 617-395-5000 Ex....

  13. ziaI_payrolldeduction_D01_dirdep111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3. Sign this form; 4. Inter-office mail it to Craft Payroll at "P238." EMPLOYEE Z NUMBER EMPLOYEE NAME FULL ADDRESS CITY, STATE, ZIP ACTION TYPE ACCOUNT FREQUENCY DEDUCTION...

  14. Clean Cities Now, Vol. 18, No. 1

    SciTech Connect (OSTI)

    2014-04-30

    The Spring 2014 edition of the semi-annual newsletter for the U.S. Department of Energy's Clean Cities initiative. The newsletter includes feature stories on deployment of alternative fuels and advanced vehicles, and articles on Clean Cities coalition successes across the country.

  15. Category:Cities | Open Energy Information

    Open Energy Info (EERE)

    category contains cities, towns, villages, etc. Contents: Top - 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Pages in category "Cities" The following 200 pages are...

  16. Clean Cities Now Vol. 19, No. 2

    SciTech Connect (OSTI)

    2015-12-18

    Clean Cities Now is the official bi-annual newsletter of Clean Cities, an initiative designed to reduce petroleum consumption in the transportation sector by advancing the use of alternative and renewable fuels, fuel economy improvements, idle-reduction measures, and new technologies, as they emerge.

  17. Clean Cities 2011 Annual Metrics Report

    SciTech Connect (OSTI)

    Johnson, C.

    2012-12-01

    This report details the petroleum savings and vehicle emissions reductions achieved by the U.S. Department of Energy's Clean Cities program in 2011. The report also details other performance metrics, including the number of stakeholders in Clean Cities coalitions, outreach activities by coalitions and national laboratories, and alternative fuel vehicles deployed.

  18. Clean Cities 2010 Annual Metrics Report

    SciTech Connect (OSTI)

    Johnson, C.

    2012-10-01

    This report details the petroleum savings and vehicle emissions reductions achieved by the U.S. Department of Energy's Clean Cities program in 2010. The report also details other performance metrics, including the number of stakeholders in Clean Cities coalitions, outreach activities by coalitions and national laboratories, and alternative fuel vehicles deployed.

  19. DOT Beyond Traffic Smart City Challenge

    Broader source: Energy.gov [DOE]

    The U.S. Department of Transportation is accepting applications for the Smart City Challenge to one mid-sized city that can demonstrate how advanced data and intelligent transportation system technologies and applications can be used to reduce congestion, protect the environment, respond to climate change, and support economic vitality.

  20. Clean Cities Now Vol. 17, No. 2

    SciTech Connect (OSTI)

    2013-10-23

    The Fall 2013 issue of the biannual newsletter for the U.S. Department of Energy's Clean Cities initiative. The newsletter includes feature stories on deployment of alternative fuels and advanced vehicles, and articles on Clean Cities coalition successes across the country.

  1. kansas city | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home kansas city Aviation Week Honors KCNSC Relocation The Kansas City National Security Campus relocation project was recognized as an industry benchmark last week at the 12th annual Aviation Week Program Excellence Awards competition. Awards were presented Nov. 4 in Scottsdale, Arizona. The NSC's contractor, Honeywell, received top honors in the...

  2. City of Tallahassee Innovative Energy Initiatives

    SciTech Connect (OSTI)

    Wilder, Todd; Moragne, Corliss L.

    2014-06-25

    The City of Tallahassee's Innovative Energy Initiatives program sought, first, to evaluate customer response and acceptance to in-home Smart Meter-enabled technologies that allow customers intelligent control of their energy usage. Additionally, this project is in furtherance of the City of Tallahassee's ongoing efforts to expand and enhance the City's Smart Grid capacity and give consumers more tools with which to effectively manage their energy consumption. This enhancement would become possible by establishing an "operations or command center" environment that would be designed as a dual use facility for the City's employees - field and network staff - and systems responsible for a Smart Grid network. A command center would also support the City's Office of Electric Delivery and Energy Reliability's objective to overcome barriers to the deployment of new technologies that will ensure a truly modern and robust grid capable of meeting the demands of the 2151 century.

  3. Clean Cities | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technical Assistance Project (Tiger Teams) Fleets across the nation have made great progress implementing alternative fuels, advanced vehicles, and fuel-saving measures into their operations. These efforts have saved billions of gallons of petroleum, and earned fleets recognition as sustainability leaders in the process. Yet as the alternative fuels and advanced vehicles landscape evolves, some fleets may encounter issues along the way. To address these challenges, the U.S. Depart- ment of

  4. Fab City SPV India Pvt Ltd | Open Energy Information

    Open Energy Info (EERE)

    Fab City SPV India Pvt Ltd Jump to: navigation, search Name: Fab City SPV India Pvt Ltd Place: India Product: Hyderabad-based company charged with setting up the Fab City SPV. Fab...

