National Library of Energy BETA

Sample records for mailing address appendix

  1. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  2. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  3. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  4. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  5. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  6. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  8. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  9. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  10. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  11. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  12. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  13. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  14. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  15. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  16. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  17. CPFF Appendix

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Cost Plus Fixed-Fee Services Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: FAR: http://farsite.hill.af.mil/vffara.htm

  18. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  19. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  20. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  1. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  2. LFS Appendix SFA-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: FAR: http://farsite.hill.af.mil/vffara.htm DEAR:

  3. Carbon dioxide and climate. [Appendix includes names and addresses of the Principal Investigators for the research projects funded in FY1991

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    Global climate change is a serious environmental concern, and the US has developed An Action Agenda'' to deal with it. At the heart of the US effort is the US Global Change Research Program (USGCRP), which has been developed by the Committee on Earth and Environmental Sciences (CEES) of the Federal Coordinating Council for Sciences, Engineering, and Technology (FCCSET). The USGCRP will provide the scientific basis for sound policy making on the climate-change issue. The DOE contribution to the USGCRP is the Carbon Dioxide Research Program, which now places particular emphasis on the rapid improvement of the capability to predict global and regional climate change. DOE's Carbon Dioxide Research Program has been addressing the carbon dioxide-climate change connection for more than twelve years and has provided a solid scientific foundation for the USGCRP. The expansion of the DOE effort reflects the increased attention that the Department has placed on the issue and is reflected in the National Energy Strategy (NES) that was released in 1991. This Program Summary describes projects funded by the Carbon Dioxide Research Program during FY 1991 and gives a brief overview of objectives, organization, and accomplishments. The Environmental Sciences Division of the Office of Health and Environmental Research, Office of Energy Research supports a Carbon Dioxide Research Program to determine the scientific linkage between the rise of greenhouse gases in the atmosphere, especially carbon dioxide, and climate and vegetation change. One facet is the Core CO{sub 2} Program, a pioneering program that DOE established more than 10 years ago to understand and predict the ways that fossil-fuel burning could affect atmospheric CO{sub 2} concentration, global climate, and the Earth's biosphere. Major research areas are: global carbon cycle; climate detection and models of climate change; vegetation research; resource analysis; and, information and integration.

  4. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  5. ATTACHMENT J.3 - APPENDIX C

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    99 Contract No.: DE-AC02-09CH11466 Section J - Appendix C J-C-1 ATTACHMENT J.3 APPENDIX C SPECIAL FINANCIAL INSTITUTION ACCOUNT AGREEMENT Applicable to the Operation of PPPL Contract No. DE-AC02-09CH11466 Modification No. 0199 Contract No.: DE-AC02-09CH11466 Section J - Appendix C J-C-2 Modification N o: 0 199 Contract N o: D E---AC02---09CH11466 Section J --- A ppendix C Information c ontained i n t his d ocument i s r estricted. C ontact P PPL v ia e mail--- j delooper@pppl.gov t o r equest a

  6. CPFF Appendix

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 31113) Cost Plus Fixed-Fee Services Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the...

  7. APPENDIX A

    National Nuclear Security Administration (NNSA)

    Revised and Replaced by Mods 002, 006, 044 DE-NA0000622 SECTION J APPENDIX I PERSONNEL APPENDIX 04/22/2013 TABLE OF CONTENTS INTRODUCTION ........................................................................................................................................................ 1 DEFINITIONS 3 PART I - COMPENSATION SYSTEM .................................................................................................................... 5 A. POLICY/OBJECTIVES

  8. ASER Web Addresses and Points of Contact at DOE Sites

    Office of Environmental Management (EM)

    ASER Web Addresses and Points of Contact at DOE Sites March 29, 2013 Site and Web Address ASER Contact Name Phone E-mail Ames Laboratory http:www.ameslab.govoperationsesha...

  9. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  10. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  11. EFS Appendix SFA-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 3/11/13) Appendix SFA-1 Page 1 of 7 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  12. EFS Appendix SFA-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 7 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  13. Appendix J

    Office of Environmental Management (EM)

    Transmission Line Project Final Environmental Impact Statement Appendix J J-1 BLM LAND USE ... The regulations establishing procedures for the processing of these leases and ...

  14. Appendix A; Appendix B

    SciTech Connect (OSTI)

    Dragan C. Curcija

    2006-09-15

    This is the summary page for the technical and other reports on the DOE Cooperative Agreement DE-FC36-94CH10604 for the period of January 1, 2000 to December 31, 2004. The progress, technical and other reports and publications are consolidated by the contracting year and also by the cooperative agreement tasks. The listing sorted by tasks is also sub-sorted by fiscal year for easier navigation. These listings are given in appendix A and Appendix B of this summary report. Individual report files are located in each fiscal year directory (i.e., FY00, FY01, etc. up to FY04). The complete listing and report files are also posted on the web site and is fully navigable by these two criteria. The web site is at: http://www.ceere.org/beep/beep{_}pubsanddownloads.html. More significant and less obvious part of deliverables are applications of this research, which are used in everyday operations of NFRC, software tools and manufacturers design practice, which has significantly changed as a result of this and related research efforts.

  15. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  16. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  17. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity Addressing Cybersecurity Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. March 17, 2016 Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. Contact Richard P. Feynman Center for Innovation (505) 665-9090 Email Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the

  18. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity March 17, 2016 Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the challenges organizations face in trying to protect their data. According to Experian, the risk of a data breach is higher than ever with almost half of organizations suffering at least one security incident in the last 12 months. It's no wonder industry and government are looking for more tools to keep their data safe. To this end, in 2015, Los Alamos

  19. Appendix A Scoping Input Appendix ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Species Act Correspondence with the U.S. Fish & Wildlife Service Appendix F Section 106 ... December 13, 2013. The following input was received during the Scoping period: * U.S. Fish ...

  20. Appendix A

    Office of Environmental Management (EM)

    Appendices of DOE G 226.1-2A Appendices of DOE G 226.1-2A Below are the appendices to DOE G 226.1-2A Federal Line Management Oversight of Department of Energy Nuclear Facilities. The DOE program offices responsible for the content in the appendices keep that information up to date. The Criteria Review and Approach Documents (CRADs) accessible by the hyperlinks in Appendix C are provided in a variety of configurations. Some of the hyperlinks in Appendix C lead directly to CRADs, others consist of

  1. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  2. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  3. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  4. LFS Appendix SFA-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 3/11/13) * Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The following

  5. Environmental Assessment for Conducting Astrophysics and Other Basic Science Experiments - Appendix A Comments and Responses

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A-1 APPENDIX A COMMENTS AND RESPONSES This appendix contains the comments that were received during the 30-day public comment period on the draft EA (October 23 through November 22, 2000) and their responses. Comments were obtained during public meetings held in Santa Fe, New Mexico, on November 14, 2000, and in Carlsbad, New Mexico, on November 16, 2000, as well as from letters and electronic mail messages. The comment entries are organized according to comment categories. In compliance with

  6. Appendix A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Appendix A Statement of Work CRADA No. SC##/####.##.## January 1, 2015 Research & Development for Advanced Concepts A. PURPOSE Sandia National Laboratories (Sandia) and The British East India Company (BEIC) will collaboratively engage in analysis, research, and development of a dynamic array of energy-related topics with a goal of augmenting an awareness of new energy systems that can transition our economy from fossil fuel dependency. The planned work will cover a wide range of energy

  7. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  8. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  9. Appendix A

    U.S. Energy Information Administration (EIA) Indexed Site

    185 Appendix A Summary of Data Collection and Report Methodology The 2014 data for the Natural Gas Annual are taken primarily from Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." This survey and all other sources of data for this report are discussed separately in the following sections. Form EIA-176 Survey Design The original version of Form EIA-176 was approved in 1980 with a mandatory response requirement. Prior to 1980, published data were

  10. APPENDIX I

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    I - SINGLE-SHELL TANK SYSTEM WASTE RETRIEVAL AND CLOSURE PROCESS I-1 1.0 PURPOSE AND INTRODUCTION The purpose of this Agreement Appendix I is to: 1. Document the process DOE is required to use to close DOE's SST system (i.e., the SSTs themselves; and associated ancillary equipment including waste transfer piping, valve pits, vaults, etc.; contaminated soils, and contaminated groundwater 1 ) including the retrieval of tank wastes. The major phases of this closure process under the HWMA are: Tank

  11. Appendix D: Facility Process Data and Appendix E: Equipment Calibration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Sheets | Department of Energy D: Facility Process Data and Appendix E: Equipment Calibration Data Sheets Appendix D: Facility Process Data and Appendix E: Equipment Calibration Data Sheets Docket No. EO-05-01: Appendix D: Facility Process Data and Appendix E: Equipment Calibration Data Sheets from Final Report: Particulate Emissions Testing, Unit 1, Potomac River Generating Station, Alexandria, Virginia PDF icon Appendix D: Facility Process Data and Appendix E: Equipment Calibration

  12. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  13. Appendix 6 of 6

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Federal Facility Agreement and Consent Order Change Control Form Appendix 3: M-20 Change Control Form Submit Part B permit applications for all RCRA TSD units Appendix 4: M-62 Change Control Form High Level Waste and Low Level Waste pretreatment, processing and vitrification Appendix 5: M-90 Change Control Form Jeep Complete Facilities for storage and disposal of immobile High Level and Low Activity Waste. Ecology WTP Recovery Plan comments Appendix 3 of 6. January 17, 2002 Change Number

  14. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  15. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  16. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  17. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  18. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  19. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  20. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  1. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  2. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  3. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  4. Appendix D: Facility Process Data and Appendix E: Equipment Calibratio...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    D: Facility Process Data and Appendix E: Equipment Calibration Data Sheets Appendix D: Facility Process Data and Appendix E: Equipment Calibration Data Sheets Docket No. EO-05-01: ...

  5. SECTION J, APPENDIX B - PEP

    National Nuclear Security Administration (NNSA)

    SECTION J APPENDIX B PERFORMANCE EVALUATION PLAN Replaced by Mods 002, 016, 020, 029, 0084 Intentionally left blank for Internet posting purposes. Section J, Appendix B, Page 1

  6. SECTION J, APPENDIX B - PEP

    National Nuclear Security Administration (NNSA)

    SECTION J APPENDIX B PERFORMANCE EVALUATION PLAN Replaced by Mods 002, 016, 020, 029, 0084 Intentionally left blank for Internet posting purposes. Section J, Appendix B, Page 1...

  7. Appendix A: Request Letters

    Gasoline and Diesel Fuel Update (EIA)

    U.S. Energy Information Administration | Analysis of Impacts of a Clean Energy Standard as requested by Chairman Bingaman Appendix A: Request Letters U.S. Energy Information...

  8. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3, 3/11/13) Construction Subcontract Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or

  9. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: * FAR: http://farsite.hill.af.mil/vffara.htm and * DEAR:

  10. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: * FAR: http://farsite.hill.af.mil/vffara.htm and * DEAR:

  11. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: * FAR: http://farsite.hill.af.mil/vffara.htm and * DEAR:

  12. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 5 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website addresses: FAR: http://farsite.hill.af.mil/vffara.htm DEAR:

  13. Appendix A: Conceptual Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL-Research Support Facilities TABLE OF CONTENTS Solicitation No. RFJ-8-77550 Appendix A: Conceptual Documents Page 1 of 299 February 6, 2008 Appendix A CONCEPTUAL DOCUMENTS TABLE OF CONTENTS INTRODUCTION ...................................................................................................................... 2 PART 1-PROCEDURES .......................................................................................................... 3 PART 2-PROGRAM

  14. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  15. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  16. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  17. Microsoft Word - Appendix A-H from 2007 Annual Report.doc

    Office of Legacy Management (LM)

    09 Appendix C, Page 1 C.1 Original Landfill Appendix C, Page 2 Appendix C, Page 3 Appendix C, Page 4 Appendix C, Page 5 Appendix C, Page 6 Appendix C, Page 7 Appendix C, Page 8 Appendix C, Page 9 Appendix C, Page 10 Appendix C, Page 11 Appendix C, Page 12 Appendix C, Page 13 Appendix C, Page 14 Appendix C, Page 15 Appendix C, Page 16 Appendix C, Page 17 Appendix C, Page 18 Appendix C, Page 19 Appendix C, Page 20 Appendix C, Page 21 Appendix C, Page 22 Appendix C, Page 23 Appendix C, Page 24

  18. Microsoft Word - Appendix A-H from 2007 Annual Report.doc

    Office of Legacy Management (LM)

    0 Appendix C, Page 1 C.1 Original Landfill Appendix C, Page 2 Appendix C, Page 3 Appendix C, Page 4 Appendix C, Page 5 Appendix C, Page 6 Appendix C, Page 7 Appendix C, Page 8 Appendix C, Page 9 Appendix C, Page 10 Appendix C, Page 11 Appendix C, Page 12 Appendix C, Page 13 Appendix C, Page 14 Appendix C, Page 15 Appendix C, Page 16 Appendix C, Page 17 Appendix C, Page 18 Appendix C, Page 19 Appendix C, Page 20 Appendix C, Page 21 Appendix C, Page 22 Appendix C, Page 23 Appendix C, Page 24

  19. change_address_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CHANGE OF ADDRESS and EMERGENCY NOTIFICATION TO: HUMAN RESOURCES DATE: Z Social Security Print First Name Print Middle Name or Initial Print Last Name (Currently in Payroll...

  20. Appendix TFIELD: Transmissivity Fields

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Appendix TFIELD-2014 Transmissivity Fields United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix TFIELD-2014 Table of Contents TFIELD-1.0 Overview of the T-field Development, Calibration, and Mining Modification Process TFIELD-2.0 Geologic Data TFIELD-2.1 Culebra Hydrogeologic Setting TFIELD-2.2 Refinement of Geologic Boundaries TFIELD-2.2.1 Rustler Halite Margins TFIELD-2.2.2 Salado

  1. Appendix B | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendix B to DOE's Report to Congress on the Price-Anderson Act, containing provisions of ... Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 ...

  2. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  3. Appendix A, Field Sampling Data and Appendix B, Field Reduced Data |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy A, Field Sampling Data and Appendix B, Field Reduced Data Appendix A, Field Sampling Data and Appendix B, Field Reduced Data Docket No. EO-05-01: Appendix A, Field Sampling Data and Appendix B, Field Reduced Data from Final Report: Particulate Emissions Testing, Unit 1, Potomac River Generating Station, Alexandria, Virginia PDF icon Appendix A, Field Sampling Data and Appendix B, Field Reduced Data More Documents & Publications Appendix D: Facility Process Data and

  4. ATTACHMENT J.7 - APPENDIX G

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Modification No. 0199 Contract No. DE-AC02-09CH11466 Section J - Appendix G J-G-1 ATTACHMENT J.7 APPENDIX G PURCHASING SYSTEM REQUIREMENTS Applicable to the Operation of PPPL Contract No. DE-AC02-09CH11466 Modification No. 0199 Contract No. DE-AC02-09CH11466 Section J - Appendix G J-G-2 Appendix G Purchasing System Requirements This Appendix and Clause I.146 "Contractor Purchasing System," sets forth DOE requirements applicable to the Purchasing System established under the Contract

  5. Appendix PA: Performance Assessment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    for the Waste Isolation Pilot Plant Appendix PA-2014 Performance Assessment United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix PA Table of Contents PA-1.0 Introduction PA-1.1 Changes since the CRA-2009 PA PA-1.1.1 Replacement of Option D with the ROMPCS PA-1.1.2 Additional Mined Volume in the Repository North End PA-1.1.3 Refinement to the Probability of Encountering Pressurized Brine

  6. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  7. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    .1, 6/17/13) Appendix SFA-1 Page 1 of 6 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  8. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    .1, 6/17/13) Appendix SFA-1 Page 1 of 6 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  9. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 3/11/13) Appendix SFA-1 Page 1 of 9 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  10. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SFA (Rev. 2, 3/11/13) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm

  11. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 3/11/13) Appendix SFA-1 Page 1 of 3 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  12. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 3/11/13) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  13. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 3/11/13) Appendix SFA-1 Page 1 of 6 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The

  14. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 7 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  15. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  16. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  17. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 7/14/14) Appendix SFA-1 Page 1 of 3 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  18. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 7/14/14) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: FAR: http://farsite.hill.af.mil/vffara.htm DEAR: http://farsite.hill.af.mil/vfdoea.htm

  19. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  20. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  1. Residential Freezers (Appendix B) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    File Residential Freezers Appendix B -- v2.0 More Documents & Publications Refrigerators and Refrigerator-Freezers (Appendix A1 after May 2, 2011) Residential Refrigerators-Freezer...

  2. Appendix C, Analytical Data | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    C, Analytical Data Appendix C, Analytical Data Docket No. EO-05-01: Appendix C, Analytical Data from Final Report: Particulate Emissions Testing, Unit 1, Potomac River Generating ...

  3. SECTION J, APPENDIX A - SOW

    National Nuclear Security Administration (NNSA)

    0007749 SECTION J, APPENDIX A: STATEMENT OF WORK TABLE OF CONTENTS CHAPTER I. OBJECTIVES, SCOPE, AND REQUIREMENTS ......................................................................... 1 1.0 OBJECTIVE .................................................................................................................................................. 1 2.0 BACKGROUND

  4. Appendix A: Reference case projections

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    6 Appendix H Table H10. World installed solar generating capacity by region and country, 2011-40 (gigawatts) Regioncountry History Projections Average annual percent change, ...