  5. National Nuclear Security Administration Kansas City Field Office

    National Nuclear Security Administration (NNSA)

    City Plant Related Web Pages Kansas City Plant Home Page - Provides background information and related news on the Kansas City Plant. Links to local site web page which contains ...

  6. Bush Administration Plays Leading Role in Studying and Addressing Global

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change | Department of Energy Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change February 27, 2007 - 3:49pm Addthis Washington, DC - Continuing to take the lead in addressing global climate change, Energy Secretary Samuel Bodman, Environmental Protection Agency (EPA) Administrator Stephen Johnson, and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice

  7. U.S. Leads International Collaborative to Address Wind Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development/Wildlife Challenges | Department of Energy U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges May 18, 2015 - 5:46pm Addthis The U.S. Department of Energy (DOE) is leading a new International Energy Agency (IEA) Wind Task to address concerns about the environmental effects of wind energy technology. Task 34, also known as WREN (Working together

  8. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Across U.S. Industry | Department of Energy Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry PDF icon eip_report_pg9.pdf More Documents & Publications ITP Energy Intensive Processes: Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy Technology Solutions Energy Technology Solutions: Public-Private

  9. Opportunities for Building America Research to Address Energy Upgrade

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Challenges: HVAC, Envelope and IAQ (301) | Department of Energy Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Better Buildings Residential Network Peer Exchange Call Series: Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ

  10. DOE Seeks Input On Addressing Contractor Pension and Medical Benefits

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Liabilities | Department of Energy Input On Addressing Contractor Pension and Medical Benefits Liabilities DOE Seeks Input On Addressing Contractor Pension and Medical Benefits Liabilities March 27, 2007 - 12:10pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced in the Federal Register that it is seeking public comment on how to address the increasing costs and liabilities of contractor employee pension and medical benefits. Under the Department of Energy's unique

  11. Working Together to Address Natural Gas Storage Safety | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Together to Address Natural Gas Storage Safety Working Together to Address Natural Gas Storage Safety April 1, 2016 - 11:15am Addthis Working Together to Address Natural Gas Storage Safety Franklin (Lynn) Orr Franklin (Lynn) Orr Under Secretary for Science and Energy Marie Therese Dominguez Marie Therese Dominguez Administrator, U.S. Department of Transportation's Pipeline and Hazardous Materials Safety Administration As a part of the Administration's ongoing commitment to support

  12. Energy Saver RSS Subscribers: Update Your Feed Address | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy RSS Subscribers: Update Your Feed Address Energy Saver RSS Subscribers: Update Your Feed Address September 28, 2015 - 12:46pm Addthis Just a short administrative note for Energy Saver RSS subscribers: our feed address is changing. To continue reading the Energy Saver Blog through your RSS feed reader, please update the link in your reader to http://energy.gov/rss/energysaver/1280681. Thanks for reading and subscribing to Energy Saver! Addthis Related Articles The Energy Savers Blog

  13. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy Feedstocks-From Field to Fuel Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Allen Julian, Chief Business Officer, MBI PDF icon julian_biomass_2014.pdf More Documents & Publications 2015 Peer Review Presentations-Biochemical Conversion 2015 Peer Review Report Process Design and

  14. Expanding Opportunity and Addressing Unique Challenges Facing Women and

    Energy Savers [EERE]

    Girls of Color | Department of Energy Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color November 17, 2014 - 11:35am Addthis When President Obama founded the White House Council on Women and Girls (CWG) within the first two months of taking office, he charged us with working to address inequalities and barriers facing women and girls in our schools, workplaces, and

  15. Secretary Chu Addresses the International Atomic Energy Agency General

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy Addresses the International Atomic Energy Agency General Conference Secretary Chu Addresses the International Atomic Energy Agency General Conference September 20, 2010 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu addressed the International Atomic Energy Agency's 54th General Conference today in Vienna. His prepared remarks are below: Thank you, Ambassador Enkhsaikhan. Congratulations on your election as President of this Conference.

  16. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges. The Department of Energy is seeking comments on policy and logistical challenges that confront smart grid implementation, as well as recommendations on how to best overcome those challenges. PDF icon Steffes Corporation

  17. Strategies to Address Split Incentives in Multifamily Buildings |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy to Address Split Incentives in Multifamily Buildings Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily / Low-Income Peer Exchange Call: Strategies to Address Split Incentives in Multifamily Buildings, Call Slides and Discussion Summary, April 26, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Outreach to Multifamily Landlords and Tenants Stewards of Affordable Housing for

  18. Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Technical Conference | Department of Energy Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference November 30, 2011 - 1:50pm Addthis WASHINGTON, D.C. - Department of Energy Assistant Secretary for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the 2011 Federal Energy Regulatory Commission technical conference in Washington, D.C.

  19. Environmental Survey preliminary report, Kansas City Plant, Kansas City, Missouri

    SciTech Connect (OSTI)

    Not Available

    1988-01-01

    This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE), Kansas City Plant (KCP), conducted March 23 through April 3, 1987. The Survey is being conducted by a multidisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team members are outside experts being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with the KCP. The Survey covers all environmental media and all areas of environmental regulations. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data observations of the operations performed at the KCP, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing certain environmental problems identified during its on-site activities. The Sampling and Analysis Plan is being executed by DOE's Argonne National Laboratory. When completed, the results will be incorporated into the KCP Environmental Survey Interim Report. The Interim Report will reflect the final determinations of the KCP Survey. 94 refs., 39 figs., 55 tabs.

  20. Synthetic Biology for Advanced Fuels (Opening Keynote Address...

    Office of Scientific and Technical Information (OSTI)

    Synthetic Biology for Advanced Fuels (Opening Keynote Address - 2010 JGI User Meeting) Citation Details In-Document Search Title: Synthetic Biology for Advanced Fuels (Opening ...

  1. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration ... and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice Admiral ...

  2. Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas Exhibition November 16, ... ASHGABAT, TURKMENISTAN - U.S. Secretary of Energy Samuel W. Bodman today held bilateral ...

  3. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes. Authors: Harper, Jason C. ; Polsky, ...

  4. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications Studies on Lithium Manganese Rich MNC Composite Cathodes ... Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials

  5. Address (Smart Grid Project) (France) | Open Energy Information

    Open Energy Info (EERE)

    France) Jump to: navigation, search Project Name Address Country France Coordinates 46.073231, 2.427979 Loading map... "minzoom":false,"mappingservice":"googlemaps3","type":"R...

  6. Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy...

    Energy Savers [EERE]

    Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid ... to the U.S. Department of Energy, Office of Electricity Delivery ...

  7. Africa - Technical Potential of Solar Energy to Address Energy...

    Open Energy Info (EERE)

    - Technical Potential of Solar Energy to Address Energy Poverty and Avoid GHG Emissions Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Technical Potential of Solar...

  8. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. The Alliance to Save ...

  9. Smart Grid RFI: Addressing Policy and Logistical Challenges,...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges, Comments from the Edison Electric Institute Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from the Edison Electric Institute The Edison Electric ...

  10. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of ...

  11. Ambient Corporation's Reply comments to DOE RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation's Reply comments to DOE RFI: ...

  12. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Federal Register Notice Volume 75, No. 180 - Sep. 17, 2010 Addressing Policy and Logistical Challenges to Smart Grid Implementation: Federal Register ...

  13. Addressing Policy and Logistical Challenges to smart grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    smart grid Implementation: eMeter Response to Department of Energy RFI Addressing Policy and Logistical Challenges to smart grid Implementation: eMeter Response to Department of ...

  14. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable ...

  15. Addressing mechanical reliability issues in Sandia MEMS devices...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing mechanical reliability issues in Sandia MEMS devices. No abstract prepared. Authors: Tanner, Danelle Mary, 1952- 1 ; -) ; Buchheit, Thomas E. ; Boyce, Brad Lee ...

  16. Microsoft Word - Actions to address lessons learned.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Actions to address Work Planning and Scheduling System lessons learned Action Executive owner Staff assigned Due date Understand the business environment of vendor references....

  17. Exploring the Utilization of Complex Algal Communities to Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase ...

  18. Addressing Challenging Materials at Oak Ridge National Laboratory...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing Challenging Materials at Oak Ridge National Laboratory No abstract prepared. Authors: Jubin, Robert Thomas 1 ; Patton, Bradley D 1 ; Robinson, Sharon M 1 ; ...