  5. ATTACHMENT J.1 - APPENDIX A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    36 Contract No. DE-AC02-09CH11466 Section J - Appendix A J-A-1 ATTACHMENT J.1 APPENDIX A ADVANCED UNDERSTANDINGS ON HUMAN RESOURCES Applicable to the Operation of Princeton Plasma Physics Laboratory Contract No. DE-AC02-09CH11466 Modification No. 0136 Contract No. DE-AC02-09CH11466 Section J - Appendix A J-A-2 Table of Contents Appendix A PRINCETON PLASMA PHYSICS LABORATORY ADVANCE UNDERSTANDING ON HUMAN RESOURCES I. INTRODUCTION II. HUMAN RESOURCES STRATEGY, BUSINESS PLANNING AND PERFORMANCE

  6. Microsoft Word - CPFFS Appendix SFA-1 (Rev. 7.1, 5-22-15).doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    .1, 5/22/15) Appendix SFA-1 Page 1 of 8 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at the following website addresses: FAR: http://farsite.hill.af.mil/vffara.htm DEAR:

  7. Appendix B-9

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    APPENDIX B-9 STANDARD TERMS AND CONDITIONS FOR Cost Type Subcontracts With Educational Institutions JULY 11, 2014 Subcontractor is hereby placed on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under the U.S. Department of Energy Contract No. DE- AC36-08GO28308. All references to "NREL" in this subcontract shall mean the

  8. Appendix C-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    APPENDIX C - 1 Intellectual Property Provisions For Large Businesses, State and Local Governments, or Foreign Organizations (Research, Development, or Demonstration) The Subcontractor is hereby placed on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department of Energy Contract No. DE-AC36-08GO28308. All references to

  9. Appendix C-2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2012 APPENDIX C - 2 Intellectual Property Provisions For Domestic Small Business, Educational Institutions, and Other Nonprofit Organizations (Research, Development, or Demonstration) The Subcontractor is hereby placed on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department of Energy Contract No. DE-AC36-08GO28308. All

  10. Appendix HYDRO: Hydrological Investigations

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HYDRO-2014 Hydrological Investigations United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix HYDRO-2014 Table of Contents HYDRO-1.0 Hydrological Studies HYDRO-2.0 Optimization of Culebra Monitoring Well Network HYDRO-3.0 Geochemical Analyses HYDRO-4.0 Steel-Cased Well Reconfiguration and Replacement HYDRO-5.0 Geological Information HYDRO-6.0 Hydraulic Test Interpretation HYDRO-7.0 Monitoring

  11. Appendix PORSURF: Porosity Surface

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PORSURF-2014 Porosity Surface United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix PORSURF-2014 Table of Contents PORSURF-1.0 Introduction PORSURF-2.0 Creep Closure Method PORSURF-3.0 Conceptual Model for Porosity Surface PORSURF-4.0 SANTOS Numerical Analyses PORSURF-5.0 Implementation of Porosity Surface in BRAGFLO PORSURF-6.0 Dynamic Closure of the North End and Hallways PORSURF-7.0

  12. EERE Program Management Guide - Appendix A | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    A EERE Program Management Guide - Appendix A Appendix A provides information on the EERE multi-year program plan template. PDF icon pmguide_appendix_a

  13. EERE Program Management Guide - Appendix B | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    B EERE Program Management Guide - Appendix B Appendix B provides suggested practice for developing the annual operating plan Phase II guidance. PDF icon pmguide_appendix_b

  14. Brinkman Addresses JLab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brinkman Addresses JLab Brinkman Addresses JLab Brinkman Addresses JLab Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. "There is still a lot of interesting nuclear physics that we want to do

  15. RESIDENTIAL CLOTHES WASHERS (APPENDIX J2) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RESIDENTIAL CLOTHES WASHERS (APPENDIX J2) RESIDENTIAL CLOTHES WASHERS (APPENDIX J2) File Residential Clothes Washers Appendix J2 -- v2.1 More Documents & Publications Residential Clothes Washers (Appendix

  16. Microsoft Word - SEC J_Appendix H - RESERVED

    National Nuclear Security Administration (NNSA)

    H, Page 1 SECTION J APPENDIX H RESERVED

  17. Microsoft Word - SEC J_Appendix R - RESERVED

    National Nuclear Security Administration (NNSA)

    R, Page 1 SECTION J APPENDIX R RESERVED

  18. Appendix B-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STANDARD TERMS AND CONDITIONS FOR (1) COST SHARING (2) COST REIMBURSEMENT, AND (3) COST PLUS FIXED FEE JULY 11, 2014 Subcontractor is hereby on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department No. DE-AC36-08GO28308. NREL MASTER Appendix July 11, 2014 Page 2 of 90 INDEX Clause Title Page SECTION I. CLAUSES APPLICABLE

  19. Appendix B-10

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 STANDARD TERMS AND CONDITIONS FOR FIRM FIXED-PRICE SUBCONTRACTS FOR DESIGN/BUILD JULY 11, 2014 Subcontractor is hereby on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department No. DE-AC36-08GO28308. All references to "NREL" in this subcontract shall mean the Alliance for Sustainable Energy, LLC. NREL Appendix

  20. Appendix B-6

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 STANDARD TERMS AND CONDITIONS FOR LABOR HOUR SUBCONTRACTS JULY 11, 2014 Subcontractor is hereby on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department No. DE-AC36-08GO28308. All references to "NREL" in this subcontract shall mean the Alliance for Sustainable Energy, LLC. NREL Appendix B-6 July 11, 2014 Page 2

  1. Appendix B4

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 STANDARD TERMS AND CONDITIONS FOR CONSTRUCTION SUBCONTRACTS JULY 11, 2014 Subcontractor is hereby on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department No. DE-AC36-08GO28308. All references to "NREL" in this subcontract shall mean the Alliance for Sustainable Energy, LLC. NREL Appendix B-4 July 11, 2014 Page

  2. Appendix D-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D-1 STANDARD TERMS AND CONDITIONS FOR SUBCONTRACTS IN EXCESS OF $650,000 July 11, 2014 Subcontractor is hereby on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department No. DE-AC36-08GO28308. All references to "NREL" in this subcontract shall mean the Alliance for Sustainable Energy, LLC. Appendix D-1 July 11,

  3. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  4. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  5. Address:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Additive Manufacturing for Ceramics Citation Details In-Document Search Title: Additive Manufacturing for Ceramics Authors: Peterson, Dominic S. [1] + Show Author Affiliations Los Alamos National Laboratory [Los Alamos National Laboratory Publication Date: 2014-01-29 OSTI Identifier: 1119593 Report Number(s): LA-UR-14-20523 DOE Contract Number: AC52-06NA25396 Resource Type: Technical Report Research Org: Los Alamos National Laboratory (LANL) Sponsoring Org: DOE/LANL Country of Publication:

  6. Time and Materials subcontract appendix

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 3/11/13) Appendix SFA-1 Dated * Subcontract No. * Page 1 of 8 Preparer Note (PN): Asterisks highlighted in yellow (i.e., *) have been used throughout this document as placeholders to indicate where information is to be inserted. Make sure to delete this note in its entirety, before releasing this document. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are

  7. Appendix C | Department of Energy

    Energy Savers [EERE]

    C Appendix C Letter from John L. Quattrocchi, Senior Vice President, Underwriting, American Nuclear Insurers to Omer F. Brown, II, Harman & Wilmot, L.L.P., dated January 21, 1998; Attachment B to Comments filed by Energy Contractor Price- Anderson Group. PDF icon Appendix C More Documents & Publications Report to Congress on the Price-Anderson Act Comments and recommendations on Notice of Inquiry re Price-Anderson Act Reply Comments of Energy Contractors Price-Anderson Group to DOE

  8. Appendix V Public Involvement Plan

    Office of Legacy Management (LM)

    V Public Involvement Plan Revision No.: 6 February 2008 Federal Facility Agreement and Consent Order (FFACO) FFACO, Appendix V February 2008 i FFACO Public Involvement Plan U.S. Department of Energy National Nuclear Security Administration Nevada Site Office Las Vegas, Nevada U.S. Department of Defense Defense Threat Reduction Agency Detachment 1, Nevada Operations Mercury, Nevada U.S. Department of Energy Office of Legacy Management Grand Junction, Colorado FFACO, Appendix V February 2008 ii

  9. Appendix MON: WIPP Monitoring Programs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MON-2014 WIPP Monitoring Programs United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix MON-2014 Table of Contents MON-1.0 Introduction MON-1.1 Compliance Monitoring Program MON-1.2 Preclosure and Postclosure Monitoring MON-1.3 Monitoring Assessment MON-1.4 Appendix Summary MON-2.0 Compliance Monitoring Program Requirements MON-2.1 Compliance Certification/Recertification MON-3.0 Preclosure

  10. Keynote Address | Department of Energy

    Office of Environmental Management (EM)

    40PM to 2:05PM PDT Pacific Ballroom Wednesday keynote address by Dan Arvizu, Director, National Renewable Energy Laboratory

  11. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  12. Appendix E References | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    E References Crosswalk of Appendix E References to Main DSEIS Reference File name (Main DSEIS) or file name in Appendix E folder DOE (U.S. Department of Energy) 1999. Final ...

  13. Operations & Maintenance Best Practices Guide: Appendix a

    Broader source: Energy.gov [DOE]

    Guide describes Appendix A of the Operations and Maintenance Best Practices: A Guide to Achieving Operational Efficiency.

  14. Operations & Maintenance Best Practices Guide: Appendix d

    Broader source: Energy.gov [DOE]

    Guide describes Appendix D of the Operations and Maintenance Best Practices: A Guide to Achieving Operational Efficiency.

  15. Operations & Maintenance Best Practices Guide: Appendix c

    Broader source: Energy.gov [DOE]

    Guide describes Appendix C of the Operations and Maintenance Best Practices: A Guide to Achieving Operational Efficiency.

  16. Operations & Maintenance Best Practices Guide: Appendix B

    Broader source: Energy.gov [DOE]

    Guide describes Appendix B of the Operations and Maintenance Best Practices: A Guide to Achieving Operational Efficiency.

  17. Keynote Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    10PM to 1:40PM PDT Pacific Ballroom Wednesday's keynote address by Dr. David Danielson, Assistant Secretary for Energy Efficiency and Renewable Energy, U.S. Department of Energy

  18. EERE Program Management Guide - Appendix F | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    F EERE Program Management Guide - Appendix F Appendix F is a model position description for the Deputy Assistant Secretary for the Office of Technology Development. PDF icon pmguide_appendix_f.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix G EERE Program Management Guide - Appendix B

  19. EERE Program Management Guide - Appendix G | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    G EERE Program Management Guide - Appendix G Appendix G is a model position description for EERE program managers. PDF icon pmguide_appendix_g.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix I EERE Program Management Guide - Appendix F

  20. Waste-Management Education and Research Consortium (WERC) annual progress report, 1991--1992. Appendixes

    SciTech Connect (OSTI)

    Not Available

    1992-04-07

    This report contains the following appendices: Appendix A - Requirements for Undergraduate Level; Appendix B - Requirements for Graduate Level; Appendix C - Graduate Degree In Environmental Engineering; Appendix D - Non-degree Certificate Program; Appendix E - Curriculum for Associate Degree Program; Appendix F - Curriculum for NCC Program; Appendix G - Information 1991 Teleconference Series; Appendix H - Information on 1992 Teleconference Series; Appendix I - WERC interactive Television Courses; Appendix J - WERC Research Seminar Series; Appendix K - Sites for Hazardous/Radioactive Waste Management Series; Appendix L- Summary of Technology Development of the Second Year; Appendix M - List of Major Publications Resulting from WERC; Appendix N - Types of Equipment at WERC Laboratories.

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  2. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  3. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  4. State of the Lab Address

    ScienceCinema (OSTI)

    King, Alex

    2013-03-01

    In his third-annual State of the Lab address, Ames Laboratory Director Alex King called the past year one of "quiet but strong progress" and called for Ames Laboratory to continue to build on its strengths while responding to changing expectations for energy research.

  5. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  6. SECTION J, APPENDIX A - SOW

    National Nuclear Security Administration (NNSA)

    Mod 002; Modified Mod 016; Replaced Mod 029; Modified Mod 0049) Honeywell FM&T, LLC Contract No. DE-NA0000622 SECTION J APPENDIX A STATEMENT OF WORK 09/19/12 TABLE OF CONTENTS CHAPTER I. OBJECTIVES, SCOPE, AND REQUIREMENTS ......................................................................... 1 1.0 OBJECTIVE .................................................................................................................................................. 1 2.0 BACKGROUND

  7. Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 3/11/13) Page 1 of 6 Appendix SFA-1 FAR & DEAR Clauses Incorporated By Reference (a) The Federal Acquisition Regulation (FAR) and the Department of Energy Acquisition Regulation (DEAR) clauses which are incorporated by reference herein shall have the same force and effect as if printed in full text. (b) Full text of the referenced clauses may be accessed electronically at website address: http://www.acquisition.gov/far/ or http://www.management.energy.gov/DEAR.htm (c) The following

  8. Addressing Deferred Maintenance, Infrastructure Costs, and Excess...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities at Portsmouth and Paducah Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities ...

  9. Appendix K - GPRA06 Weatherization and Intergovernmental Program...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendix K - GPRA06 Weatherization and Intergovernmental Program (WIP) Documentation Appendix K - GPRA06 Weatherization and Intergovernmental Program (WIP) Documentation State ...

  10. FAC 04-08, Appendix C | Open Energy Information

    Open Energy Info (EERE)

    Appendix CPermittingRegulatory GuidanceSupplemental Material Abstract Appendix to Bureau of Reclamation manual for issuing Leases of Power Privilege. Provides example of a...

  11. FAC 04-08, Appendix B | Open Energy Information

    Open Energy Info (EERE)

    Appendix BPermittingRegulatory GuidanceSupplemental Material Abstract Appendix to Bureau of Reclamation manual for issuing Leases of Power Privilege. Provides overview of...

  12. Barriers to Industrial Energy Efficiency - Study (Appendix A...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Study (Appendix A), June 2015 Barriers to Industrial Energy Efficiency - Study (Appendix A), June 2015 This study examines barriers that impede the adoption of energy efficient...

  13. Microsoft Word - Appendix G.doc

    Office of Legacy Management (LM)

    0 are included in this appendix. Appendix G, Page 1 This page intentionally left blank Appendix G, Page 2 RFLMA Contact Record 2010-01 1 of 4 ROCKY FLATS SITE REGULATORY CONTACT RECORD Purpose: Targeted soil sampling at the Original Landfill (OLF) to evaluate residual contamination levels in relation to the Colorado Department of Public Health and Environment's (CDPHE's) August 2008 Policy, End of Post-Closure Care. Contact Record Approval Date: January 20, 2010 Site Contact(s) / Affiliation(s):

  14. EERE Program Management Guide - Appendix K

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...baprogmgmtguide.html EERE Program Management Guide Appendix K-Roles, ... The CO is responsible for the business management and non- programmatic aspects of the ...

  15. Addressing the workforce pipeline challenge

    SciTech Connect (OSTI)

    Leonard Bond; Kevin Kostelnik; Richard Holman

    2006-11-01

    A secure and affordable energy supply is essential for achieving U.S. national security, in continuing U.S. prosperity and in laying the foundations to enable future economic growth. To meet this goal the next generation energy workforce in the U.S., in particular those needed to support instrumentation, controls and advanced operations and maintenance, is a critical element. The workforce is aging and a new workforce pipeline, to support both current generation and new build has yet to be established. The paper reviews the challenges and some actions being taken to address this need.

  16. POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Addressing Missclassified Positions POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions This memorandum provides policy guidance on how to consistently address misclassified positions within the Department and is effective immediately. There are several different circumstances that affect how a misclassified position will be addressed. PDF icon POLICY GUIDANCE MEMORANDUM #3A Addressing Missclassified Positions Responsible Contacts Jennifer Ackerman

  17. Addressing failures in exascale computing

    SciTech Connect (OSTI)

    Snir, Marc; Wisniewski, Robert W.; Abraham, Jacob A.; Adve, Sarita; Bagchi, Saurabh; Balaji, Pavan; Belak, Jim; Bose, Pradip; Cappello, Franck; Carlson, William; Chien, Andrew A.; Coteus, Paul; Debardeleben, Nathan A.; Diniz, Pedro; Engelmann, Christian; Erez, Mattan; Saverio, Fazzari; Geist, Al; Gupta, Rinku; Johnson, Fred; Krishnamoorthy, Sriram; Leyffer, Sven; Liberty, Dean; Mitra, Subhasish; Munson, Todd; Schreiber, Robert; Stearly, Jon; Van Hensbergen, Eric

    2014-05-01

    We present here a report produced by a workshop on Addressing Failures in Exascale Computing held in Park City, Utah, August 411, 2012. The charter of this workshop was to establish a common taxonomy about resilience across all the levels in a computing system; discuss existing knowledge on resilience across the various hardware and software layers of an exascale system; and build on those results, examining potential solutions from both a hardware and software perspective and focusing on a combined approach. The workshop brought together participants with expertise in applications, system software, and hardware; they came from industry, government, and academia; and their interests ranged from theory to implementation. The combination allowed broad and comprehensive discussions and led to this document, which summarizes and builds on those discussions.

  18. EERE Program Management Guide - Appendix D | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    D EERE Program Management Guide - Appendix D Appendix D provides information on the background and purpose of the EERE Peer Review Guide. PDF icon pmguide_appendix_d.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 3 EERE Program Management Guide - Appendix H

  19. EERE Program Management Guide - Appendix H | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    H EERE Program Management Guide - Appendix H Appendix H is a model senior executive services performance appraisal. PDF icon pmguide_appendix_h.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix I EERE Program Management Guide - Chapter 3

  20. EERE Program Management Guide - Appendix I | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    I EERE Program Management Guide - Appendix I Appendix I provides information on the EERE Program Management Virtual University. PDF icon pmguide_appendix_i.pdf More Documents & Publications EERE Program Management Guide - Appendix H EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - About the Program Management Guide

  1. EERE Program Management Guide - Appendix J | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    J EERE Program Management Guide - Appendix J Appendix J provides guidelines for functions that must be performed by government employees (inherently governmental functions). PDF icon pmguide_appendix_j.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix M

  2. EERE Program Management Guide - Appendix L | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    L EERE Program Management Guide - Appendix L Appendix L provides information on the role of the national laboratories. PDF icon pmguide_appendix_l.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 6 EERE Program Management Guide - Appendix P

  3. EERE Program Management Guide - Appendix M | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    M EERE Program Management Guide - Appendix M Appendix M provides information on support service contracts, which are a significant portion of the Department's total contracting effort. PDF icon pmguide_appendix_m.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix J EERE Program Management Guide - Chapter 6

  4. EERE Program Management Guide - Appendix N | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    N EERE Program Management Guide - Appendix N Appendix N provides EERE guidelines, definitions, and restrictions for support services contracting. PDF icon pmguide_appendix_n.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 6 EERE Program Management Guide - Appendix P

  5. Addressing Chromium in Groundwater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Chromium in Groundwater Addressing Chromium in Groundwater From 1956 to 1972, a non-nuclear power plant at Los Alamos National Laboratory periodically flushed water out ...

  6. Deputy Secretary Poneman Addresses Nuclear Deterrence Summit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Nuclear Deterrence Summit Deputy Secretary Poneman Addresses Nuclear Deterrence Summit February 17, 2010 - 12:00am Addthis Alexandria, VA - U.S. Deputy Secretary of ...

  7. EPA -- Addressing Children's Health through Reviews Conducted...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EPA -- Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act EPA -- Addressing Children's ...

  8. Expanding Opportunity and Addressing Unique Challenges Facing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color ...

  9. Microsoft Word - SECTION_J_Appendix_G_Performance_Guarantee_Agreement Contract.doc

    Energy Savers [EERE]

    G-1 SECTION J APPENDIX G PERFORMANCE GUARANTEE AGREEMENT

  10. Microsoft Word - SEC J_Appendix E - Perf Guarantee Agrmt_s_

    National Nuclear Security Administration (NNSA)

    E, Page 1 SECTION J APPENDIX E PERFORMANCE GUARANTEE AGREEMENT

  11. Microsoft Word - Appendix A-H from 2007 Annual Report.doc

    Office of Legacy Management (LM)

    1 Appendix C, Page 1 C.1 Original Landfill Appendix C, Page 2 Appendix C, Page 3 Appendix C, Page 4 Appendix C, Page 5 Appendix C, Page 6 Appendix C, Page 7 Appendix C, Page 8 Appendix C, Page 9 Appendix C, Page 10 Appendix C, Page 11 Original Landfill October 2011 Monthly Inspection-Attachment 1 The monthly inspection of the OLF was completed on October 31. The Site received approximately 10 inches of snow on October 25 and 26, however the cover was dry at the time of the inspection except for

  12. Appendix F Human Health Risk Assessment Document Number Q0029500 Appendix F

    Office of Legacy Management (LM)

    Human Health Risk Assessment Document Number Q0029500 Appendix F This appendix presents the detailed calculations used to estimate risks to human health. It includes the exposure factors, equations, abbreviations, assumptions, and references. Separate spreadsheets for ground water ingestion for the near-term and 20-year assumptio~ls have also been provided. The following spreadsheets are included in this appendix: Overview (Exposure Factors, Equations, Abbreviations, and COPCs)

  13. Address conversion unit for multiprocessor system

    SciTech Connect (OSTI)

    Fava, T.F.; Lary, R.F.; Blackledge, R.