  19. Cities Leading through Energy Analysis and Planning | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Us » Initiatives & Projects » Cities Leading through Energy Analysis and Planning Cities Leading through Energy Analysis and Planning Now Accepting Applications for Funding Opportunity Announcement Now Accepting Applications for Funding Opportunity Announcement Read more View this infographic to learn more about the Cities-LEAP report. View this infographic to learn more about the Cities-LEAP report. Read more The Cities Leading through Energy Analysis and Planning (Cities-LEAP) project

  20. Cities Leading Through Energy Analysis and Planning Infographic |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Cities Leading Through Energy Analysis and Planning Infographic Cities Leading Through Energy Analysis and Planning Infographic The Cities Leading through Energy Analysis and Planning (Cities-LEAP) project delivers standardized, localized energy data and analysis that enables cities to lead clean energy innovation and integrate strategic energy analysis into decision making. Two Cities-LEAP infographics catalog the programs and tools currently supporting local

  1. ENERGYWORKS KC BUILDS CAPACITY IN KANSAS CITY | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ENERGYWORKS KC BUILDS CAPACITY IN KANSAS CITY ENERGYWORKS KC BUILDS CAPACITY IN KANSAS CITY ENERGYWORKS KC BUILDS CAPACITY IN KANSAS CITY In 2008, Kansas City, Missouri, formally adopted a Climate Protection Plan with greenhouse gas reduction targets for 2020 and 2050 and specific energy efficiency recommendations. Using $20 million in seed funding from the U.S. Department of Energy's (DOE's) Better Buildings Neighborhood Program, the City of Kansas City launched EnergyWorks KC in 2010 to

  2. Cooper City, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    it. Cooper City is a city in Broward County, Florida. It falls under Florida's 20th congressional district and Florida's 22nd congressional district.12 References ...

  3. Overview Of The Lake City, California Geothermal System | Open...

    Open Energy Info (EERE)

    : GRC; p. () Related Geothermal Exploration Activities Activities (1) Geothermal Literature Review At Lake City Hot Springs Area (Benoit, Et Al., 2004) Areas (1) Lake City Hot...

  4. EECBG Success Story: Seven Cities and a Utility Company Team...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seven Cities and a Utility Company Team Up to Deliver Residential Energy Savings EECBG Success Story: Seven Cities and a Utility Company Team Up to Deliver Residential Energy...

  5. Spanish Fork City Corporation (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Spanish Fork City Corporation (Utility Company) Jump to: navigation, search Name: Spanish Fork City Corporation Place: Utah Phone Number: 801-804-4450 Website: www.spanishfork.org...

  6. Workplace Charging Challenge Partner: City of Beaverton, OR ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The City of Beaverton's Sustainable Beaverton Strategy includes the goal of decreasing greenhouse gas emissions stemming from city operations, including fleet and employee ...

  7. Cambodia-Sub National Planning for Climate Change (cities, states...

    Open Energy Info (EERE)

    Climate Change (cities, states, districts) Jump to: navigation, search Name Cambodia-Sub National Planning for Climate Change (cities, states, districts) AgencyCompany...

  8. Vietnam-Sub National Planning for Climate Change (cities, states...

    Open Energy Info (EERE)

    Climate Change (cities, states, districts) Jump to: navigation, search Name Vietnam-Sub National Planning for Climate Change (cities, states, districts) AgencyCompany...

  9. Indonesia-Sub National Planning for Climate Change (cities, states...

    Open Energy Info (EERE)

    Climate Change (cities, states, districts) Jump to: navigation, search Name Indonesia-Sub National Planning for Climate Change (cities, states, districts) AgencyCompany...

  10. China-Sub National Planning for Climate Change (cities, states...

    Open Energy Info (EERE)

    for Climate Change (cities, states, districts) Jump to: navigation, search Name China-Sub National Planning for Climate Change (cities, states, districts) AgencyCompany...

  11. Myanmar-Sub National Planning for Climate Change (cities, states...

    Open Energy Info (EERE)

    Climate Change (cities, states, districts) Jump to: navigation, search Name Myanmar-Sub National Planning for Climate Change (cities, states, districts) AgencyCompany...

  12. 2012 Annual Planning Summary for Kansas City Site Office | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kansas City Site Office 2012 Annual Planning Summary for Kansas City Site Office The ongoing and projected Environmental Assessments and Environmental Impact Statements for 2012 ...

  13. 2011 Annual Planning Summary for Kansas City Site Office (KCSO...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kansas City Site Office (KCSO) 2011 Annual Planning Summary for Kansas City Site Office (KCSO) The ongoing and projected Environmental Assessments and Environmental Impact ...

  14. Guangxi Baise City Chenyu Hydroelectric Development Co Ltd |...

    Open Energy Info (EERE)

    Baise City Chenyu Hydroelectric Development Co Ltd Jump to: navigation, search Name: Guangxi Baise City Chenyu Hydroelectric Development Co., Ltd. Place: Baise, Guangxi Autonomous...

  15. City of Newton Falls, Ohio (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Company) Jump to: navigation, search Name: City of Newton Falls Place: Ohio Website: ci.newtonfalls.oh.us Facebook: https:www.facebook.compagesCity-of-Newton-Falls...

  16. Portland, Oregon: Solar in Action (Brochure), Solar America Cities...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Portland, Oregon Includes case studies on: * Increasing Market Demand: The Solar Now Campaign * Streamlining City Regulations * Integrating Solar into City Planning and Facilities ...

  17. Wuyishan City Xiangrun Hydropower Investment Co Ltd | Open Energy...

    Open Energy Info (EERE)

    Wuyishan City Xiangrun Hydropower Investment Co Ltd Jump to: navigation, search Name: Wuyishan City Xiangrun Hydropower Investment Co Ltd Place: Wuyishan, Fujian Province, China...

  18. Lichuan City Yujiang River Valley Hydro Co Ltd | Open Energy...

    Open Energy Info (EERE)

    Lichuan City Yujiang River Valley Hydro Co Ltd Jump to: navigation, search Name: Lichuan City Yujiang River Valley Hydro Co., Ltd. Place: Hubei Province, China Zip: 445400 Sector:...

  19. Demonstration of LED Street Lighting in Kansas City, MO (Technical...

    Office of Scientific and Technical Information (OSTI)

    Demonstration of LED Street Lighting in Kansas City, MO Citation Details In-Document Search Title: Demonstration of LED Street Lighting in Kansas City, MO Nine different ...

  20. Kansas City Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Us Our Operations Management and Budget Office of Civil Rights Workforce Statistics Kansas City Field Office Kansas City Field Office FY15 Year End Report Semi Annual...

  1. King Abdulaziz City for Science and Technology | Open Energy...

    Open Energy Info (EERE)

    Abdulaziz City for Science and Technology Jump to: navigation, search Name: King Abdulaziz City for Science and Technology Place: Riyadh, Saudi Arabia Zip: 11442 Sector: Solar...

  2. Caliente City Pool Pool & Spa Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Caliente City Pool Pool & Spa Low Temperature Geothermal Facility Jump to: navigation, search Name Caliente City Pool Pool & Spa Low Temperature Geothermal Facility Facility...

  3. Forest City High School Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    High School Energy Purchaser Forest City Community School District Location Forest City IA Coordinates 43.266011, -93.653378 Show Map Loading map... "minzoom":false,"mappings...

  4. City of Portland- Streamlined Building Permits for Residential Solar Systems

    Office of Energy Efficiency and Renewable Energy (EERE)

    The City of Portland's Bureau of Development Services (BDS) developed a streamlined permitting process for residential solar energy system installations. The City of Portland has staff at the...

  5. AEP (Central and North)- CitySmart Program

    Broader source: Energy.gov [DOE]

    The CitySmart Program is designed to help participants identify energy efficiency opportunities in existing and newly planned city facilities. Monetary incentives are also available to help...

  6. City of Olive Hill, Kentucky (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    City of Olive Hill, Kentucky (Utility Company) Jump to: navigation, search Name: Olive Hill City of Place: Kentucky Phone Number: (606) 286-2192 Website: www.cityofolivehillutiliti...

  7. City of Medford Wind Turbine | Open Energy Information

    Open Energy Info (EERE)

    Medford Wind Turbine Jump to: navigation, search Name City of Medford Wind Turbine Facility City of Medford Wind Turbine Sector Wind energy Facility Type Small Scale Wind Facility...

  8. Elk City Station Biomass Facility | Open Energy Information

    Open Energy Info (EERE)

    Station Biomass Facility Jump to: navigation, search Name Elk City Station Biomass Facility Facility Elk City Station Sector Biomass Facility Type Landfill Gas Location Douglas...

  9. Fact #663: February 21, 2011 Clean Cities Program Petroleum Displaceme...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    February 21, 2011 Clean Cities Program Petroleum Displacement Estimates for 2009 Fact 663: February 21, 2011 Clean Cities Program Petroleum Displacement Estimates for 2009 Each ...

  10. Kansas City National Security Campus | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    Operations Acquisition and Project Management M & O Support Department Kansas City National Security Campus Kansas City National Security Campus National Security Campus ...

  11. Houston, Texas: Solar in Action (Brochure), Solar America Cities...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Houston, Texas: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Houston, Texas: Solar in Action (Brochure), Solar America Cities, ...