    1987-03-03

    An address conversion unit is described for use in one processor in a multi-processor data processing system including a common memory, the processors and common memory being interconnected by a common bus including means for transferring address signals defining a common address space. The processor includes private bus means including means for transferring signals including address signals defining a private address space. A processor unit means is connected to the private bus means and includes means for transmitting and receiving signals including address signals over the private bus means for engaging in data transfers thereover. The address conversion unit is connected to the private bus means and common bus means for receiving address signals over the private bus means from the processor unit means in the private address space. The unit comprises: A. pointer storage means for storing a pointer identifying a portion of the common bus memory space; B. pointer generation means connected to receive a common bus address and for generating a pointer in response thereto for storage in the pointer storage means; and C. common bus address generation means connected to the private bus and the pointer storage means for receiving an address from the processor unit means and for generating a common bus address in response thereto. The common bus address is used to initiate transfers between the processor unit means and the common memory over the common bus.

  14. Microsoft Word - APPENDIX B flysheet.doc

    National Nuclear Security Administration (NNSA)

    B: NOTICE OF INTENT FOR THE Y-12 SITE WIDE ENVIRONMENTAL IMPACT STATEMENT AND OTHER FEDERAL REGISTER NOTICES Appendix B: Notice of Intent B-1 1 Final Y-12 SWEIS - February 2011 B-2...

  15. Searchlight Wind Energy Project FEIS Appendix C

    Office of Environmental Management (EM)

    C Page | C 19B Appendix C: BLM Wind Energy Development Program Policies and BMPs A-1 ATTACHMENT A BLM WIND ENERGY DEVELOPMENT PROGRAM POLICIES AND BEST MANAGEMENT PRACTICES (BMPS) ...

  16. EERE Program Management Guide - Appendix H

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    H Model Senior Executive Services Performance Appraisal H-1 December 2007 http:www1.eere.energy.govbaprogmgmtguide.html SAMPLE EERE Program Management Guide Appendix H-Model ...

  17. Appendix DATA Attachment A: WIPP Borehole Update

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Carlsbad, New Mexico Appendix DATA-2014 Attachment A: WIPP Borehole Update Table of Contents DATA-A-1.0 WIPP Boreholes DATA-A-2.0 Individual Well Reports ...

  18. Keynote Address: Future Vision | Department of Energy

    Office of Environmental Management (EM)

    Future Vision Keynote Address: Future Vision May 20, 2014 1:00PM to 1:30PM PDT Pacific Ballroom Tuesday's keynote address by Raffi Garabedian, Chief Technology Officer, First Solar

  19. Operating Guidelines Appendix C D.DOC

    Energy Savers [EERE]

    Competitive Sourcing Program OPERATING GUIDELINES (CS-OG-01) C-1 APPENDIX C. CONFLICT OF INTERESTS GUIDELINES 1. PURPOSE This Appendix identifies personal conflicts of interest (PCI), including participation, representation, post- employment, and procurement information restrictions, and organizational conflict of interest (OCI) restrictions relating to the conduct of Office of Management and Budget (OMB) Circular A-76 competitions and associated procurement actions at the Department of Energy

  20. Microsoft Word - Appendix G.doc

    Office of Legacy Management (LM)

    09 are included in this appendix. Appendix G, Page 1 RFLMA Contact Record 2009-01 1 of 5 ROCKY FLATS SITE REGULATORY CONTACT RECORD Purpose: Phase II and III Upgrades to Solar Ponds Plume Treatment System Contact Record Approval Date: February 17, 2009 Site Contact(s) / Affiliation(s): Scott Surovchak / DOE; Linda Kaiser / Stoller; Rick DiSalvo / Stoller; John Boylan / Stoller Regulatory Contact(s) / Affiliation(s): Carl Spreng / CDPHE Discussion: As approved in Rocky Flats Legacy Management

  1. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  2. Microsoft Word - Appendix A-H from 2007 Annual Report.doc

    Office of Legacy Management (LM)

    C, Page 1 C.1 Original Landfill Appendix C, Page 2 Appendix C, Page 3 Appendix C, Page 4 Appendix C, Page 5 Appendix C, Page 6 Appendix C, Page 7 Appendix C, Page 8 Appendix C, Page 9 Appendix C, Page 10 Appendix C, Page 11 The monthly inspection of the Original Landfill (OLF) at the Rocky Flats, Colorado, Site was completed on October 30, 2014. The repairs in the Berm 1 and Berm 4 areas remain in good condition. Although there is a noticeable depression in Berm 4 where the original slump-crack

  3. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  4. Appendix A: Reference case projections

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Appendix A Table A3. World gross domestic product (GDP) by region expressed in purchasing power parity, Reference case, 2011-40 (billion 2010 dollars) Region History Projections Average annual percent change, 2012-40 2011 2012 2020 2025 2030 2035 2040 OECD OECD Americas 18,616 19,080 23,390 26,577 29,942 33,569 37,770 2.5 United States a 15,021 15,369 18,801 21,295 23,894 26,659 29,898 2.4 Canada 1,396 1,422 1,700 1,881 2,074 2,293 2,529 2.1 Mexico and Chile 2,200 2,288 2,890 3,400 3,974 4,618

  5. OM Code Requirements For MOVs -- OMN-1 and Appendix III

    SciTech Connect (OSTI)

    Kevin G. DeWall

    2011-08-01

    The purpose or scope of the ASME OM Code is to establish the requirements for pre-service and in-service testing of nuclear power plant components to assess their operational readiness. For MOVs this includes those that perform a specific function in shutting down a reactor to the safe shutdown condition, maintaining the safe shutdown condition, and mitigating the consequences of an accident. This paper will present a brief history of industry and regulatory activities related to MOVs and the development of Code requirements to address weaknesses in earlier versions of the OM Code. The paper will discuss the MOV requirements contained in the 2009 version of ASME OM Code, specifically Mandatory Appendix III and OMN-1, Revision 1.

  6. Refrigerators and Refrigerator-Freezers (Appendix A1 after May...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Refrigerators and Refrigerator-Freezers (Appendix A1 after May 2, 2011) Refrigerators and Refrigerator-Freezers (Appendix A1 after May 2, 2011) The Department of Energy (DOE) ...

  7. Appendix B: Rules and Directives Applicable to Nuclear Facilities...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendix B: Rules and Directives Applicable to Nuclear Facilities Line Management Oversight Appendix B to DOE G 226.1-2A "Federal Line Management Oversight of Department of Energy ...

  8. Montana 2012 Final Water Quality Integrated Report: Appendix...

    Open Energy Info (EERE)

    Appendix A Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Montana 2012 Final Water Quality Integrated Report: Appendix A Abstract Index for impaired...

  9. Microsoft Word - PPPL Section J 9 Appendix I Directives - pso...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0211 Contract No.: DE-AC02-09CH11466 Section J - Appendix I J-I-1 ATTACHMENT J.9 APPENDIX I DOE DIRECTIVES LIST B Applicable to the Operation of PPPL Contract No. ...

  10. FERC Order No. 2003 Appendix 6 - Large Generator Interconnection...

    Open Energy Info (EERE)

    FERC Order No. 2003 Appendix 6 - Large Generator Interconnection Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 6 -...

  11. Appendix D.1 Hanford Sitewide SSHAC Level 3 PSHA Project

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D.1 Hanford Sitewide SSHAC Level 3 PSHA Project March 18, 2014 Hazard Input Document (HID) Final SSC Model 1 Contents Appendix D.1 ...................................................................................................................................... 1 Appendix D.1 ...................................................................................................................................... 2 Description of Seismic Sources

  12. The INL Seismic Risk Assessment Project: Requirements for Addressing DOE

    Office of Environmental Management (EM)

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  13. EERE Program Management Guide - Appendix O | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    O EERE Program Management Guide - Appendix O Appendix O provides a comprehensive list of acronyms for the different EERE programs/program offices, terms, facilities, procedures, and processes discussed throughout the guide. PDF icon pmguide_appendix_o.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Appendix I EERE Program Management Guide - About the Program Management Guide

  14. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC� Operating Guidelines Appendix A B.DOC� PDF icon Operating Guidelines Appendix A B.DOC� More Documents & Publications Operating Guidelines Appendix C D.DOC� 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc� DOE HR Guidebook 12_15_05.DOC�

  15. Final EIS Keystone Pipeline Project Appendix E Pipeline Restrictive Layer

    Energy Savers [EERE]

    E Pipeline Restrictive Layer Areas Crossings Final EIS Keystone Pipeline Project Appendix F Soil Associations along the Keystone Pipeline Project Route Final EIS Keystone Pipeline Project Appendix F Soil Associations along the Keystone Pipeline Project Route Appendix G Public Water Supply Wells Within One Mile of the Proposed Keystone Pipeline Project Centerline (Note: This appendix is Table 3.5-6, taken directly from the Environmental Report for the Keystone Pipeline Project [TransCanada

  16. Microsoft Word - Appendix A_2006_Jun | Department of Energy

    Energy Savers [EERE]

    Appendix A_2006_Jun Microsoft Word - Appendix A_2006_Jun PDF icon Microsoft Word - Appendix A_2006_Jun More Documents & Publications A:\ZAPPENDA1Matrix(FAR)(REVISED).PDF� A:\ZAPPENDA3Matrix(DOEandOther)(REVISED).PDF� CHAPTER 3

  17. EERE Program Management Guide - Appendix C | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    C EERE Program Management Guide - Appendix C Appendix C provides suggested practice for the program progress review (including developing and preparing the review). PDF icon pmguide_appendix_c.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Quick Reference Guide EERE Program Management Guide - Cover and Table of Contents

  18. EERE Program Management Guide - Appendix E | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    E EERE Program Management Guide - Appendix E Appendix E provides information on and a suggested framework for the merit review process. PDF icon pmguide_appendix_e.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 3 EERE Program Management Guide - Chapter 7

  19. EERE Program Management Guide - Appendix K | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    K EERE Program Management Guide - Appendix K Appendix K provides information on the roles, responsibilities, and relationships of program managers, project managers, contracting officers, and contracting officer's representatives. PDF icon pmguide_appendix_k.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q Acquisition Career Management Handbook Change - Revised Contracting Officer's Representative Certification (COR)

  20. EERE Program Management Guide - Appendix P | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    P EERE Program Management Guide - Appendix P Appendix P provides a comprehensive listing of the references used to formulate the different chapters of this guide. PDF icon pmguide_appendix_p.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 1 EERE Program Management Guide - Chapter 8

  1. EERE Program Management Guide - Appendix Q | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Q EERE Program Management Guide - Appendix Q Appendix Q provides a comprehensive glossary of terms used throughout the rest of the PMI guide. PDF icon pmguide_appendix_q.pdf More Documents & Publications EERE Program Management Guide - Appendices A-Q EERE Program Management Guide - Chapter 6 EERE Program Management Guide - Cover and Table of Contents

  2. Appendix J of EERE Peer Review Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    J of EERE Peer Review Guide Appendix J of EERE Peer Review Guide This is a sample PEER Review Evaluation Form to be completed by reviewers after presentations and before leaving the review site. PDF icon Appendix J. Peer Reviewer Project/Program Evaluation Form More Documents & Publications Appendix H of EERE Peer Review Guide

  3. Research Projects Addressing Technical Challenges to Environmentally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acceptable Shale Gas Development Selected by DOE | Department of Energy Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE Research Projects Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE November 28, 2012 - 12:00pm Addthis Washington, DC - Fifteen research projects aimed at addressing the technical challenges of producing natural gas from shales and tight sands, while simultaneously

  4. Recommendations to Address Power Reliability Concerns Raised...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a ...

  5. Energy Department Assistant Secretary Patricia Hoffman Addresses...

    Broader source: Energy.gov (indexed) [DOE]

    for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the ... In addition, whatever local reliability challenges that could arise should be manageable ...

  6. Addressing Challenges of Identifying Geometrically Diverse Sets...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Challenges of Identifying Geometrically Diverse Sets of Crystalline Porous Materials Previous Next List R. L. Martin, B. Smit, and M. Haranczyk, J. Chem Inf. Model. 52...

  7. Appendix B: Rules and Directives Applicable to Nuclear Facilities Line

    Energy Savers [EERE]

    Appendix B of EERE Peer Review Guide Appendix B of EERE Peer Review Guide A checklist designed to help managers identify key actions to be performed to plan, design, implement and follow-up on the peer review process. PDF icon Appendix B: Manager's Checklist for Conducting a Peer Review More Documents & Publications EERE Peer Review Guide EERE Peer Review Guide - August 2004 SOP for Peer Reviews

    B Appendix B Appendix B to DOE's Report to Congress on the Price-Anderson Act, containing

  8. Microsoft Word - Appendix A-H from 2007 Annual Report.doc

    Office of Legacy Management (LM)

    Appendix C, Page 3 Appendix C, Page 4 Appendix C, Page 5 Appendix C, Page 6 Appendix C, Page 7 Appendix C, Page 8 Appendix C, Page 9 Appendix C, Page 10 Appendix C, Page 11 Original Landfill October 2012 Monthly Inspection-Attachment 1 The monthly inspection of the OLF was completed on October 30. The Rocky Flats Site received 1.44 inches of precipitation during the month of October. The cover was dry at the time of the inspection including the majority of the seep locations. The slump in the

  9. Appendix A: Reference case projections

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Appendix A Table A2. World total energy consumption by region and fuel, Reference case, 2011-40 (quadrillion Btu) Region History Projections Average annual percent change, 2012-40 2011 2012 2020 2025 2030 2035 2040 OECD OECD Americas Liquids 45.3 44.6 46.4 46.1 46.0 46.2 46.7 0.2 Natural gas 31.8 32.8 33.9 35.5 37.7 39.5 41.4 0.8 Coal 21.0 18.7 20.3 20.5 20.1 20.0 20.0 0.2 Nuclear 9.4 9.2 9.5 9.4 9.5 9.5 9.7 0.2 Other 13.1 12.9 15.6 16.6 17.5 18.6 20.3 1.6 Total 120.6 118.1 125.7 128.1 130.7

  10. Appendix A: Reference case projections

    U.S. Energy Information Administration (EIA) Indexed Site

    30 Appendix A Table A5. World liquids consumption by region, Reference case, 2011-40 (million barrels per day) Region History Projections Average annual percent change, 2012-40 2011 2012 2020 2025 2030 2035 2040 OECD OECD Americas 23.6 23.2 24.4 24.4 24.3 24.4 24.6 0.2 United States a 18.9 18.5 19.6 19.6 19.4 19.3 19.3 0.2 Canada 2.3 2.4 2.4 2.4 2.4 2.4 2.5 0.2 Mexico and Chile 2.4 2.4 2.4 2.4 2.5 2.7 2.9 0.6 OECD Europe 14.5 14.1 13.7 13.6 13.7 13.8 14.0 0.0 OECD Asia 7.9 8.2 7.7 7.5 7.5 7.5

  11. SECTION J, APPENDIX L - DIVERSITY PLAN GUIDANCE

    National Nuclear Security Administration (NNSA)

    L, Page 1 SECTION J APPENDIX L [Note: The Diversity Plan shall be submitted to the Contracting Officer in accordance with DEAR 970.5226-1] DIVERSITY PLAN GUIDANCE 12/1/10 In accordance with the Contract's Section I Clause entitled "DEAR 970.5226-1, Diversity Plan," this Appendix provides guidance to assist the Contractor in understanding the information being sought by the Department of Energy, National Nuclear Security Administration (DOE/NNSA) for each of the clause's Diversity

  12. Microsoft Word - Appendix G.doc

    Office of Legacy Management (LM)

    1 are included in this appendix. Appendix G, Page 1 RFLMA Contact Record 2011-01 1 of 5 ROCKY FLATS SITE REGULATORY CONTACT RECORD Purpose: Replace Mound Site Plume Treatment System (MSPTS) media and maintain/repair discharge gallery. Contact Record Approval Date: 1/14/11 Site Contact(s)/Affiliation(s): Scott Surovchak, U.S. Department of Energy (DOE); John Boylan, S.M. Stoller (Stoller); Rick DiSalvo, Stoller Regulatory Contact(s)/Affiliation(s): Carl Spreng, Colorado Department of Public

  13. Appendix MASS: Performance Assessment Modeling Assumptions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Appendix MASS-2014 Performance Assessment Modeling Assumptions United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix MASS Table of Contents MASS-1.0 Introduction MASS-2.0 Summary of Changes in Performance Assessment MASS-2.1 FEPs Assessment MASS-2.2 Monitoring MASS-2.3 Experimental Activities MASS-2.3.1 Steel Corrosion Investigations MASS-2.3.2 Waste Shear Strength Investigations MASS-2.3.3

  14. 2015 State of Indian Nations Address

    Broader source: Energy.gov [DOE]

    The President of the National Congress of American Indians will deliver his annual State of the Indian Nations address to Member of Congress, government officials, tribal leaders and citizens, and...

  15. Federal Actions to Address Impacts of Uranium

    Office of Legacy Management (LM)

    Federal Actions to Address Impacts of Uranium Contamination in the Navajo Nation 2014 Page | i TABLE OF CONTENTS Executive Summary ....................................................................................................................... 1 Introduction .................................................................................................................................... 2 Summary of Work Completed 2008-2012

  16. Data summary of municipal solid waste management alternatives. Volume 10, Appendix H: Anaerobic digestion of MSW

    SciTech Connect (OSTI)

    1992-10-01

    While municipal solid waste (MSW) thermoconversion and recycling technologies have been described in Appendices A through E, this appendix addresses the role of bioconversion technologies in handling the organic fraction in MSW and sewage sludge. Much of the organic matter in MSW, consisting mainly of paper, food waste, and yard waste, has potential for conversion, along with sewage sludge, through biochemical processes to methane and carbon dioxide providing a measurable, renewable energy resource potential. The gas produced may be treated for removal of carbon dioxide and water, leaving pipeline quality gas. The process also has the potential for producing a stabilized solid product that may be suitable as a fuel for combustion or used as a compost fertilizer. Anaerobic digestion can occur naturally in an uncontrolled environment such as a landfill, or it can occur in a controlled environment such as a confined vessel. Landfill gas production is discussed in Appendix F. This appendix provides information on the anaerobic digestion process as it has been applied to produce methane from the organic fraction of MSW in enclosed, controlled reactors.

  17. Shared address collectives using counter mechanisms

    DOE Patents [OSTI]

    Blocksome, Michael; Dozsa, Gabor; Gooding, Thomas M; Heidelberger, Philip; Kumar, Sameer; Mamidala, Amith R; Miller, Douglas

    2014-02-18

    A shared address space on a compute node stores data received from a network and data to transmit to the network. The shared address space includes an application buffer that can be directly operated upon by a plurality of processes, for instance, running on different cores on the compute node. A shared counter is used for one or more of signaling arrival of the data across the plurality of processes running on the compute node, signaling completion of an operation performed by one or more of the plurality of processes, obtaining reservation slots by one or more of the plurality of processes, or combinations thereof.

  18. Cheaper Adjoints by Reversing Address Computations

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hascoët, L.; Utke, J.; Naumann, U.

    2008-01-01

    The reverse mode of automatic differentiation is widely used in science and engineering. A severe bottleneck for the performance of the reverse mode, however, is the necessity to recover certain intermediate values of the program in reverse order. Among these values are computed addresses, which traditionally are recovered through forward recomputation and storage in memory. We propose an alternative approach for recovery that uses inverse computation based on dependency information. Address storage constitutes a significant portion of the overall storage requirements. An example illustrates substantial gains that the proposed approach yields, and we show use cases in practical applications.

  19. Appendix B of EERE Peer Review Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendix B of EERE Peer Review Guide Appendix B of EERE Peer Review Guide A checklist designed to help managers identify key actions to be performed to plan, design, implement and follow-up on the peer review process. PDF icon Appendix B: Manager's Checklist for Conducting a Peer Review More Documents & Publications EERE Peer Review Guide EERE Peer Review Guide - August 2004 SOP for Peer Reviews

  20. Appendix G of EERE Peer Review Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    G of EERE Peer Review Guide Appendix G of EERE Peer Review Guide This peer review nondisclosure agreement should be signed by each reviewer prior to the program sending review materials if sensitive or proprietary information will be provided reviewers or discussed during the review, and to everyone attending a review. PDF icon Appendix G. Peer Review Nondisclosure Agreement More Documents & Publications Appendix B of EERE Peer Review Guide SOP for Peer Reviews EERE Peer Review Guide

  1. Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy ...

  2. Financing Innovation to Address Global Climate Change

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy’s Loan Programs Office (LPO) is helping address the global challenge of climate change by providing critical financing needed to deploy some of the world’s largest and most innovative clean energy and advanced technology vehicles manufacturing projects, preventing more than 25 million metric tons of CO2 emissions to date.

  3. Mapping virtual addresses to different physical addresses for value disambiguation for thread memory access requests

    DOE Patents [OSTI]

    Gala, Alan; Ohmacht, Martin

    2014-09-02

    A multiprocessor system includes nodes. Each node includes a data path that includes a core, a TLB, and a first level cache implementing disambiguation. The system also includes at least one second level cache and a main memory. For thread memory access requests, the core uses an address associated with an instruction format of the core. The first level cache uses an address format related to the size of the main memory plus an offset corresponding to hardware thread meta data. The second level cache uses a physical main memory address plus software thread meta data to store the memory access request. The second level cache accesses the main memory using the physical address with neither the offset nor the thread meta data after resolving speculation. In short, this system includes mapping of a virtual address to a different physical addresses for value disambiguation for different threads.

  4. Appendix S-50 - Power Purchase Agreement (PPA) - Public Utilities...

    Open Energy Info (EERE)

    "http:en.openei.orgwindex.php?titleAppendixS-50-PowerPurchaseAgreement(PPA)-PublicUtilitiesCommission&oldid800827" Feedback Contact needs updating Image needs...

  5. Appendix S-51 - Transmission Line Approval - Public Utilities...

    Open Energy Info (EERE)

    from "http:en.openei.orgwindex.php?titleAppendixS-51-TransmissionLineApproval-PublicUtilitiesCommission&oldid800735" Feedback Contact needs updating Image needs...

  6. FERC Order No. 2003 Appendix 5 - Optional Interconnection Study...

    Open Energy Info (EERE)

    5 - Optional Interconnection Study Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 5 - Optional Interconnection...

  7. Microsoft Word - Section J Appendix A MOd 0192

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Section J, Appendix A J-A-1 ATTACHMENT J.1 APPENDIX A ADVANCE UNDERSTANDINGS ON HUMAN RESOURCES Applicable to the Operation of AMES Laboratory Contract No. DE-AC02-07CH11358 Contract No. DE-AC02-07CH11358 Contract Modification No. 0192 Section J, Appendix A J-A-2 Table of Contents Appendix A AMES LABORATORY ADVANCE UNDERSTANDINGS ON HUMAN RESOURCES I. INTRODUCTION J-A-3 II. HUMAN RESOURCES STRATEGY, BUSINESS PLANNING AND PERFORMANCE MANAGEMENT J-A-4 III. COMPENSATION J-A-4 IV. ANCILLARY PAY

  8. Impact of Utility Rates on PV Economics - Digital Appendix |...

    Open Energy Info (EERE)

    for The Impacts of Utility Rates and Building Type on the Economics of Commercial Photovoltaic Systems. This digital appendix contains supplement material for the NREL technical...

  9. Hawaii Variance from Pollution Control Permit Packet (Appendix...

    Open Energy Info (EERE)

    Variance from Pollution Control Permit Packet (Appendix S-13) Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - Supplemental...

  10. Appendix DATA Attachment B: WIPP Waste Containers and Emplacement

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Carlsbad, New Mexico Appendix DATA-2014 Attachment B: WIPP Waste Containers and Emplacement Table of Contents DATA-B-1.0 Authorized Waste Emplacement ...

  11. SEP Special Projects Report: Future Outlook and Appendix

    SciTech Connect (OSTI)

    None

    2000-07-01

    The Sharing Success appendix provides the future outlook for SEP as well as charts and graphs for grants and Special Projects.

  12. Appendix C: Map of NEMS Electricity Market Module Regions

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    U.S. Energy Information Administration | Analysis of Impacts of a Clean Energy Standard as requested by Chairman Bingaman Appendix C: Map of NEMS Electricity Market Module Regions...

  13. AppendixI_SRG _staff_

    Office of Environmental Management (EM)

    I State Fees I. Introduction Twenty-eight 1 states levy some type of fee on shipments of radioactive material in order to fund services such as preparing emergency responders and inspecting radioactive materials shipments. The fees range from twenty-five dollars to forty-five hundred dollars for the initial rail cask. The question for the Department of Energy is how should DOE handle state fees in the context of the Section 180(c) program. The 1998 Draft Policy on Section 180(c) did not address

  14. Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session. The meeting will be livestreamed at energy.gov/live

  15. FirstNet East Region Appendix E

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    E This page intentionally left blank First Responder Network Authority Nationwide Public Safety Broadband Network Draft Programmatic Environmental Impact Statement for the Eastern United States VOLUME 15 - APPENDIX E Amanda Goebel Pereira, AICP NEPA Coordinator First Responder Network Authority U.S. Department of Commerce 12201 Sunrise Valley Dr. M/S 243 Reston, VA 20192 Cooperating Agencies Federal Communications Commission General Services Administration U.S. Department of Agriculture-Rural

  16. EERE Program Management Guide - Appendix O

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    O List of Acronyms Note: This appendix provides a comprehensive list of acronyms for the different EERE programs/program offices, terms, facilities, procedures, and processes discussed throughout the guide. List of Acronyms: AFP Approved Funding Program AOP Annual Operating Plan ASEE Assistant Secretary for EERE B&R Budget & Reporting [code of] BA Business Administration (Office of) BBS Broad-Base Solicitation BES Basic Energy Sciences BESAC Basic Energy Sciences Advisory Committee BOD

  17. Appendix B - GPRA06 biomass program documentation

    SciTech Connect (OSTI)

    None, None

    2009-01-18

    This appendix discusses the assumptions and methods employed in the biomass benefits analysis that is part of the fiscal year 2006 GPRA benefits analysis for all of the Department of Energys Energy Efficiency and Renewable Energy (EERE) research and deployment programs. The biomass benefits analysis focuses on the benefits of future achievements by the program and excludes retrospective benefits and benefits resulting from industrys own initiative and funding.

  18. Appendix C-3, Intellectual Property Provisions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    APPENDIX C - 3 Intellectual Property Provisions For Large and Small Business, Nonprofit Organizations, Educational Institutions, and Others (Non Research and Development) The Subcontractor is hereby placed on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department of Energy Contract No. DE-AC36-08GO28308. All references to

  19. Appendix IGP: Individual and Groundwater Protection Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    IGP-2014 Individual and Groundwater Protection Requirements United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix IGP-2014 Individual and Groundwater Protection Requirements Table of Contents IGP-1.0 Introduction IGP-2.0 Individual Protection Requirements IGP-2.1 Compliance Assessment of Undisturbed Performance IGP-2.2 Dose Calculation IGP-2.2.1 Transport Pathway IGP-2.2.2 Bounding Analysis

  20. Appendix SOTERM: Actinide Chemistry Source Term

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SOTERM-2014 Actinide Chemistry Source Term United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix SOTERM-2014 Actinide Chemistry Source Term Table of Contents SOTERM-1.0 Introduction SOTERM-2.0 Expected WIPP Repository Conditions, Chemistry, and Processes SOTERM-2.1 Ambient Geochemical Conditions SOTERM-2.2 Repository Conditions SOTERM-2.2.1 Repository Pressure SOTERM-2.2.2 Repository

  1. Multithreaded Global Address Space Communication Techniques

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Multithreaded Global Address Space Communication Techniques for Gyrokinetic Fusion Applications on Ultra-Scale Platforms Robert Preissl Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 rpreissl@lbl.gov Nathan Wichmann CRAY Inc. St. Paul, MN, USA, 55101 wichmann@cray.com Bill Long CRAY Inc. St. Paul, MN, USA, 55101 longb@cray.com John Shalf Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 jshalf@lbl.gov Stephane Ethier Princeton Plasma Physics Laboratory Princeton, NJ,

  2. Global-Address Space Networking (GASNet) Library

    Energy Science and Technology Software Center (OSTI)

    2011-04-06

    GASNet (Global-Address Space Networking) is a language-independent, low-level networking layer that provides network-independent, high-performance communication primitives tailored for implementing parallel global address space SPMD languages such as UPC and Titanium. The interface is primarily intended as a compilation target and for use by runtime library writers (as opposed to end users), and the primary goals are high performance, interface portability, and expressiveness. GASNet is designed specifically to support high-performance, portable implementations of global address spacemore » languages on modern high-end communication networks. The interface provides the flexibility and extensibility required to express a wide variety of communication patterns without sacrificing performance by imposing large computational overheads in the interface. The design of the GASNet interface is partitioned into two layers to maximize porting ease without sacrificing performance: the lower level is a narrow but very general interface called the GASNet core API - the design is basedheavily on Active Messages, and is implemented directly on top of each individual network architecture. The upper level is a wider and more expressive interface called GASNet extended API, which provides high-level operations such as remote memory access and various collective operations. This release implements GASNet over MPI, the Quadrics "elan" API, the Myrinet "GM" API and the "LAPI" interface to the IBM SP switch. A template is provided for adding support for additional network interfaces.« less

  3. Microsoft Word - SECTION_J_Appendix_B_Special_Financial_Ins_Agreement Contract.doc

    Energy Savers [EERE]

    J-B-1 SECTION J APPENDIX B SPECIAL FINANCIAL INSTITUTION ACCOUNT AGREEMENT

  4. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  5. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  6. Framework for Address Cooperative Extended Transactions

    Energy Science and Technology Software Center (OSTI)

    1997-12-01

    The Framework for Addressing Cooperative Extended Transactions (FACET) is an object-oriented software framework for building models of complex, cooperative behaviors of agents. it can be used to implement simulation models of societal processes such as the complex interplay of participating individuals and organizations engaged in multiple concurrent transactions in pursuit of their various goals. These transactions can be patterned on, for example, clinical guidelines and procedures, business practices, government and corporate policies, etc. FACET canmore » also address other complex behaviors such as biological life cycles or manufacturing processes. FACET includes generic software objects representing the fundamental classes of agent -- Person and Organization - with mechanisms for resource management, including resolution of conflicting requests for participation and/or use of the agent's resources. The FACET infrastructure supports stochastic behavioral elements and coping mechanisms by which specified special conditions and events can cause an active cooperative process to be preempted, diverting the participants onto appropriate alternative behavioral pathways.« less

  7. OLNG and WEP DEIS Appendix J - WEP Mitigation and Monitoring Plans

    Energy Savers [EERE]

    J WEP MITIGATION AND MONITORING PLANS Appendix J1: Washington Expansion Project Erosion Control and Revegetation Plan Appendix J2: Draft Unanticipated Discovery of Contamination Plan Appendix J3: Washington Expansion Project Water Quality Monitoring Plan Appendix J4: Horizontal Directional Drilling Monitoring and Contingency Plan APPENDIX J1: WASHINGTON EXPANSION PROJECT EROSION CONTROL AND REVEGETATION PLAN Washington Expansion Project Erosion Control and Revegetation Plan May 2014 Prepared by

  8. Revenue Requirements Modeling System (RRMS) documentation. Volume I. Methodology description and user's guide. Appendix A: model abstract; Appendix B: technical appendix; Appendix C: sample input and output. [Compustat

    SciTech Connect (OSTI)

    Not Available

    1986-03-01

    The Revenue Requirements Modeling System (RRMS) is a utility specific financial modeling system used by the Energy Information Administration (EIA) to evaluate the impact on electric utilities of changes in the regulatory, economic, and tax environments. Included in the RRMS is a power plant life-cycle revenue requirements model designed to assess the comparative economic advantage of alternative generating plant. This report is Volume I of a 2-volume set and provides a methodology description and user's guide, a model abstract and technical appendix, and sample input and output for the models. Volume II provides an operator's manual and a program maintenance guide.

  9. Annual Energy Outlook 2015 - Appendix F

    Gasoline and Diesel Fuel Update (EIA)

    1 U.S. Energy Information Administration | Annual Energy Outlook 2015 Source: U.S. Energy Information Administration, Office of Energy Analysis. U.S. Energy Information Administration / Annual Energy Outlook 2010 213 Appendix F Regional Maps Figure F1. United States Census Divisions Pacific South Atlantic Middle Atlantic New England West South Central West North Central East North Central Mountain AK WA MT WY ID NV UT CO AZ NM TX OK IA KS MO IL IN KY TN MS AL FL GA SC NC WV PA NJ MD DE NY CT VT

  10. Appendix B Ground Water Management Policy

    Office of Legacy Management (LM)

    Ground Water Management Policy for the Monticello Mill Tailings Site and Adjacent Areas This page intentionally left blank Docun~ent Number Q0029500 Appendix B State of Utah DEPARTblENT OF NATURAL RESOURCES DIVISION OF WATER RIGHTS Ground-Water Management Policy for the Mot~ticello Mill Tailings Site and Adjacent Areas The Monticello Mill Tailings Site is on the southeast portion of the tovm of Monticello in Sectton 36, T33S, K23E and Section 31, i33S. R24E, SLB&M. The mill site was used

  11. Appendix F Stream Flow.xls

    Office of Legacy Management (LM)

    Stream Flow Measurement Results Since 2000 This page intentionally left blank Appendix F Stream Flow Measurement Results Since 2000 Collect Date Surface ID Calculated Flow (ft 3 /sec) Comments 1/14/2000 CARB POND TRENCH OUT 0.25 Carb Pond trench outfall 1/14/2000 MNT CR E OF HWY CULV 0.22 MONTEZUMA CREEK 100 FT EAST OF HIGHWAY CULVERT 1/14/2000 MC>CUTOFFTRENCH CLAY 0.19 Montezuma Creek above ground water cutoff trench, clay bottom. 4/14/2000 MIDPOND OUTFALL PIPE 0.26 Middle Pond outfall pipe

  12. Appendix DATA Attachment A: WIPP Borehole Update

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A: WIPP Borehole Update United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Appendix DATA-2014 Attachment A: WIPP Borehole Update Table of Contents DATA-A-1.0 WIPP Boreholes DATA-A-2.0 Individual Well Reports DATA-A-2.1 New Wells Drilled Since the CRA-2009 DATA-A-2.2 Plugged Wells DATA-A-3.0 References List of Tables Table DATA-A- 1. Status of WIPP Boreholes December 2012 WIPP Table DATA-A-1. Status of WIPP Boreholes December 2012 WIPP

  13. Appendix DATA: Monitoring Data and Reports

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Monitoring Data and Reports United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix DATA-2014 Table of Contents DATA-1.0 Introduction DATA-1.1 Reported Data DATA-2.0 Delaware Basin Drilling Surveillance Program DATA-2.1 Program Overview DATA-2.2 Reported Data DATA-3.0 Subsidence Monitoring Program DATA-3.1 Program Overview DATA-3.2 Reported Data DATA-4.0 Geotechnical Monitoring Program DATA-4.1

  14. Appendix E: Standard Terms and Conditions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E STANDARD TERMS AND CONDITIONS FOR TRAVEL REQUIREMENTS August 5, 2010 Subcontractor is hereby placed on notice that the contracting party to this subcontract is the Alliance for Sustainable Energy, LLC, in its capacity as the Managing and Operating Contractor for the National Renewable Energy Laboratory (NREL) under U.S. Department of Energy Contract No. DE-AC36-08GO28308. All references to "NREL" in this subcontract shall mean the Alliance for Sustainable Energy, LLC. NREL Appendix E

  15. Protocol for Addressing Induced Seismicity Associated with Enhanced...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems (EGS) Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems...

  16. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the...

  17. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of ...

  18. Addressing Uncertainties in Design Inputs: A Case Study of Probabilist...

    Office of Environmental Management (EM)

    Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF Addressing Uncertainties in Design Inputs: A Case...

  19. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy ...

  20. Opportunities for Building America Research to Address Energy...

    Energy Savers [EERE]

    Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address...

  1. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change...

  2. Energy Department Addresses Largest Gathering of Geothermal Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Largest Gathering of Geothermal Energy Stakeholders Energy Department Addresses Largest Gathering of Geothermal Energy Stakeholders October 4, 2012 - 1:00pm Addthis Photo ...

  3. DOE Convenes Multi-stakeholder Process to Address Privacy for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by Smart Grid Technologies DOE Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by ...

  4. Strategies to Address Split Incentives in Multifamily Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily Low-Income Peer Exchange Call: Strategies to Address Split ...

  5. Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen...

    Open Energy Info (EERE)

    Agenda for Addressing Climate Change in Bangladesh: Copenhagen and Beyond Jump to: navigation, search Name Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen and...

  6. Indonesia National Action Plan Addressing Climate Change | Open...

    Open Energy Info (EERE)

    National Action Plan Addressing Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Indonesia National Action Plan Addressing Climate Change AgencyCompany...

  7. New partnership uses advanced computer science modeling to address...

    National Nuclear Security Administration (NNSA)

    computer science modeling to address climate change | National Nuclear Security ... New partnership uses advanced computer science modeling to address climate change Several ...

  8. NBP RFI-Addressing Policy and Logistical Challenges to Smart...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid ...

  9. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: ...

  10. New York Independent System Operator, Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. New York Independent System Operator, Smart Grid RFI: Addressing Policy and ...

  11. Response to Request for Information titled "Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and ...

  12. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American ...

  13. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical ...

  14. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation ...

  15. Progress Energy draft regarding Smart Grid RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical ...

  16. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. ...

  17. Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges ...

  18. Assistant Secretary Patricia Hoffman to Deliver Keynote Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Patricia Hoffman to Deliver Keynote Address at IEEE PES Conference on Innovative Smart Grid Technologies Assistant Secretary Patricia Hoffman to Deliver Keynote Address at IEEE PES ...

  19. Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District Smart Grid RFI: Addressing Policy and ...

  20. DOE Action Plan Addressing the Electricity Transmission System

    Broader source: Energy.gov (indexed) [DOE]

    U.S. DEPARTMENT OF ENERGY ACTION PLAN ADDRESSING THE ELECTRICITY TRANSMISSION SYSTEM DRAFT DOE Action Plan Addressing the Electricity Transmission System 1 Table of Contents * ...

  1. U.S. Leads International Collaborative to Address Wind Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife Challenges U.S. Leads International Collaborative to Address Wind Energy DevelopmentWildlife ...

  2. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials 2013 DOE ...

  3. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. ...

  4. Addressable morphology control of silica structures by manipulating...

    Office of Scientific and Technical Information (OSTI)

    Addressable morphology control of silica structures by manipulating the reagent addition time Citation Details In-Document Search Title: Addressable morphology control of silica ...

  5. Data summary of municipal solid waste management alternatives. Volume 8, Appendix F, Landfills

    SciTech Connect (OSTI)

    1992-10-01

    While the preceding appendices have focused on the thermochemical approaches to managing municipal solid waste (MSW), this appendix and those that follow on composting and anaerobic digestion address more of the bioconversion process technologies. Landfilling is the historical baseline MSW management option central to every community`s solid waste management plan. It generally encompasses shredfills, balefills, landfill gas recovery, and landfill mining. While landfilling is virtually universal in use, it continues to undergo intense scrutiny by the public and regulators alike. Most recently, the US Environmental Protection Agency (EPA) issued its final rule on criteria for designing, operating, monitoring, and closing municipal solid waste landfills. While the Federal government has established nationwide standards and will assist the States in planning and developing their own practices, the States and local governments will carry out the actual planning and direct implementation. The States will also be authorized to devise programs to deal with their specific conditions and needs. While the main body of this appendix and corresponding research was originally prepared in July of 1991, references to the new RCRA Subtitle D, Part 258 EPA regulations have been included in this resubmission (908). By virtue of timing, this appendix is, necessarily, a ``transition`` document, combining basic landfill design and operation information as well as reference to new regulatory requirements. Given the speed with which landfill practices are and will be changing, the reader is encouraged to refer to Part 258 for additional details. As States set additional requirements and schedules and owners and operators of MSW landfills seek to comply, additional guidance and technical information, including case studies, will likely become available in the literature.