  12. DOE - Office of Legacy Management -- Texas City Chemicals Co...

    Office of Legacy Management (LM)

    Texas City Chemicals Co Inc - TX 02 FUSRAP Considered Sites Site: TEXAS CITY CHEMICALS CO., INC. (TX.02 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated ...

  13. Salt Lake City, Utah: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Salt Lake City, Utah: Energy Resources (Redirected from Salt Lake City, UT) Jump to: navigation, search Equivalent URI DBpedia Coordinates 40.7607793, -111.8910474 Show Map...

  14. Lincang City Xinshui Hydropower Development Co Ltd | Open Energy...

    Open Energy Info (EERE)

    Lincang City Xinshui Hydropower Development Co Ltd Jump to: navigation, search Name: Lincang City Xinshui Hydropower Development Co. Ltd. Place: Lincang, Yunnan Province, China...

  15. Project Profile: The International City/County Management Association...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Project Profile: The International CityCounty Management Association Project Profile: The International CityCounty Management Association Funding Opportunity: Solar Powering ...

  16. Fuel Cell and Hydrogen Pathways to Clean Cities: A Stakeholder...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell and Hydrogen Pathways to Clean Cities: A Stakeholder - Government Engagement Fuel Cell and Hydrogen Pathways to Clean Cities: A Stakeholder - Government Engagement May ...

  17. Elk City Wind Energy Center | Open Energy Information

    Open Energy Info (EERE)

    Wind Energy Center Jump to: navigation, search Name Elk City Wind Energy Center Facility Elk City Wind Energy Center Sector Wind energy Facility Type Commercial Scale Wind Facility...

  18. Eco Energy Cities Plc STAR group | Open Energy Information

    Open Energy Info (EERE)

    Energy Cities Plc STAR group Jump to: navigation, search Name: Eco Energy Cities Plc (STAR group) Place: Shanghai, Shanghai Municipality, China Sector: Carbon, Renewable Energy...

  19. DOE - Office of Legacy Management -- Cotter Canon City Site ...

    Office of Legacy Management (LM)

    Cotter Canon City Site - 009 FUSRAP Considered Sites Site: Cotter Canon City Site (009) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site...

  20. Canon City Area Space Heating Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Canon City Area Space Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Canon City Area Space Heating Low Temperature Geothermal Facility Facility Canon...

  1. Grant Improves Comfort for Nevada City's Employees | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Articles EECBG Success Story: Grant Improves Comfort for Nevada City's Employees Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  2. City of Atka, Alaska (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Name: City of Atka Place: Alaska Phone Number: (907) 581-6226 Website: www.swamc.orghtmlsouthwest-a Facebook: https:www.facebook.compagesCity-of-Atka135988283150031...

  3. City of Paris, Tennessee (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City of Paris, Tennessee (Utility Company) Jump to: navigation, search Name: City of Paris Place: Tennessee Website: parisbpu.com Facebook: https:www.facebook.com...

  4. Envision America Launches Inaugural Workshop to Help Cities Meet...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Envision America Launches Inaugural Workshop to Help Cities Meet Sustainability Challenges Envision America Launches Inaugural Workshop to Help Cities Meet Sustainability Challenges ...

  5. Energy Department Recognizes City of Roanoke, VA for Leadership...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Recognizes City of Roanoke, VA for Leadership in Better Buildings Challenge Energy Department Recognizes City of Roanoke, VA for Leadership in Better Buildings Challenge January ...

  6. Orlando, Florida: Solar in Action (Brochure), Solar America Cities...

    Office of Environmental Management (EM)

    Orlando, Florida: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Orlando, Florida: Solar in Action (Brochure), Solar America Cities,...

  7. Denver, Colorado: Solar in Action (Brochure), Solar America Cities...

    Office of Environmental Management (EM)

    Denver, Colorado: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Denver, Colorado: Solar in Action (Brochure), Solar America Cities,...

  8. Spring City Corporation (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City Corporation (Utility Company) Jump to: navigation, search Name: Spring City Corporation Place: Utah Phone Number: (435) 462-2244 Website: uamps.comindex.phpabout-uamp Outage...

  9. Quarterly Biomass Program/Clean Cities States Web Conference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Quarterly Biomass ProgramClean Cities States Web Conference: January 21, 2010 Quarterly Biomass ProgramClean Cities States Web Conference: January 21, 2010 Presentation from the ...

  10. City of Pittsburgh Implementation Model: Green Initiatives Trust...

    Broader source: Energy.gov (indexed) [DOE]

    City of Pittsburgh implementation model, Green initiatives trust fund. Author: U. S. Department of Energy City of Pittsburgh Implementation Model Website More Documents & ...