  6. Data Summary of Municipal Solid Waste Management Alternatives. Volume VIII: Appendix F - Landfills

    SciTech Connect (OSTI)

    1992-10-01

    While the preceding appendices have focused on the thermochemical approaches to managing municipal solid waste (MSW), this appendix and those that follow on composting and anaerobic digestion address more of the bioconversion process technologies. Landfilling is the historical baseline MSW management option central to every community's solid waste management plan. It generally encompasses shredfills, balefills, landfill gas recovery, and landfill mining. While landfilling is virtually universal in use, it continues to undergo intense scrutiny by the public and regulators alike. Most recently, the US Environmental Protection Agency (EPA) issued its final rule on criteria for designing, operating, monitoring, and closing municipal solid waste landfills. While the Federal government has established nationwide standards and will assist the States in planning and developing their own practices, the States and local governments will carry out the actual planning and direct implementation. The States will also be authorized to devise programs to deal with their specific conditions and needs. While the main body of this appendix and corresponding research was originally prepared in July of 1991, references to the new RCRA Subtitle D, Part 258 EPA regulations have been included in this resubmission (908). By virtue of timing, this appendix is, necessarily, a transition'' document, combining basic landfill design and operation information as well as reference to new regulatory requirements. Given the speed with which landfill practices are and will be changing, the reader is encouraged to refer to Part 258 for additional details. As States set additional requirements and schedules and owners and operators of MSW landfills seek to comply, additional guidance and technical information, including case studies, will likely become available in the literature.

  7. Final Report on Internet Addressable Lightswitch

    SciTech Connect (OSTI)

    Rubinstein, Francis; Pettler, Peter

    2001-08-27

    This report describes the work performed to develop and test a new switching system and communications network that is useful for economically switching lighting circuits in existing commercial buildings. The first section of the report provides the general background of the IBECS (Integrated Building Environmental Communications System) research and development work as well as the context for the development of the new switching system. The research and development effort that went into producing the first proof-of-concept (the IBECS Addressable Power Switch or APS) and the physical prototype of that concept is detailed in the second section. In the third section of the report, we detail the refined Powerline Carrier Based IBECS Title 24 Wall Switch system that evolved from the APS prototype. The refined system provided a path for installing IBECS switching technology in existing buildings that may not be already wired for light level switching control. The final section of the report describes the performance of the IBECS Title 24 Switch system as applied to a small demonstration in two offices at LBNL's Building 90. We learned that the new Powerline Carrier control systems (A-10 technology) that have evolved from the early X-10 systems have solved most of the noise problems that dogged the successful application of X-10 technologies in commercial buildings. We found that the new A-10 powerline carrier control technology can be reliable and effective for switching lighting circuits even in electrically noisy office environments like LBNL. Thus we successfully completed the task objectives by designing, building and demonstrating a new switching system that can provide multiple levels of light which can be triggered either from specially designed wall switches or from a digital communications network. By applying commercially available powerline carrier based technologies that communicate over the in-place lighting wiring system, this type of control can be economi cally installed even in existing buildings that were not wired for dual-level lighting.

  8. Keynote Address: Ali Zaidi, the White House Domestic Policy Council

    Broader source: Energy.gov [DOE]

    Keynote address by Ali Zaidi, Deputy Director for Energy Policy, the White House Domestic Policy Council.

  9. FERC Order No. 2003 Appendix 2 - Feasibility Study Agreement...

    Open Energy Info (EERE)

    2 - Feasibility Study Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 2 - Feasibility Study Agreement Abstract FERC...

  10. Appendix TFIELD Attachment A: Attachment A: TFIELD-2014 Visualization

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    input and output data is summarized in Appendix TFIELD-2014 and discussed in detail in Hart et al. (2009). Hart, D.B., Beauheim, R.L. and McKenna, S.A. 2009. Analysis Report for...

  11. Appendix A. Notice of Inquiry: Preparation of Report to Congress...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal ...

  12. EERE Guide for Managing General Program Evaluation Studies-- Appendix 11

    Broader source: Energy.gov [DOE]

    The American Evaluation Association developed the ethical principles in this Appendix to guide the professional practice of evaluators. EERE expects evaluation experts who perform general program evaluations of its programs to be governed by these principles.

  13. Appendix A: Office Technology Pathway Structure, Bioenergy Technologie...

    Broader source: Energy.gov (indexed) [DOE]

    A-1 Last updated: November 2014 Appendix A: Technology Pathway Structure High-level block flow diagrams for each biorefinery pathway are presented in Figures A-1 through A-5....

  14. FERC Order No. 2003 Appendix 4 - Facilities Study Agreement ...

    Open Energy Info (EERE)

    4 - Facilities Study Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 4 - Facilities Study Agreement Abstract FERC...

  15. Appendix C: Transmission, Ancillary and Control Area Service...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ADMINISTRATOR'S FINAL RECORD OF DECISION Appendix C: Transmission, Ancillary and Control Area Service Rate Schedules BP-16-A-02-AP03 July 2015 BP-16-A-02-AP03 Page i...

  16. Barriers to Industrial Energy Efficiency - Study (Appendix A), June 2015 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Industrial Energy Efficiency - Study (Appendix A), June 2015 Barriers to Industrial Energy Efficiency - Study (Appendix A), June 2015 This study examines barriers that impede the adoption of energy efficient technologies and practices in the industrial sector, and identifies successful examples and opportunities to overcome these barriers. Three groups of energy efficiency technologies and measures were examined: industrial end-use energy efficiency, industrial demand

  17. Appendix N of EERE Peer Review Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    N of EERE Peer Review Guide Appendix N of EERE Peer Review Guide A sample peer review tracking document, identifying action items, relevant reviewer comments, action owners, and progress to date. PDF icon Appendix N. Peer Review Response Tracking More Documents & Publications Bioenergy Technologies Office Multi-Year Program Plan: November 2014 Update -- Sections Bioenergy Technologies Office Multi-Year Program Plan: July 2014 Update Bioenergy Technologies Office Multi-Year Program Plan: July

  18. Microsoft Word - SEC J_Appendix G - RESERVED - Governance

    National Nuclear Security Administration (NNSA)

    G, Page i SECTION J APPENDIX G RESERVED - GOVERNANCE [Note: Governance is in Draft form and not yet NNSA approved. Once approved it will be incorporated into the Contract at this Appendix.] Re-Forming Relationships: A Guide to Transformational Governance and Oversight National Nuclear Security Administration U.S. Department of Energy Washington, D.C. 20585 DE-NA000622 Re-Forming Relationships: A Guide to Transformational Governance and Oversight 2-

  19. Feasibility study on Thailand LNG project. Final report. Volume 2. Appendix. Export trade information

    SciTech Connect (OSTI)

    1995-08-01

    This study, conducted by Bechtel, was funded by the U.S. Trade and Development Agency. The report specifically addresses an LNG terminal and associated gas pipeline, the crude oil pipeline component of the Southern Seaboard project, in addition to a power plant which uses a portion of the gas. Volume II contains the Appendix and is divided into the following sections: (1.0) PTT Data; (2.0) Design Criteria; (3.0) Khao Bo Ya Soils Data; (4.0) Khao Bo Ya Oceanographic Data; (5.0) Thailand Seismic Data; (6.0) Risk Assessment; (7.0) Equipment Lists; (8.0) Equipment Data Sheets; (9.0) Drawings; (10.0) Cost Data; (11.0) Calculations; (12.0) Terms of Reference.

  20. Columbia River System Operation Review : Final Environmental Impact Statement, Appendix N: Wildlife.

    SciTech Connect (OSTI)

    Columbia River System Operation Review

    1995-11-01

    The Columbia River System is a vast and complex combination of Federal and non-Federal facilities used for many purposes including power production, irrigation, navigation, flood control, recreation, fish and wildlife habitat and municipal and industrial water supply. Each river use competes for the limited water resources in the Columbia River Basin. This technical appendix addresses only the effects of alternative system operating strategies for managing the Columbia River system. The environmental impact statement (EIS) itself and some of the other appendices present analyses of the alternative approaches to the other three decisions considered as part of the SOR. This document is the product of the Wildlife Work Group, focusing on wildlife impacts but not including fishes. Topics covered include the following: scope and process; existing and affected environment, including specific discussion of 18 projects in the Columbia river basin. Analysis, evaluation, and alternatives are presented for all projects. System wide impacts to wildlife are also included.

  1. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  2. Request for Proposal No. DE-SOL-XXXXXX Section J, Appendix A, Page i

    National Nuclear Security Administration (NNSA)

    XXXXXX Section J, Appendix A, Page i SECTION J, APPENDIX A: STATEMENT OF WORK TABLE OF CONTENTS CHAPTER I. OBJECTIVES, SCOPE, AND REQUIREMENTS ......................................................................... 1 1.0 OBJECTIVE .................................................................................................................................................. 1 2.0 BACKGROUND

  3. Request for Proposal NO. DE-SOL-0008418 Section J, Appendix K...

    National Nuclear Security Administration (NNSA)

    NO. DE-SOL-0008418 Section J, Appendix K, Page 1 SECTION J APPENDIX K PROGRAM MANAGEMENT AND COST REPORTS The Contractor shall submit periodic cost, schedule, and technical...

  4. Request for Proposal No. DE-SOL-0008418 Section J, Appendix G, Page i

    National Nuclear Security Administration (NNSA)

    G, Page i SECTION J APPENDIX G PERSONNEL APPENDIX TABLE OF CONTENTS 1.0 Introduction .......................................................................................................................... 1 2.0 Definitions............................................................................................................................ 2 3.0 Compensation ...................................................................................................................... 2 3.1

  5. 2014 SunShot Initiative Portfolio Book: Appendix of SunShot Funding...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendix of SunShot Funding Programs 2014 SunShot Initiative Portfolio Book: Appendix of SunShot Funding Programs The 2014 SunShot Initiative Portfolio Book outlines the progress ...

  6. Appendix of Supporting Information for the 21st Century Truck Technology Partnership

    SciTech Connect (OSTI)

    2009-01-18

    Appendix contains supporting information to the 21st Century Truck Partnership's Roadmap and Technical White Papers (21CTP-003)

  7. IMPACTS: Industrial Technologies Program, Summary of Program Results for CY2009, Appendix 2: ITP Emerging Technologies

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    127 DOE Industrial Technologies Program Appendix 2: ITP Emerging Technologies Aluminum ............................................................................................................................................................................ 130 u Direct Chill Casting Model ................................................................................................................................................................130

  8. Technology Plan to Address the EM Mercury Challenge

    Broader source: Energy.gov [DOE]

    EM’s Technology Plan to Address the EM Mercury Challenge addresses mercury contamination, and advocates for research and technology development to resolve key technical uncertainties with the pollutant in environmental remediation, facility deactivation and decommissioning, and tank waste processing.

  9. Moving Forward to Address Nuclear Waste Storage and Disposal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Moving Forward to Address Nuclear Waste Storage and Disposal Moving Forward to Address Nuclear Waste Storage and Disposal March 24, 2015 - 2:15pm Addthis Three trucks transport ...

  10. Keynote Address: Billy Parish of Mosaic | Department of Energy

    Office of Environmental Management (EM)

    Billy Parish of Mosaic Keynote Address: Billy Parish of Mosaic May 20, 2014 3:00PM to 3:30PM PDT Pacific Ballroom Billy Parish, President and Founder of Mosaic, will address Summit attendees

  11. Method for the electro-addressable functionalization of electrode arrays

    Office of Scientific and Technical Information (OSTI)

    (Patent) | SciTech Connect Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of electrode arrays A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable

  12. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges. Pepco Holdings, Inc. (PHI) is pleased to respond to the US Department of Energy (DOE) request for information regarding addressing policy and logistical challenges to smart grid implementation. This follows on the heels of

  13. Progress Energy draft regarding Smart Grid RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges | Department of Energy Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges PDF icon Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges More Documents & Publications Comments of DRSG to DOE Smart Grid RFI:

  14. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges. Southern recognizes that many policy and logistical concerns must be addressed for the promises of smart grid technologies and applications to be fully realized in ways that are beneficial, secure, and cost-effective

  15. Keynote Address: Update on Environmental Management | Department of Energy

    Energy Savers [EERE]

    Address: Update on Environmental Management Keynote Address: Update on Environmental Management Keynote presentation made by David G. Huizenga for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY. PDF icon Keynote Address: Update on Environmental Management More Documents & Publications Chairs Meeting - November 2013 Chairs Meeting - April 2014 Chairs Meeting - April 2013

  16. Individually addressable cathodes with integrated focusing stack or detectors

    DOE Patents [OSTI]

    Thomas, Clarence E.; Baylor, Larry R.; Voelkl, Edgar; Simpson, Michael L.; Paulus, Michael J.; Lowndes, Douglas; Whealton, John; Whitson, John C.; Wilgen, John B.

    2005-07-12

    Systems and method are described for addressable field emission array (AFEA) chips. A plurality of individually addressable cathodes are integrated with an electrostatic focusing stack and/or a plurality of detectors on the addressable field emission array. The systems and methods provide advantages including the avoidance of space-charge blow-up.

  17. Addressing Barriers to Upgrade Projects at Affordable Multifamily

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Properties (201) | Department of Energy Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201) Better Buildings Residential Network Peer Exchange Call Series: Addressing Barriers to Upgrade Projects at Affordable Multifamily Properties (201), call slides and discussion summary. PDF icon Call Slides and Discussion Summary More Documents & Publications Incorporating Energy

  18. Addressing Climate Change with Next Generation Energy Storage Technology -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joint Center for Energy Storage Research March 19, 2015, Videos Addressing Climate Change with Next Generation Energy Storage Technology George Crabtree gives keynote at Loyola University In March 2015, George Crabtree gave the keynote address, "Addressing Climate Change with Next Generation Energy Storage Technology" at the Institute of Environmental Sustainability Climate Change Conference at Loyola University

  19. Department of Energy Programmatic Spent Nuclear Fuel Management and Idaho National Engineering Laboratory Environmental Restoration and Waste Management Programs, Draft Environmental Impact Statement. Volume 1, Appendix D: Part A, Naval Spent Nuclear Fuel Management

    SciTech Connect (OSTI)

    Not Available

    1994-06-01

    Volume 1 to the Department of Energy`s Programmatic Spent Nuclear Fuel Management and Idaho National Engineering Laboratory Environmental Management Programs Environmental Impact Statement evaluates a range of alternatives for managing naval spent nuclear fuel expected to be removed from US Navy nuclear-powered vessels and prototype reactors through the year 2035. The Environmental Impact Statement (EIS) considers a range of alternatives for examining and storing naval spent nuclear fuel, including alternatives that terminate examination and involve storage close to the refueling or defueling site. The EIS covers the potential environmental impacts of each alternative, as well as cost impacts and impacts to the Naval Nuclear Propulsion Program mission. This Appendix covers aspects of the alternatives that involve managing naval spent nuclear fuel at four naval shipyards and the Naval Nuclear Propulsion Program Kesselring Site in West Milton, New York. This Appendix also covers the impacts of alternatives that involve examining naval spent nuclear fuel at the Expended Core Facility in Idaho and the potential impacts of constructing and operating an inspection facility at any of the Department of Energy (DOE) facilities considered in the EIS. This Appendix also considers the impacts of the alternative involving limited spent nuclear fuel examinations at Puget Sound Naval Shipyard. This Appendix does not address the impacts associated with storing naval spent nuclear fuel after it has been inspected and transferred to DOE facilities. These impacts are addressed in separate appendices for each DOE site.

  20. Microsoft Word - Attachment J.9, Appendix I Directives

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Part III, Section J, Appendix I J-I-1 ATTACHMENT J.9 APPENDIX I DOE DIRECTIVES/LIST B Applicable to the Operation of AMES Laboratory Contract No. DE-AC02-07CH11358 Contract No. DE-AC02-07CH11358 Contract Modification No. 0192 Part III, Section J, Appendix I NUMBER DATE TITLE J-I-2 O 130.1 09/29/95 Budget Formulation Process O 142.3A 10/14/10 Unclassified Foreign Visits and Assignments Program O 150.1A 03/31/14 Continuity Programs O 151.1C 11/02/05 Comprehensive Emergency Management System O

  1. Information Resources Management Strategic Plan Appendix FY2014-2018

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Plan Appendix FY2014-2018 IRM 2 U.S. Department of Energy FY 2014-2018 doe irm strategic plan Appendix: Strategic Planning Process The FY 2014-2018 Department of Energy (DOE) Information Resources Management (IRM) Strategic Plan creates a cohesive connection among more than 15 Federal, DOE, and Office of the Chief Information Officer (OCIO) strategic documents that provide guidance to the Department on issues related to information and IT. Guidance Documents for the FY 2014-2018 DOE IRM

  2. Appendix F of EERE Peer Review Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    F of EERE Peer Review Guide Appendix F of EERE Peer Review Guide Conflict of interest policy and agreement recognize that 1) expert reviewers of in-progress programs do not make funding decisions, and 2) programs must often balanced perceived conflict of interest & need expert advice from small community of experts. PDF icon Appendix F. DOE/EERE Conflict-of-Interest Policy and Form More Documents & Publications SOP for Peer Reviews EERE Peer Review Guide EERE Peer Review Guide - August

  3. Bush Administration Plays Leading Role in Studying and Addressing Global

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change | Department of Energy Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change February 27, 2007 - 3:49pm Addthis Washington, DC - Continuing to take the lead in addressing global climate change, Energy Secretary Samuel Bodman, Environmental Protection Agency (EPA) Administrator Stephen Johnson, and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice

  4. U.S. Leads International Collaborative to Address Wind Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development/Wildlife Challenges | Department of Energy U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges May 18, 2015 - 5:46pm Addthis The U.S. Department of Energy (DOE) is leading a new International Energy Agency (IEA) Wind Task to address concerns about the environmental effects of wind energy technology. Task 34, also known as WREN (Working together

  5. Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Across U.S. Industry | Department of Energy Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry PDF icon eip_report_pg9.pdf More Documents & Publications ITP Energy Intensive Processes: Energy-Intensive Processes Portfolio: Addressing Key Energy Challenges Across U.S. Industry Energy Technology Solutions Energy Technology Solutions: Public-Private

  6. Opportunities for Building America Research to Address Energy Upgrade

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Challenges: HVAC, Envelope and IAQ (301) | Department of Energy Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Better Buildings Residential Network Peer Exchange Call Series: Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ

  7. DOE Seeks Input On Addressing Contractor Pension and Medical Benefits

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Liabilities | Department of Energy Input On Addressing Contractor Pension and Medical Benefits Liabilities DOE Seeks Input On Addressing Contractor Pension and Medical Benefits Liabilities March 27, 2007 - 12:10pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced in the Federal Register that it is seeking public comment on how to address the increasing costs and liabilities of contractor employee pension and medical benefits. Under the Department of Energy's unique

  8. Working Together to Address Natural Gas Storage Safety | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Together to Address Natural Gas Storage Safety Working Together to Address Natural Gas Storage Safety April 1, 2016 - 11:15am Addthis Working Together to Address Natural Gas Storage Safety Franklin (Lynn) Orr Franklin (Lynn) Orr Under Secretary for Science and Energy Marie Therese Dominguez Marie Therese Dominguez Administrator, U.S. Department of Transportation's Pipeline and Hazardous Materials Safety Administration As a part of the Administration's ongoing commitment to support

  9. Energy Saver RSS Subscribers: Update Your Feed Address | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy RSS Subscribers: Update Your Feed Address Energy Saver RSS Subscribers: Update Your Feed Address September 28, 2015 - 12:46pm Addthis Just a short administrative note for Energy Saver RSS subscribers: our feed address is changing. To continue reading the Energy Saver Blog through your RSS feed reader, please update the link in your reader to http://energy.gov/rss/energysaver/1280681. Thanks for reading and subscribing to Energy Saver! Addthis Related Articles The Energy Savers Blog

  10. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy Feedstocks-From Field to Fuel Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Allen Julian, Chief Business Officer, MBI PDF icon julian_biomass_2014.pdf More Documents & Publications 2015 Peer Review Presentations-Biochemical Conversion 2015 Peer Review Report Process Design and

  11. Expanding Opportunity and Addressing Unique Challenges Facing Women and

    Energy Savers [EERE]

    Girls of Color | Department of Energy Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color November 17, 2014 - 11:35am Addthis When President Obama founded the White House Council on Women and Girls (CWG) within the first two months of taking office, he charged us with working to address inequalities and barriers facing women and girls in our schools, workplaces, and

  12. Secretary Chu Addresses the International Atomic Energy Agency General

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy Addresses the International Atomic Energy Agency General Conference Secretary Chu Addresses the International Atomic Energy Agency General Conference September 20, 2010 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu addressed the International Atomic Energy Agency's 54th General Conference today in Vienna. His prepared remarks are below: Thank you, Ambassador Enkhsaikhan. Congratulations on your election as President of this Conference.

  13. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges. The Department of Energy is seeking comments on policy and logistical challenges that confront smart grid implementation, as well as recommendations on how to best overcome those challenges. PDF icon Steffes Corporation

  14. Strategies to Address Split Incentives in Multifamily Buildings |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy to Address Split Incentives in Multifamily Buildings Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily / Low-Income Peer Exchange Call: Strategies to Address Split Incentives in Multifamily Buildings, Call Slides and Discussion Summary, April 26, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Outreach to Multifamily Landlords and Tenants Stewards of Affordable Housing for

  15. Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Technical Conference | Department of Energy Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference Energy Department Assistant Secretary Patricia Hoffman Addresses 2011 FERC Reliability Technical Conference November 30, 2011 - 1:50pm Addthis WASHINGTON, D.C. - Department of Energy Assistant Secretary for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the 2011 Federal Energy Regulatory Commission technical conference in Washington, D.C.

  16. Synthetic Biology for Advanced Fuels (Opening Keynote Address...

    Office of Scientific and Technical Information (OSTI)

    Synthetic Biology for Advanced Fuels (Opening Keynote Address - 2010 JGI User Meeting) Citation Details In-Document Search Title: Synthetic Biology for Advanced Fuels (Opening ...

  17. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration ... and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice Admiral ...

  18. Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Secretary Bodman Addresses Turkmenistan Industrial Oil and Gas Exhibition November 16, ... ASHGABAT, TURKMENISTAN - U.S. Secretary of Energy Samuel W. Bodman today held bilateral ...

  19. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes. Authors: Harper, Jason C. ; Polsky, ...

  20. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich...

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications Studies on Lithium Manganese Rich MNC Composite Cathodes ... Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials

  1. Address (Smart Grid Project) (France) | Open Energy Information

    Open Energy Info (EERE)

    France) Jump to: navigation, search Project Name Address Country France Coordinates 46.073231, 2.427979 Loading map... "minzoom":false,"mappingservice":"googlemaps3","type":"R...

  2. Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy...

    Energy Savers [EERE]

    Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid ... to the U.S. Department of Energy, Office of Electricity Delivery ...

  3. Africa - Technical Potential of Solar Energy to Address Energy...

    Open Energy Info (EERE)

    - Technical Potential of Solar Energy to Address Energy Poverty and Avoid GHG Emissions Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Technical Potential of Solar...

  4. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. The Alliance to Save ...

  5. Smart Grid RFI: Addressing Policy and Logistical Challenges,...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges, Comments from the Edison Electric Institute Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from the Edison Electric Institute The Edison Electric ...

  6. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of ...

  7. Ambient Corporation's Reply comments to DOE RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation's Reply comments to DOE RFI: ...

  8. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Federal Register Notice Volume 75, No. 180 - Sep. 17, 2010 Addressing Policy and Logistical Challenges to Smart Grid Implementation: Federal Register ...

  9. Addressing Policy and Logistical Challenges to smart grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    smart grid Implementation: eMeter Response to Department of Energy RFI Addressing Policy and Logistical Challenges to smart grid Implementation: eMeter Response to Department of ...

  10. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable ...

  11. Addressing mechanical reliability issues in Sandia MEMS devices...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing mechanical reliability issues in Sandia MEMS devices. No abstract prepared. Authors: Tanner, Danelle Mary, 1952- 1 ; -) ; Buchheit, Thomas E. ; Boyce, Brad Lee ...

  12. Microsoft Word - Actions to address lessons learned.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Actions to address Work Planning and Scheduling System lessons learned Action Executive owner Staff assigned Due date Understand the business environment of vendor references....

  13. Exploring the Utilization of Complex Algal Communities to Address...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase ...

  14. Addressing Challenging Materials at Oak Ridge National Laboratory...

    Office of Scientific and Technical Information (OSTI)

    Title: Addressing Challenging Materials at Oak Ridge National Laboratory No abstract prepared. Authors: Jubin, Robert Thomas 1 ; Patton, Bradley D 1 ; Robinson, Sharon M 1 ; ...

  15. Symbiosis: Addressing Biomass Production Challenges and Climate Change |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Symbiosis: Addressing Biomass Production Challenges and Climate Change Symbiosis: Addressing Biomass Production Challenges and Climate Change This presentation was the opening keynote of the Symbiosis Conference. PDF icon symbiosis_conference_hamilton.pdf More Documents & Publications The Future of Bioenergy Feedstock Production Symbiosis Biofeedstock Conference: Expanding Commercialization of Mutualistic Microbes to Increase Feedstock Production Symbiosis

  16. Method for the electro-addressable functionalization of electrode arrays

    DOE Patents [OSTI]

    Harper, Jason C.; Polsky, Ronen; Dirk, Shawn M.; Wheeler, David R.; Arango, Dulce C.; Brozik, Susan M.

    2015-12-15

    A method for preparing an electrochemical biosensor uses bias-assisted assembly of unreactive -onium molecules on an electrode array followed by post-assembly electro-addressable conversion of the unreactive group to a chemical or biological recognition group. Electro-addressable functionalization of electrode arrays enables the multi-target electrochemical sensing of biological and chemical analytes.

  17. IP address management : augmenting Sandia's capabilities through open source tools.

    SciTech Connect (OSTI)

    Nayar, R. Daniel

    2005-08-01

    Internet Protocol (IP) address management is an increasingly growing concern at Sandia National Laboratories (SNL) and the networking community as a whole. The current state of the available IP addresses indicates that they are nearly exhausted. Currently SNL doesn't have the justification to obtain more IP address space from Internet Assigned Numbers Authority (IANA). There must exist a local entity to manage and allocate IP assignments efficiently. Ongoing efforts at Sandia have been in the form of a multifunctional database application notably known as Network Information System (NWIS). NWIS is a database responsible for a multitude of network administrative services including IP address management. This study will explore the feasibility of augmenting NWIS's IP management capabilities utilizing open source tools. Modifications of existing capabilities to better allocate available IP address space are studied.

  18. Pacific Northwest residential energy survey. Volume 2. Technical appendix

    SciTech Connect (OSTI)

    1980-07-01

    The technical appendix presents the technical aspects of the Pacific Northwest Residential Energy Survey: the survey questionnaire, exhibit cards, instructions for interviewers, and a description of the survey plan. A description of the sample plan (method used to determine which 4000 households) is given. (MCW)

  19. Construction safety program for the National Ignition Facility, Appendix B

    SciTech Connect (OSTI)

    Cerruti, S.J.

    1997-06-26

    This Appendix contains material from the LLNL Health and Safety Manual as listed below. For sections not included in this list, please refer to the Manual itself. The areas covered are: asbestos, lead, fire prevention, lockout, and tag program confined space traffic safety.

  20. The State of the Ames Laboratory Address 2011

    ScienceCinema (OSTI)

    King, Alex

    2013-03-01

    Alex King, director of The Ames Laboratory, discusses the budget situation, improvements at Ames Lab and infrastructure improvements during the State of the Lab address on Tuesday, May 24, 2011.

  1. United Indigenous Voices Address Sustainability: Climate Change and Traditional Places

    Broader source: Energy.gov [DOE]

    At the First Stewards Symposium, over 300 industry and policy leaders from around the nation will discuss four main themes generated from the 2012 First Stewards Symposium that address issues...

  2. Keynote Address: Ali Zaidi, the White House Domestic Policy Council...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ali Zaidi, the White House Domestic Policy Council Keynote Address: Ali Zaidi, the White House Domestic Policy Council May 21, 2014 2:05PM to 2:30PM PDT Pacific Ballroom Keynote...

  3. Keynote Address: Cristin Dorgelo, White House Office of Science...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to ...

  4. U.S. Energy Secretary Addresses International Atomic Energy Agency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Energy Secretary Addresses International Atomic Energy Agency General Conference September 19, 2011 - 4:48pm Addthis VIENNA, AUSTRIA - U.S. Energy Secretary Steven Chu ...

  5. Chapter VII: Addressing Environmental Aspects of TS&D Infrastructure

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Environmental Aspects of TS&D Infrastructure QER ... be in demand because new classes of jobs (e.g., smart grid ... As a result, energy jobs are classified with traditional job ...

  6. The INL Seismic Risk Assessment Project: Requirements for Addressing...

    Office of Environmental Management (EM)

    The INL Seismic Risk Assessment Project: Requirements for Addressing DOE Order 420.1C & A Proposed Generic Methodology Presentation from the May 2015 Seismic Lessons-Learned Panel ...

  7. Corrective Action Plan Addressing the Accident Investigation Report

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Corrective Action Plan Addressing the Accident Investigation Report of the February 5, 2014 Fire Event and the February 14, 2014 Radiological Release Event, Rev 1 Page 2 of 89 Table of Contents 1 Purpose ................................................................................................................................................................................................ 7 2 Summary of the

  8. NERSC Implements Organizational Changes to Better Address Evolving Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environment NERSC Organizational Changes to Better Address Evolving Data Environment NERSC Implements Organizational Changes to Better Address Evolving Data Environment February 23, 2015 Contact: Jon Bashor, jbashor@lbl.gov, 510-486-5849 Sudip Dosanjh, director of the Department of Energy's National Energy Research Scientific Computing Center, announced several organizational changes to help the center's 6,000 users more productively manage their data-intensive research. The changes took

  9. Addressing Failures in Exascale Computing (Technical Report) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Technical Report: Addressing Failures in Exascale Computing Citation Details In-Document Search Title: Addressing Failures in Exascale Computing Authors: Snir, M. ; Wisniewski, R. W. ; Abraham, J. A. ; Adve, S. V. ; Bagchi, S. ; Balaji, P. ; Belak, J. ; Bose, P. ; Cappello, F. ; Carlson, B. ; Chien, A. A. ; Coteus, P. ; Debardeleben, N. A. ; Diniz, P. ; Engelmann, C. ; Erez, M. ; Fazzari, S. ; Geist, A. ; Gupta, R. ; Johnson, F. more »; Krishnamoorthy, S. ; Leyffer, S. ; Liberty, D.

  10. Exploring the Utilization of Complex Algal Communities to Address Algal

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pond Crash and Increase Annual Biomass Production for Algal Biofuels | Department of Energy Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels Exploring the Utilization of Complex Algal Communities to Address Algal Pond Crash and Increase Annual Biomass Production for Algal Biofuels white paper exploring complex algal communities as a means of increasing algal biomass production PDF icon

  11. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges to Smart Grid Implementation | Department of Energy NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation The NAP Coalition is a "Coalition of Coalitions" that has been formed for the purpose of implementing the National Action Plan released by FERC in cooperation with DOE in June of 2010. Organizations working

  12. Addressing Policy and Logistical Challenges to Smart Grid Implementation

    Energy Savers [EERE]

    Before the Department of Energy Washington, D.C. 20585 In the Matter of Addressing Policy and Logistical Challenges to Smart Grid Implementation Smart Grid RFI: Addressing Policy and Logistical Challenges COMMENTS OF BALTIMORE GAS & ELECTRIC COMPANY I. Introduction BGE is the nation's oldest utility company. It has met the energy needs of Central Maryland for nearly 200 years. Today, it serves more than 1.2 million business and residential electric customers and approximately 650,000 gas

  13. Addressable morphology control of silica structures by manipulating the

    Office of Scientific and Technical Information (OSTI)

    reagent addition time (Journal Article) | SciTech Connect Addressable morphology control of silica structures by manipulating the reagent addition time Citation Details In-Document Search Title: Addressable morphology control of silica structures by manipulating the reagent addition time Authors: Sharma, Jaswinder K [1] ; Datskos, Panos G [1] ; Chen, Jihua [1] + Show Author Affiliations ORNL [ORNL Publication Date: 2014-01-01 OSTI Identifier: 1110986 DOE Contract Number: DE-AC05-00OR22725

  14. Addressing Challenging Materials at Oak Ridge National Laboratory

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Addressing Challenging Materials at Oak Ridge National Laboratory Citation Details In-Document Search Title: Addressing Challenging Materials at Oak Ridge National Laboratory No abstract prepared. Authors: Jubin, Robert Thomas [1] ; Patton, Bradley D [1] ; Robinson, Sharon M [1] ; Van Hoesen, Stephen Dirk [1] + Show Author Affiliations ORNL Publication Date: 2010-01-01 OSTI Identifier: 973839 DOE Contract Number: DE-AC05-00OR22725 Resource Type: Conference

  15. Addressing mechanical reliability issues in Sandia MEMS devices.

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Addressing mechanical reliability issues in Sandia MEMS devices. Citation Details In-Document Search Title: Addressing mechanical reliability issues in Sandia MEMS devices. No abstract prepared. Authors: Tanner, Danelle Mary, 1952- [1] ; -) ; Buchheit, Thomas E. ; Boyce, Brad Lee ; Goods, Steven Howard + Show Author Affiliations (, Publication Date: 2005-02-01 OSTI Identifier: 897611 Report Number(s): SAND2005-0920C TRN: US200705%%131 DOE Contract Number:

  16. Advanced Test Reactor National Scientific User Facility: Addressing

    Office of Scientific and Technical Information (OSTI)

    advanced nuclear materials research (Conference) | SciTech Connect Advanced Test Reactor National Scientific User Facility: Addressing advanced nuclear materials research Citation Details In-Document Search Title: Advanced Test Reactor National Scientific User Facility: Addressing advanced nuclear materials research The Advanced Test Reactor National Scientific User Facility (ATR NSUF), based at the Idaho National Laboratory in the United States, is supporting Department of Energy and

  17. Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges to Smart Grid Implementation | Department of Energy Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Okaloosa Gas District (The District) an Independent Special District of the State of Florida is appreciative of the opportunity to submit for your consideration the following comments in response to the U.S.

  18. PROJECT PROFILE: Addressing Soiling: From Interface Chemistry to

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Practicality | Department of Energy Addressing Soiling: From Interface Chemistry to Practicality PROJECT PROFILE: Addressing Soiling: From Interface Chemistry to Practicality Funding Opportunity: SuNLaMP SunShot Subprogram: Photovoltaics Location: National Renewable Energy Laboratory, Golden, CO Amount Awarded: $6,000,000 Natural soiling is responsible for about 4% output power loss and may be adding one cent per kilowatt hour to the levelized cost of energy (LCOE) depending on the site.

  19. DOE Awards Over a Billion Supercomputing Hours to Address Scientific

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy Over a Billion Supercomputing Hours to Address Scientific Challenges DOE Awards Over a Billion Supercomputing Hours to Address Scientific Challenges January 26, 2010 - 12:00am Addthis Washington, DC. - The U.S. Department of Energy announced today that approximately 1.6 billion supercomputing processor hours have been awarded to 69 cutting-edge research projects through the Innovative and Novel Computational Impact on Theory and Experiment (INCITE) program.

  20. President Obama Praises NAMII in State of the Union Address

    Broader source: Energy.gov [DOE]

    In his 2013 State of the Union address, President Obama used the National Additive Manufacturing Institute (NAMII) as a model of the potential for innovation in manufacturing in the U.S. His address made it clear that his Administration is making the revitalization of the manufacturing sector a priority, stating that he plans to make the U.S. "a magnet for new jobs and manufacturing." He laid out a plan for spurring growth in manufacturing in the following statement:

  1. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenges | Department of Energy ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American Society of Heating, Refrigerating and Air-Conditioning Engineers Inc. (ASHRAE), founded in 1894, is an international organization of over 50,000 members. ASHRAE fulfills its mission of advancing heating, ventilation, air conditioning and refrigeration to serve humanity and promote a

  2. Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges to Smart Grid Implementation | Department of Energy Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation's Reply comments to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation Ambient Corporation submits the following comments to the US Department of Energy (DOE) in hopes that their contribution can highlight and further the understanding of the DOE on

  3. New partnership uses advanced computer science modeling to address climate

    National Nuclear Security Administration (NNSA)

    change | National Nuclear Security Administration partnership uses advanced computer science modeling to address climate change Friday, August 29, 2014 - 10:26am Several national laboratories and institutions have joined forces to develop and apply the most complete climate and Earth system model to address the most challenging and demanding climate change issues. Accelerated Climate Modeling for Energy, or ACME, is designed to accelerate the development and application of fully coupled,

  4. Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Logistical Challenges | Department of Energy Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges Dairyland Power Cooperative is a generation and transmission cooperative (G&T) that provides the wholesale electrical requirements and other services for 25 electric distribution cooperatives and 16 municipal utilities in the Upper Midwest. PDF icon Smart Grid RFI:

  5. Helping Local Officials Address Fuel Shortages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Helping Local Officials Address Fuel Shortages Helping Local Officials Address Fuel Shortages November 3, 2012 - 6:30pm Addthis The Energy Department continues to work with its federal and state partners to restore critical energy infrastructure throughout the region affected by Hurricane Sandy. The Energy Department continues to work with its federal and state partners to restore critical energy infrastructure throughout the region affected by Hurricane Sandy. Lindsey Geisler Lindsey Geisler

  6. Biosurveillance panel to address essential science for public health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Panel to address essential science for public health Biosurveillance panel to address essential science for public health A team of national experts across varied disciplines will be gathering Feb. 17 in Chicago, prepared to explore the most critical aspects of international disease awareness. February 17, 2014 Basil Swanson Basil Swanson Contact Nancy Ambrosiano Communications Office (505) 699-1149 Email "It is absolutely essential that nations are able to quickly detect and characterize a

  7. Can Cloud Computing Address the Scientific Computing Requirements for DOE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Researchers? Well, Yes, No and Maybe Can Cloud Computing Address the Scientific Computing Requirements for DOE Researchers? Well, Yes, No and Maybe Can Cloud Computing Address the Scientific Computing Requirements for DOE Researchers? Well, Yes, No and Maybe January 30, 2012 Jon Bashor, Jbashor@lbl.gov, +1 510-486-5849 Magellan1.jpg Magellan at NERSC After a two-year study of the feasibility of cloud computing systems for meeting the ever-increasing computational needs of scientists,

  8. Report Outlines Promising Opportunities for Addressing Climate Change

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Report Outlines Promising Opportunities for Addressing Climate Change For more information contact: George Douglas, 303-275-4096 email: George Douglas Golden, Colo., Nov. 15, 2000 - Researchers from five U.S. Department of Energy national laboratories, including the National Renewable Energy Laboratory, have issued a major report that finds the United States can make impressive strides toward addressing climate change through smart policies and technologies. The report, "Scenarios for a

  9. Keynote Address: Cristin Dorgelo, White House Office of Science and

    Office of Environmental Management (EM)

    Technology Policy | Department of Energy Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to 2:30PM PDT Pacific Ballroom Cristin Dorgelo, Assistant Director of Grand Challenges for The White House Office of Science and Technology Policy will deliver a keynote address

  10. Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models

    Office of Scientific and Technical Information (OSTI)

    Position Aware Linear Solid (PALS). (Conference) | SciTech Connect Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models Position Aware Linear Solid (PALS). Citation Details In-Document Search Title: Towards Addressing Surface Effects in Ordinary Isotropic Peridynamic Models Position Aware Linear Solid (PALS). Abstract not provided. Authors: Mitchell, John Anthony ; Silling, Stewart Andrew Publication Date: 2013-12-01 OSTI Identifier: 1121945 Report Number(s):

  11. Request for Proposal NO. DE-SOL-0008418 Section J, Appendix K, Page 1

    National Nuclear Security Administration (NNSA)

    NO. DE-SOL-0008418 Section J, Appendix K, Page 1 SECTION J APPENDIX K PROGRAM MANAGEMENT AND COST REPORTS The Contractor shall submit periodic cost, schedule, and technical performance plans and reports in such form and substance as required by the Contracting Officer. Reference Section J, Appendix A, Statement of Work, Chapter I, paragraph 3.3. Cost reports will include at a minimum: 1. Monthly general management reports to summarize schedule, labor and cost plans and status, and provide

  12. Draft New England Clean Power Link Power Project Environmental Impact Statement Appendix A-L

    Energy Savers [EERE]

    D APPENDIX D ALTERNATIVES CONSIDERED BUT ELIMINATED FROM FURTHER ANALYSIS U.S. Department of Energy May 2015 D-1 Draft New England Clean Power Link EIS Appendix D This Page Intentionally Left Blank U.S. Department of Energy May 2015 D-2 Draft New England Clean Power Link EIS Appendix D New England Clean Power Link Project Alternatives Considered but Eliminated from Further Analysis The New England Clean Power Link (NECPL) Project (Project) would transport electricity from Canada on a merchant

  13. Columbia River System Operation Review : Final Environmental Impact Statement, Appendix T (Second Continued Volume): Comments & Responses.