  11. Kansas City, Missouri: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Registered Energy Companies in Kansas City, Missouri Alternative Energy Sources Inc Smith Electric Vehicles US SEV US Registered Financial Organizations in Kansas City,...

  12. New York City Data Jam | OpenEI Community

    Open Energy Info (EERE)

    Jul 8 2012 New York City Data Jam Location: New York City Recent content 2013 Civic Hacking Day Ideas IRENA launches global atlas of renewable energy potential Datapalooza...

  13. City of Detroit (Michigan) EIA Revenue and Sales - February 2008...

    Open Energy Info (EERE)

    City of Detroit (Michigan) EIA Revenue and Sales - February 2008 Jump to: navigation, search EIA Monthly Electric Utility Sales and Revenue Data for City of Detroit for February...

  14. City of Detroit (Michigan) EIA Revenue and Sales - February 2009...

    Open Energy Info (EERE)

    City of Detroit for February 2009. Monthly Electric Utility Sales and Revenue Data Short Name 2009-02 Utility Company City of Detroit (Michigan) Place Michigan Start Date...

  15. City of Detroit (Michigan) EIA Revenue and Sales - November 2008...

    Open Energy Info (EERE)

    City of Detroit (Michigan) EIA Revenue and Sales - November 2008 Jump to: navigation, search EIA Monthly Electric Utility Sales and Revenue Data for City of Detroit for November...

  16. City of Detroit (Michigan) EIA Revenue and Sales - December 2008...

    Open Energy Info (EERE)

    City of Detroit for December 2008. Monthly Electric Utility Sales and Revenue Data Short Name 2008-12 Utility Company City of Detroit (Michigan) Place Michigan Start Date...

  17. Clean Cities Now, Vol. 11, No. 2 - April 2007

    SciTech Connect (OSTI)

    Not Available

    2007-04-01

    Clean Cities Now is the official publication of the Clean Cities initiative. Articles include program-specific news, coalition news, industry news, and more.

  18. Clean Cities Now, Vol. 12, No. 3 - July 2008

    SciTech Connect (OSTI)

    Not Available

    2008-07-01

    Clean Cities Now is the official newsletter of DOE's Clean Cities program. It includes articles on coalition activities, fleet and stakeholder success stories, and helpful resources.

  19. City of Orangeburg, South Carolina (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    City of Orangeburg, South Carolina (Utility Company) Jump to: navigation, search Name: City of Orangeburg Place: South Carolina Phone Number: 803- 268-4000 Website:...

  20. City of Peabody, Massachusetts (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Massachusetts (Utility Company) Jump to: navigation, search Logo: City of Peabody Name: City of Peabody Abbreviation: PMLP Place: Massachusetts Phone Number: 978-531-5975 Website:...

  1. City of Biggs, California (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City of Biggs, California (Utility Company) Jump to: navigation, search Name: City of Biggs Place: California Phone Number: (530) 868-5590 Website: www.biggs-ca.govutilitiesele...

  2. City of Chicopee, Massachusetts (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Massachusetts (Utility Company) Jump to: navigation, search Logo: Chicopee City of Name: Chicopee City of Abbreviation: CEL Place: Massachusetts Phone Number: 413.598.8311 Website:...

  3. City of Redding, California (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    City of Redding, California (Utility Company) Jump to: navigation, search Name: City of Redding Place: California Phone Number: 530.245.7000 Website: www.reupower.com Outage...

  4. Beaver City Corporation (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    City Corporation (Utility Company) Jump to: navigation, search Name: Beaver City Corporation Place: Utah Phone Number: 435-438-2451 Website: www.beaverutah.netelectric-li...

  5. Recovery Act Funding Helps City Open Energy Efficient Community Center

    Broader source: Energy.gov [DOE]

    The City of Largo, Florida is celebrating the opening of its new energy efficient Community Center that will help the city save money by saving energy.

  6. Community Renewable Energy Deployment: City of Montpelier Project...

    Open Energy Info (EERE)

    Community Renewable Energy Deployment: City of Montpelier Project Jump to: navigation, search Name Community Renewable Energy Deployment: City of Montpelier Project AgencyCompany...

  7. Kansas City Site Office General Workforce Restructuring (2007...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Apply for Our Jobs Our Jobs Working at NNSA Blog Home Field Offices Welcome to the Kansas City Field Office Kansas City Site Office General Workforce Restructuring (2007)...