    SciTech Connect (OSTI)

    Columbia River System Operation Review

    1995-11-01

    This is Appendix T (second continued volume) giving public comments and responses to the final environmental impact statement for the Columbia River System.

  14. Technical Basis and Considerations for DOE M 435.1-1 (Appendix A)

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1999-07-09

    This appendix establishes the technical basis of the order revision process and of each of the requirements included in the revised radioactive waste management order.

  15. Microsoft Word - KCP SEC J_Appendix K - Small Business SubK Plan 001

    National Nuclear Security Administration (NNSA)

    K, Page 1 SECTION J APPENDIX K SMALL BUSINESS SUBCONTRACTING PLAN Plan: As attached below. Replaced Mod 002 dated 1/5/11 (Replaced Mod 002)

  16. An Analysis of Wind Power Development in the Town of Hull, MA_Appendix 1_MEPA Certificate

    SciTech Connect (OSTI)

    Adams, Christopher

    2013-06-30

    This appendix consists of the CERTIFICATE OF THE SECRETARY OF ENERGY AND ENVIRONMENTAL AFFAIRS ON THE ENVIRONMENTAL NOTIFICATION FORM.

  17. Wind vs. Biofuels: Addressing Climate, Health and Energy

    SciTech Connect (OSTI)

    Professor Mark Jacobson

    2007-01-29

    The favored approach today for addressing global warming is to promote a variety of options: biofuels, wind, solar thermal, solar photovoltaic, geothermal, hydroelectric, and nuclear energy and to improve efficiency. However, by far, most emphasis has been on biofuels. It is shown here, though, that current-technology biofuels cannot address global warming and may slightly increase death and illness due to ozone-related air pollution. Future biofuels may theoretically slow global warming, but only temporarily and with the cost of increased air pollution mortality. In both cases, the land required renders biofuels an impractical solution. Recent measurements and statistical analyses of U.S. and world wind power carried out at Stanford University suggest that wind combined with other options can substantially address global warming, air pollution mortality, and energy needs simultaneously.

  18. Wind versus Biofuels for Addressing Climate, Health, and Energy

    SciTech Connect (OSTI)

    Jacobson, Mark Z.

    2007-01-29

    The favored approach today for addressing global warming is to promote a variety of options: biofuels, wind, solar thermal, solar photovoltaic, geothermal, hydroelectric, and nuclear energy and to improve efficiency. However, by far, most emphasis has been on biofuels. It is shown here, though, that current-technology biofuels cannot address global warming and may slightly increase death and illness due to ozone-related air pollution. Future biofuels may theoretically slow global warming, but only temporarily and with the cost of increased air pollution mortality. In both cases, the land required renders biofuels an impractical solution. Recent measurements and statistical analyses of U.S. and world wind power carried out at Stanford University suggest that wind combined with other options can substantially address global warming, air pollution mortality, and energy needs simultaneously.

  19. SECTION J, APPENDIX N - LIST OF APPLICABLE DIRECTIVES

    National Nuclear Security Administration (NNSA)

    N, Page 1 SECTION J APPENDIX N LIST OF APPLICABLE DIRECTIVES 09/17/2014 Directive Directive Title 10 CFR 824, Current Rule Procedural Rules for the Assessment of Civil Penalties for Classified Information Security Violations 10 CFR 830 - Current Rule Nuclear Safety Management 10 CFR 851 - Current Rule Worker Safety and Health Program ANSI B30.11 Monorails and Underhung Hoists ANSI N323A Radiation Protection Instrumentation Test and Calibration Portable Survey Instrumentation, 1997 ANSI N43.2

  20. SECTION J, APPENDIX Q - MIN STDS FOR CONTRACTORS' COI PLANS

    National Nuclear Security Administration (NNSA)

    Q, Page 1 SECTION J APPENDIX Q [Note: The Contractors' Conflict of Interest Plan shall be submitted to the Contracting Officer during the Transition Term prior to December 31, 2010.] MINIMUM STANDARDS FOR CONTRACTORS' CONFLICT OF INTEREST (COI) PLANS 12/1/10 A. Corporate Structure The COI Plan shall describe any parent relationship and list all affiliates, subsidiaries, and sister companies, etc. Generally, this need not exceed three corporate tiers, unless a relationship exists beyond three

  1. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  2. BuriedWasteAgreementAPPENDIX_A-F.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    APPENDIX F - 1 Protocol For Targeted Waste Retrievals and Volume Determinations This Protocol describes procedures used in the field by the operators of the retrieval projects to conduct excavation, waste identification, retrieval and segregation. SUMMARY: The approach taken in the field involves sectioning a defined pit area into grids for tracking purposes. Operators excavate and sort through all of the material in each grid with an excavator before moving to another grid area. The lateral

  3. Microsoft Word - SEC J_Appendix M - Functional Activity Def

    National Nuclear Security Administration (NNSA)

    M, Page 1 SECTION J APPENDIX M U. S. DEPARTMENT OF ENERGY FUNCTIONAL ACTIVITY DEFINITIONS Support Cost by Functional Activity (SCFA) Report Introduction Prior to fiscal year 1997, Department-wide support cost data showing the nature of, amount of, and trends in these costs were not available. Recognizing the importance of managing these costs, and receiving requests from Congress and the GAO, the Department's Chief Financial Officer implemented the SCFA System. In implementing the SCFA to track

  4. Appendix TFIELD Attachment A: Attachment A: TFIELD-2014 Visualization

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attachment A: TFIELD-2014 Visualization United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Attachment A: TFIELD-2014 Visualization This attachment contains figures for Appendix TFIELD-2014, related to the Culebra T-Field calibration process, performed as part of the 2009 Compliance Recertification Application (CRA-2009) Performance Assessment Baseline Calculation (PABC). These parameter inputs and

  5. Addressing the Need for Alternative Transportation Fuels: The Joint

    Office of Scientific and Technical Information (OSTI)

    BioEnergy Institute (Journal Article) | SciTech Connect Addressing the Need for Alternative Transportation Fuels: The Joint BioEnergy Institute Citation Details In-Document Search Title: Addressing the Need for Alternative Transportation Fuels: The Joint BioEnergy Institute Today, carbon-rich fossil fuels, primarily oil, coal, and natural gas, provide 85% of the energy consumed in the U.S. As world demand increases, oil reserves may become rapidly depleted. Fossil fuel use increases CO{sub

  6. Keynote Address at MIT Energy Conference 2016 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Keynote Address at MIT Energy Conference 2016 Keynote Address at MIT Energy Conference 2016 March 4, 2016 - 9:00am Addthis Well, thank you to all the students in the energy club for they have been doing and are doing today. I have to say it's great to be back on campus at this energy conference in what, for me, is a brief window between a two-year recusal of appearing at MIT to January 20th, 2017. So this is a good time to get here. It's also great to read from a distance and to - and to see up

  7. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  8. Argonne Director Eric Isaacs addresses the National Press Club

    ScienceCinema (OSTI)

    Eric Isaccs

    2010-01-08

    Argonne Director Eric Isaacs addresses the National Press Club on 9/15/2009. To build a national economy based on sustainable energy, the nation must first "reignite its innovation ecology," he said. Issacs makes the case for investing in science to secure America's future.

  9. Nuclear power plant Generic Aging Lessons Learned (GALL). Main report and appendix A

    SciTech Connect (OSTI)

    Kaza, K.E.; Diercks, D.R.; Holland, J.W.; Choi, S.U.

    1996-12-01

    The purpose of this generic aging lessons learned (GALL) review is to provide a systematic review of plant aging information in order to assess materials and component aging issues related to continued operation and license renewal of operating reactors. Literature on mechanical, structural, and thermal-hydraulic components and systems reviewed consisted of 97 Nuclear Plant Aging Research (NPAR) reports, 23 NRC Generic Letters, 154 Information Notices, 29 Licensee Event Reports (LERs), 4 Bulletins, and 9 Nuclear Management and Resources Council Industry Reports (NUMARC IRs) and literature on electrical components and systems reviewed consisted of 66 NPAR reports, 8 NRC Generic Letters, 111 Information Notices, 53 LERs, 1 Bulletin, and 1 NUMARC IR. More than 550 documents were reviewed. The results of these reviews were systematized using a standardized GALL tabular format and standardized definitions of aging-related degradation mechanisms and effects. The tables are included in volume s 1 and 2 of this report. A computerized data base has also been developed for all review tables and can be used to expedite the search for desired information on structures, components, and relevant aging effects. A survey of the GALL tables reveals that all ongoing significant component aging issues are currently being addressed by the regulatory process. However, the aging of what are termed passive components has been highlighted for continued scrutiny. This document is Volume 1, consisting of the executive summary, summary and observations, and an appendix listing the GALL literature review tables.

  10. Request for Proposal No. DE-SOL-0008470 Section J, Appendix A, Page i

    National Nuclear Security Administration (NNSA)

    J, Appendix A, Page i SECTION J, APPENDIX A: STATEMENT OF WORK TABLE OF CONTENTS CHAPTER I. BACKGROUND, OBJECTIVES, AND REQUIREMENTS .......................... 1 1.0 THE NATIONAL NUCLEAR SECURITY ADMINISTRATION (NNSA) MISSION .................................................. 1 2.0 MANAGEMENT & OPERATIONS .................................................................................................................... 1 3.0 REQUIREMENTS

  11. Synthesis Gas Demonstration Plant, Baskett, Kentucky: environmental report. [Contains chapter 4 and appendix 4A

    SciTech Connect (OSTI)

    1980-01-01

    This volume contains chapter 4 and Appendix 4A which include descriptions of use of adjacent land and water (within miles of the proposed site), baseline ecology, air quality, meteorology, noise, hydrology, water quality, geology, soils and socio-economic factors. Appendix 4A includes detailed ecological surveys made in the area including the methods used. (LTN)

  12. Appendix D.2 Hanford Site-Wide SSHAC Level 3 PSHA Project

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Appendix D.2 Hanford Site-Wide SSHAC Level 3 PSHA Project April 24, 2014 Hazard Input Document (HID) Final GMC Model Contents Appendix D.2 Hanford Site-Wide SSHAC Level 3 PSHA Project ..................................................... 1 Overview ...................................................................................................................................... 2 Median Motions from Crustal Earthquakes

  13. Contract No. DE-AC02-07CH11358 Section J Appendix G Contract Modification No. 0183

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Section J Appendix G Contract Modification No. 0183 ATTACHMENT J.7 Contract No. DE-AC02-07CH11358 J-G-1 APPENDIX G PURCHASING SYSTEM REQUIREMENTS Applicable to the Operation of AMES Laboratory Contract No. DE-AC02-07CH11358 Section J Appendix G Contract Modification No. 0183 Appendix G Purchasing System Requirements This Appendix and Clause 1.154, "Contractor Purchasing System," sets forth DOE requirements applicable to the Purchasing System established under the Contract for the

  14. Appendix E: Other NEMS-MP results for the base case and scenarios.

    SciTech Connect (OSTI)

    Plotkin, S. E.; Singh, M. K.; Energy Systems

    2009-12-03

    The NEMS-MP model generates numerous results for each run of a scenario. (This model is the integrated National Energy Modeling System [NEMS] version used for the Multi-Path Transportation Futures Study [MP].) This appendix examines additional findings beyond the primary results reported in the Multi-Path Transportation Futures Study: Vehicle Characterization and Scenario Analyses (Reference 1). These additional results are provided in order to help further illuminate some of the primary results. Specifically discussed in this appendix are: (1) Energy use results for light vehicles (LVs), including details about the underlying total vehicle miles traveled (VMT), the average vehicle fuel economy, and the volumes of the different fuels used; (2) Resource fuels and their use in the production of ethanol, hydrogen (H{sub 2}), and electricity; (3) Ethanol use in the scenarios (i.e., the ethanol consumption in E85 vs. other blends, the percent of travel by flex fuel vehicles on E85, etc.); (4) Relative availability of E85 and H2 stations; (5) Fuel prices; (6) Vehicle prices; and (7) Consumer savings. These results are discussed as follows: (1) The three scenarios (Mixed, (P)HEV & Ethanol, and H2 Success) when assuming vehicle prices developed through literature review; (2) The three scenarios with vehicle prices that incorporate the achievement of the U.S. Department of Energy (DOE) program vehicle cost goals; (3) The three scenarios with 'literature review' vehicle prices, plus vehicle subsidies; and (4) The three scenarios with 'program goals' vehicle prices, plus vehicle subsidies. The four versions or cases of each scenario are referred to as: Literature Review No Subsidies, Program Goals No Subsidies, Literature Review with Subsidies, and Program Goals with Subsidies. Two additional points must be made here. First, none of the results presented for LVs in this section include Class 2B trucks. Results for this class are included occasionally in Reference 1. They represent a small, though noticeable, segment of the 'LV plus 2B' market (e.g., a little more than 3% of today's energy use in that market). We generally do not include them in this discussion, simply because it requires additional effort to combine the NEMS-MP results for them with the results for the other LVs. (Where there is an exception, we will indicate so.) Second, where reference is made to E85, the ethanol content is actually 74%. The Energy Information Administration (EIA) assumes that, to address cold-starting issues, the percent of ethanol in E85 will vary seasonally. The EIA uses an annual average ethanol content of 74% in its forecasts. That assumption is maintained in the NEMS-MP scenario runs.

  15. Briefing Memo: Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session.

  16. Agenda: Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: Energy.gov [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session.

  17. Plan for addressing issues relating to oil shale plant siting

    SciTech Connect (OSTI)

    Noridin, J. S.; Donovan, R.; Trudell, L.; Dean, J.; Blevins, A.; Harrington, L. W.; James, R.; Berdan, G.

    1987-09-01

    The Western Research Institute plan for addressing oil shale plant siting methodology calls for identifying the available resources such as oil shale, water, topography and transportation, and human resources. Restrictions on development are addressed: land ownership, land use, water rights, environment, socioeconomics, culture, health and safety, and other institutional restrictions. Descriptions of the technologies for development of oil shale resources are included. The impacts of oil shale development on the environment, socioeconomic structure, water availability, and other conditions are discussed. Finally, the Western Research Institute plan proposes to integrate these topics to develop a flow chart for oil shale plant siting. Western Research Institute has (1) identified relative topics for shale oil plant siting, (2) surveyed both published and unpublished information, and (3) identified data gaps and research needs. 910 refs., 3 figs., 30 tabs.

  18. Smart Grid RFI: Addressing Policy and Logistical Challenges

    Energy Savers [EERE]

    Electricity Delivery and Energy Reliability 1000 Independence Avenue, SW Room 8H033 Washington, DC 20585 Submitted electronically via smartgridpolicy@hq.doe.gov Smart Grid Request for Information: Addressing Policy and Logistical Challenges Comments of the Alliance to Save Energy The Alliance to Save Energy (the Alliance) thanks the Department of Energy for the opportunity to comment on broad issues of policy and logistical challenges faced in smart grid implementation. The Alliance to Save

  19. Addressing Policy and Logistical Challenges to Smart Grid Implementation:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments by the Office of the Ohio Consumers' Counsel | Department of Energy Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel The Office of the Ohio Consumers' Counsel ("OCC") hereby submits the following comments in response to the United States Department of Energy ("DOE") Request for Information

  20. Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Edison Electric Institute | Department of Energy Challenges, Comments from the Edison Electric Institute Smart Grid RFI: Addressing Policy and Logistical Challenges, Comments from the Edison Electric Institute The Edison Electric Institute ("EEI"), on behalf of its member companies, hereby submits the following comments in response to the request by the Department of Energy ("DOE" or "Department") for information on a wide range of issues dealing with Smart

  1. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Alliance to Save Energy. | Department of Energy Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. The Alliance to Save Energy is a coalition of prominent business, government, environmental, and consumer leaders who promote the efficient use of energy worldwide to benefit consumers, the environment, economy, and national security. The Alliance to Save Energy (the Alliance) thanks the

  2. Community Leaders to Address Energy Solutions Through Leadership Program -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL Community Leaders to Address Energy Solutions Through Leadership Program May 16, 2007 Thirteen local community leaders were chosen to join the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory's (NREL) Executive Energy Leadership program. Energy Execs will participate in monthly educational sessions covering topics such as solar technology, wind energy and transportation of the future. Sessions will include an in depth look at future markets and

  3. UK Energy Minister to Address World Renewable Energy Congress - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL UK Energy Minister to Address World Renewable Energy Congress Conference, Expo to Bring International 'Clean Energy' experts to Denver April 7, 2004 Golden, Colo. - Stephen Timms, energy minister for the United Kingdom will speak to delegates from as many as 100 nations at the opening ceremony of the eighth World Renewable Energy Congress (WREC VIII) in Denver on Aug. 30. Expected to be the world's largest gathering of renewable energy experts, WREC VIII will provide a forum

  4. NEW APPROACH TO ADDRESSING GAS GENERATION IN RADIOACTIVE MATERIAL PACKAGING

    SciTech Connect (OSTI)

    Watkins, R; Leduc, D; Askew, N

    2009-06-25

    Safety Analysis Reports for Packaging (SARP) document why the transportation of radioactive material is safe in Type A(F) and Type B shipping containers. The content evaluation of certain actinide materials require that the gas generation characteristics be addressed. Most packages used to transport actinides impose extremely restrictive limits on moisture content and oxide stabilization to control or prevent flammable gas generation. These requirements prevent some users from using a shipping container even though the material to be shipped is fully compliant with the remaining content envelope including isotopic distribution. To avoid these restrictions, gas generation issues have to be addressed on a case by case basis rather than a one size fits all approach. In addition, SARP applicants and review groups may not have the knowledge and experience with actinide chemistry and other factors affecting gas generation, which facility experts in actinide material processing have obtained in the last sixty years. This paper will address a proposal to create a Gas Generation Evaluation Committee to evaluate gas generation issues associated with Safety Analysis Reports for Packaging material contents. The committee charter could include reviews of both SARP approved contents and new contents not previously evaluated in a SARP.