  8. Orlando, Florida: Solar in Action (Brochure), Solar America Cities...

    Office of Environmental Management (EM)

    America City. By the time of this designation, the city already had ambitious plans for a green energy future in collaboration with Orlando Utilities Commission's (OUC) renewable...

  9. Focus Series: Philadelphia Energyworks: In the City of Brotherly...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Philadelphia Energyworks: In the City of Brotherly Love, Sharing Know-How Leads to Sustainability Focus Series: Philadelphia Energyworks: In the City of Brotherly Love, Sharing ...

  10. Atlantic City Convention Center Solar Power Plant | Open Energy...

    Open Energy Info (EERE)

    Convention Center Solar Power Plant Jump to: navigation, search Name Atlantic City Convention Center Solar Power Plant Facility Atlantic City Convention Center Sector Solar...

  11. Tuba City, Arizona, Disposal Site Community Information

    Office of Legacy Management (LM)

    C O M M U N I T Y I N F O R M A T I O N Tuba City, Arizona, Disposal Site Tuba City Site Background 1954-1955 Tuba City mill is built. 1956-1966 Rare Metals Corporation and El Paso Natural Gas Company operate the uranium- and vanadium-ore processing mill. Chemicals from tailings piles and ponds leak into the soil and groundwater during milling operations. 1988 U.S. Department of Energy (DOE) cleans up materials from former milling operations. 1990 Mill tailings are placed in a disposal cell. A

  12. Symbiosis: Addressing Biomass Production Challenges and Climate Change |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Symbiosis: Addressing Biomass Production Challenges and Climate Change Symbiosis: Addressing Biomass Production Challenges and Climate Change This presentation was the opening keynote of the Symbiosis Conference. PDF icon symbiosis_conference_hamilton.pdf More Documents & Publications The Future of Bioenergy Feedstock Production Symbiosis Biofeedstock Conference: Expanding Commercialization of Mutualistic Microbes to Increase Feedstock Production Symbiosis

  13. Method for the electro-addressable functionalization of electrode arrays

    DOE Patents [OSTI]

    Harper, Jason C.; Polsky, Ronen; Dirk, Shawn M.; Wheeler, David R.; Arango, Dulce C.; Brozik, Susan M.

    2015-12-15

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes.

  14. IP address management : augmenting Sandia's capabilities through open source tools.

    SciTech Connect (OSTI)

    Nayar, R. Daniel

    2005-08-01

    Internet Protocol (IP) address management is an increasingly growing concern at Sandia National Laboratories (SNL) and the networking community as a whole. The current state of the available IP addresses indicates that they are nearly exhausted. Currently SNL doesn't have the justification to obtain more IP address space from Internet Assigned Numbers Authority (IANA). There must exist a local entity to manage and allocate IP assignments efficiently. Ongoing efforts at Sandia have been in the form of a multifunctional database application notably known as Network Information System (NWIS). NWIS is a database responsible for a multitude of network administrative services including IP address management. This study will explore the feasibility of augmenting NWIS's IP management capabilities utilizing open source tools. Modifications of existing capabilities to better allocate available IP address space are studied.

  15. City of Cincinnati- Residential Rebate Program

    Broader source: Energy.gov [DOE]

     The City of Cincinnati and the Greater Cincinnati Energy Alliance have partnered to provide rebate incentives for homeowners in Cincinnati. To qualify for rebates, homeowners must receive a Home...

  16. City of Asheville- Building Permit Fee Rebates

    Broader source: Energy.gov [DOE]

    The City of Asheville offers rebates for building permits and plan reviews for certain renewable energy technologies and green building certifications for homes and mixed-use commercial buildings....

  17. City of Berkeley- Energy Conservation Ordinance

    Broader source: Energy.gov [DOE]

    The City of Berkeley has an ordinance requiring certain energy conservation measures to be installed in residential and commercial properties upon the sale of the building or major renovations over...

  18. City of Chicago- Small Business Improvement Fund

    Broader source: Energy.gov [DOE]

    SomerCor 504 Inc. administers the Small Business Improvement Fund for the City of Chicago. The fund utilizes revenue from Tax Increment Financing (TIF) and supports commercial and industrial...

  19. City of Boulder- Solar Grant Program

    Broader source: Energy.gov [DOE]

    The Solar Grant Program provides grants for PV and solar water heating installations on housing enrolled in the city's affordable housing program, site-based non-profit organizations, and low- to...

  20. City of Healdsburg- PV Incentive Program

    Broader source: Energy.gov [DOE]

    Through the City of Healdsburg's PV Buy-down Program, residential and commercial customers are eligible for rebate on qualifying grid-connected PV systems. In keeping with SB1, (the California...