  5. Construction safety program for the National Ignition Facility, Appendix A

    SciTech Connect (OSTI)

    Cerruti, S.J.

    1997-06-26

    Topics covered in this appendix include: General Rules-Code of Safe Practices; 2. Personal Protective Equipment; Hazardous Material Control; Traffic Control; Fire Prevention; Sanitation and First Aid; Confined Space Safety Requirements; Ladders and Stairways; Scaffolding and Lift Safety; Machinery, Vehicles, and Heavy Equipment; Welding and Cutting-General; Arc Welding; Oxygen/Acetylene Welding and Cutting; Excavation, Trenching, and Shoring; Fall Protection; Steel Erection; Working With Asbestos; Radiation Safety; Hand Tools; Electrical Safety; Nonelectrical Work Performed Near Exposed High-Voltage Power-Distribution Equipment; Lockout/Tagout Requirements; Rigging; A-Cranes; Housekeeping; Material Handling and Storage; Lead; Concrete and Masonry Construction.

  6. Appendix DATA Attachment B: WIPP Waste Containers and Emplacement

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attachment B: WIPP Waste Containers and Emplacement United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Appendix DATA-2014 Attachment B: WIPP Waste Containers and Emplacement Table of Contents DATA-B-1.0 Authorized Waste Emplacement Containers DATA-B-1.1 Container Descriptions DATA-B-1.2 Dunnage Containers DATA-B-1.3 Payload Descriptions DATA-B-1.4 Emplacement Configurations DATA-B-2.0 References List of Figures Figure DATA-B- 1. 55-gal Drum

  7. Appendix SCR: Feature, Event, and Process Screening for PA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SCR-2014 Feature, Event, and Process Screening for PA United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix SCR-2014 Feature, Event, and Process Screening for PA Table of Contents SCR-1.0 Introduction SCR-2.0 Basis for FEPs Screening Process SCR-2.1 Requirement for FEPs SCR-2.2 FEPs List Development for the CCA SCR-2.3 Criteria for Screening of FEPs and Categorization of Retained FEPs

  8. Resource Conservation and Recovery Act, Part B Permit Application [for the Waste Isolation Pilot Plant (WIPP)]. Chapter E, Appendix E1, Chapter L, Appendix L1: Volume 12, Revision 3

    SciTech Connect (OSTI)

    Not Available

    1993-01-01

    The Waste Isolation Pilot Plant (WIPP) Project was authorized by the US Department of Energy 5 (DOE) National Security and Military Applications of the Nuclear Energy Authorization Act of 1980 (Public Law 96-164). Its legislative mandate is to provide a research and development facility to demonstrate the safe disposal of radioactive waste resulting from national defense programs and activities. To fulfill this mandate, the WIPP facility has been designed to perform scientific investigations of the behavior of bedded salt as a repository medium and the interactions between the soft and radioactive wastes. In 1991, DOE proposed to initiate a experimental Test Phase designed to demonstrate the performance of the repository. The Test Phase activities involve experiments using transuranic (TRU) waste typical of the waste planned for future disposal at the WIPP facility. Much of this TRU waste is co-contaminated with chemical constituents which are defined as hazardous under HWMR-7, Pt. II, sec. 261. This waste is TRU mixed waste and is the subject of this application. Because geologic repositories, such as the WIPP facility, are defined under the Resource Conservation and Recovery Act (RCRA) as land disposal facilities, the groundwater monitoring requirements of HWMR-7, PLV, Subpart X, must be addressed. HWMR-7, Pt. V, Subpart X, must be addressed. This appendix demonstrates that groundwater monitoring is not needed in order to demonstrate compliance with the performance standards; therefore, HWMR-7, Pt.V, Subpart F, will not apply to the WIPP facility.

  9. A novel electron gun with an independently addressable cathode array.

    SciTech Connect (OSTI)

    Rudys, Joseph Matthew; Reed, Kim Warren; Pea, Gary Edward; Schneider, Larry X.

    2006-08-01

    The design of a novel electron gun with an array of independently addressable cathode elements is presented. Issues relating to operation in a 6.5 Tesla axial magnetic field are discussed. Simulations with the TriComp [1] electromagnetic field code that were used to determine the space charge limited tube characteristic and to model focusing of the electron beam in the magnetic field are reviewed. Foil heating and stress calculations are discussed. The results of CYLTRAN [2] simulations yielding the energy spectrum of the electron beam and the current transmitted through the foil window are presented.

  10. Imulation of polymer forming processes - addressing industrial needs

    SciTech Connect (OSTI)

    Thibault, F.; DiRaddo, R. [Industrial Materials Institute-National Research Council (Canada)

    2011-05-04

    The objective of this paper is to present the development of simulation and design optimization capabilities, for polymer forming processes, in the context of addressing industrial needs. Accomplishments generated from close to twenty years of research in this field, at the National Research Council (NRC), are presented. Polymer forming processes such as extrusion blow moulding, stretch blow moulding and thermoforming have been the focus of the work, yet the research is extendable to similar polymer forming operations such as micro-blow moulding, sheet blow moulding and composites stamping. The research considers material models, process sequence integration and design optimization, derivative processes and 3D finite elements with multi-body contact.

  11. Content-addressable memory based enforcement of configurable policies

    DOE Patents [OSTI]

    Berg, Michael J

    2014-05-06

    A monitoring device for monitoring transactions on a bus includes content-addressable memory ("CAM") and a response policy unit. The CAM includes an input coupled to receive a bus transaction tag based on bus traffic on the bus. The CAM stores data tags associated with rules of a security policy to compare the bus transaction tag to the data tags. The CAM generates an output signal indicating whether one or more matches occurred. The response policy unit is coupled to the CAM to receive the output signal from the CAM and to execute a policy action in response to the output signal.

  12. Final New England Clean Power Link Project Environmental Impact Statement Appendix D-F

    Energy Savers [EERE]

    D U.S. Department of Energy October 2015 D-1 APPENDIX D ALTERNATIVES CONSIDERED BUT ELIMINATED FROM FURTHER ANALYSIS Final New England Clean Power Link EIS Appendix D U.S. Department of Energy October 2015 D-2 This Page Intentionally Left Blank Final New England Clean Power Link EIS Appendix D U.S. Department of Energy October 2015 D-3 New England Clean Power Link Project Alternatives Considered but Eliminated from Further Analysis The New England Clean Power Link (NECPL) Project (Project) would

  13. Retrospective analysis of energy use and conservation trends: 1972-1982. Appendix

    SciTech Connect (OSTI)

    Adams, R.C.; Belzer, D.B.; Fang, J.M.; Imhoff, K.L.; Lax, D.H.; Moe, R.J.; Roop, J.M.; Wusterbarth, A.R.

    1985-06-01

    This appendix contains the detailed documentation corresponding to the end-use sectoral analyses presented in the main report. The data and methods used to calculate alternative scenarios for estimating energy savings in four economic sectors are provided in this volume. Appendix A contains the detailed documentation for the residential sector analysis. The methodology used to prepare estimates of building energy savings in the commercial sector is provided in Appendix B. Finally, Appendices C and D discuss the data and explain the analytical techniques used to derive estimates of energy savings in the industrial and transportation sectors, respectively. 9 refs., 14 figs., 86 tabs.

  14. Compensated individually addressable array technology for human breast imaging

    DOE Patents [OSTI]

    Lewis, D. Kent

    2003-01-01

    A method of forming broad bandwidth acoustic or microwave beams which encompass array design, array excitation, source signal preprocessing, and received signal postprocessing. This technique uses several different methods to achieve improvement over conventional array systems. These methods are: 1) individually addressable array elements; 2) digital-to-analog converters for the source signals; 3) inverse filtering from source precompensation; and 4) spectral extrapolation to expand the bandwidth of the received signals. The components of the system will be used as follows: 1) The individually addressable array allows scanning around and over an object, such as a human breast, without any moving parts. The elements of the array are broad bandwidth elements and efficient radiators, as well as detectors. 2) Digital-to-analog converters as the source signal generators allow virtually any radiated field to be created in the half-space in front of the array. 3) Preprocessing allows for corrections in the system, most notably in the response of the individual elements and in the ability to increase contrast and resolution of signal propagating through the medium under investigation. 4) Postprocessing allows the received broad bandwidth signals to be expanded in a process similar to analytic continuation. Used together, the system allows for compensation to create beams of any desired shape, control the wave fields generated to correct for medium differences, and improve contract and resolution in and through the medium.

  15. Recent NRC research activities addressing valve and pump issues

    SciTech Connect (OSTI)

    Morrison, D.L.

    1996-12-01

    The mission of the U.S. Nuclear Regulatory Commission (NRC) is to ensure the safe design, construction, and operation of commercial nuclear power plants and other facilities in the U.S.A. One of the main roles that the Office of Nuclear Regulatory Research (RES) plays in achieving the NRC mission is to plan, recommend, and implement research programs that address safety and technical issues deemed important by the NRC. The results of the research activities provide the bases for developing NRC positions or decisions on these issues. Also, RES performs confirmatory research for developing the basis to evaluate industry responses and positions on various regulatory requirements. This presentation summarizes some recent RES supported research activities that have addressed safety and technical issues related to valves and pumps. These activities include the efforts on determining valve and motor-operator responses under dynamic loads and pressure locking events, evaluation of monitoring equipment, and methods for detecting and trending aging of check valves and pumps. The role that RES is expected to play in future years to fulfill the NRC mission is also discussed.

  16. Network Security Mechanisms Utilizing Dynamic Network Address Translation LDRD Project

    SciTech Connect (OSTI)

    PRICE, CARRIE M.; STANTON, ERIC; LEE, ERIK J.; MICHALSKI, JOHN T.; CHUA, KUAN SEAH; WONG, YIP HENG; TAN, CHUNG PHENG

    2002-11-01

    A new protocol technology is just starting to emerge from the laboratory environment. Its stated purpose is to provide an additional means in which networks, and the services that reside on them, can be protected from adversarial compromise. This report has a two-fold objective. First is to provide the reader with an overview of this emerging Dynamic Defenses technology using Dynamic Network Address Translation (Dynat). This ''structure overview'' is concentrated in the body of the report, and describes the important attributes of the technology. The second objective is to provide a framework that can be used to help in the classification and assessment of the different types of dynamic defense technologies along with some related capabilities and limitations. This information is primarily contained in the appendices.

  17. Western Wind Strategy: Addressing Critical Issues for Wind Deployment

    SciTech Connect (OSTI)

    Douglas Larson; Thomas Carr

    2012-03-30

    The goal of the Western Wind Strategy project was to help remove critical barriers to wind development in the Western Interconnection. The four stated objectives of this project were to: (1) identify the barriers, particularly barriers to the operational integration of renewables and barriers identified by load-serving entities (LSEs) that will be buying wind generation, (2) communicate the barriers to state officials, (3) create a collaborative process to address those barriers with the Western states, utilities and the renewable industry, and (4) provide a role model for other regions. The project has been on the forefront of identifying and informing state policy makers and utility regulators of critical issues related to wind energy and the integration of variable generation. The project has been a critical component in the efforts of states to push forward important reforms and innovations that will enable states to meet their renewable energy goals and lower the cost to consumers of integrating variable generation.

  18. Remedial investigation report on Waste Area Grouping 5 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Volume 2 -- Appendix A: Characterization methods and data summary

    SciTech Connect (OSTI)

    1995-09-01

    This document provides the Environmental Restoration Program with information about the results of investigations performed at Waste Area Grouping (WAG) 5. It includes information on risk assessments that have evaluated long-term impacts to human health and the environment. Information provided in this document forms the basis for decisions regarding the need for subsequent remediation work at WAG 5. This appendix presents background regulatory and technical information regarding the solid waste management units (SWMUs) at WAG 5 to address requirements established by the Federal Facility Agreement (FFA) for the Oak Ridge Reservation (ORR). The US Department of Energy (DOE) agreed to conduct remedial investigations (RIs) under the FFA at various sites at Oak Ridge National Laboratory (ORNL), including SWMUs and other areas of concern on WAG 5. The appendix gives an overview of the regulatory background to provide the context in which the WAG 5 RI was planned and implemented and documents how historical sources of data, many of which are SWMU-specific, were evaluated and used.

  19. Hanford environmental analytical methods (methods as of March 1990). Appendix A3-R

    SciTech Connect (OSTI)

    Goheen, S.C.; McCulloch, M.; Daniel, J.L.

    1993-05-01

    Techniques in use at the Hanford Reservation as of March, 1990 for the analysis of liquids and radioactive effluents are described. Limitations and applications of the techniques are included. This report is Appendix A3-R.

  20. Microsoft Word - DOE_PPPL_M210_ Appendix K.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DE-AC02-09CH11466 Section J - Appendix K J-K-2 KEY PERSONNEL Name Title Position Stewart C. Prager Michael Zarnstorff John DeLooper Kristen A. Fischer Laboratory Director...

  1. Gasoline from coal in the state of Illinois: feasibility study. Appendix 1. Design

    SciTech Connect (OSTI)

    Not Available

    1980-01-01

    Appendix 1 includes the overall design philosophy about units in parallel, specifications above actual need, spares maintenance, etc. Most of the report involves engineering work sheets for various equipments. (LTN)

  2. Title 33 CFR 325 Appendix B Processing of Department of the Army...

    Open Energy Info (EERE)

    5 Appendix B Processing of Department of the Army Permits Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: Title 33 CFR 325...

  3. Commercial Building Tenant Energy Usage Data Aggregation and Privacy: Technical Appendix

    SciTech Connect (OSTI)

    Livingston, Olga V.; Pulsipher, Trenton C.; Anderson, David M.

    2014-11-12

    This technical appendix accompanies report PNNL–23786 “Commercial Building Tenant Energy Usage Data Aggregation and Privacy”. The objective is to provide background information on the methods utilized in the statistical analysis of the aggregation thresholds.

  4. Microsoft Word - KCP SEC J_Appendix P - Special Financial Agreement

    National Nuclear Security Administration (NNSA)

    P, Page 1 SECTION J APPENDIX P [Note: To be inserted by the Contracting Officer during the Transition Term prior to December 31, 2010.] SPECIAL FINANCIAL INSTITUTION AGREEMENT FOR USE WITH THE PAYMENTS-CLEARED FINANCING ARRANGEMENT Note: (1) The Contractor shall enter into a new banking agreement(s) during this Contract's Transition Term, utilizing the format contained in this Appendix P and include other applicable Contract terms and conditions. (2) Items in brackets [ ] below are provided for

  5. Microsoft Word - SEC J_Appendix C - Contractor's Transition Plan_Negotiated

    National Nuclear Security Administration (NNSA)

    C, Page 1 SECTION J APPENDIX C CONTRACTOR'S TRANSITION PLAN Plan: As attached below. Guidance: The Contractor shall submit a Transition Plan that describes the process, details, and schedule for providing an orderly transition during the Contract's Transition Term stated in Section F, F-2, Period of Performance, in accordance with the guidance herein for all elements of Section J, Appendix A, Statement of Work, Chapter II Work Scope Structure. The objectives of the Transition Plan are: to

  6. Microsoft Word - SEC J_Appendix O - Program Mgt and Cost Reports and Government_Negotiated

    National Nuclear Security Administration (NNSA)

    O, Page 1 SECTION J APPENDIX O PROGRAM MANAGEMENT AND COST REPORTS The Contractor shall submit periodic cost, schedule, and technical performance plans and reports in such form and substance as required by the Contracting Officer. Reference Section J, Appendix A, Statement of Work, Chapter I, 4.2. Cost reports will include at a minimum: 1. Monthly general management reports to summarize schedule, labor, and cost plans and status, and provide explanations of status variances from plans. The

  7. Appendix C. Part 303 Wetland Permit Application, Wetland Impact Assessment and Compensatory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Part 303 Wetland Permit Application, Wetland Impact Assessment and Compensatory Mitigation Proposal DOE/EA-1709 C-1 APPENDIX C. PART 303 WETLAND PERMIT APPLICATION, WETLAND IMPACT ASSESSMENT AND COMPENSATORY MITIGATION PROPOSAL On January 28, 2010, Compact Power, Inc. submitted a Part 303 Wetland Permit Application, which contains a compensatory mitigation proposal, to the Michigan Department of Natural Resources and Environment. The application and proposal are contained in this appendix.

  8. GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions November ...

  9. Hidden benefits of electric vehicles for addressing climate change

    SciTech Connect (OSTI)

    Li, Canbing; Cao, Yijia; Zhang, Mi; Wang, Jianhui; Liu, Jianguo; Shi, Haiqing; Geng, Yinghui

    2015-03-19

    There is an increasingly hot debate on whether the replacement of conventional vehicles (CVs) by electric vehicles (EVs) should be delayed or accelerated since EVs require higher cost and cause more pollution than CVs in the manufacturing process. Here we reveal two hidden benefits of EVs for addressing climate change to support the imperative acceleration of replacing CVs with EVs. As EVs emit much less heat than CVs within the same mileage, the replacement can mitigate urban heat island effect (UHIE) to reduce the energy consumption of air conditioners, benefitting local and global climates. To demonstrate these effects brought by the replacement of CVs by EVs, we take Beijing, China, as an example. EVs emit only 19.8% of the total heat emitted by CVs per mile. The replacement of CVs by EVs in 2012 could have mitigated the summer heat island intensity (HII) by about 0.94°C, reduced the amount of electricity consumed daily by air conditioners in buildings by 14.44 million kilowatt-hours (kWh), and reduced daily CO₂ emissions by 10,686 tonnes.

  10. Addressing Energy Demand through Demand Response. International Experiences and Practices

    SciTech Connect (OSTI)

    Shen, Bo; Ghatikar, Girish; Ni, Chun Chun; Dudley, Junqiao; Martin, Phil; Wikler, Greg

    2012-06-01

    Demand response (DR) is a load management tool which provides a cost-effective alternative to traditional supply-side solutions to address the growing demand during times of peak electrical load. According to the US Department of Energy (DOE), demand response reflects “changes in electric usage by end-use customers from their normal consumption patterns in response to changes in the price of electricity over time, or to incentive payments designed to induce lower electricity use at times of high wholesale market prices or when system reliability is jeopardized.” 1 The California Energy Commission (CEC) defines DR as “a reduction in customers’ electricity consumption over a given time interval relative to what would otherwise occur in response to a price signal, other financial incentives, or a reliability signal.” 2 This latter definition is perhaps most reflective of how DR is understood and implemented today in countries such as the US, Canada, and Australia where DR is primarily a dispatchable resource responding to signals from utilities, grid operators, and/or load aggregators (or DR providers).

  11. Software programs that address site-specific inventory characteristics issues.

    SciTech Connect (OSTI)

    Dare, J. H.; Cournoyer, M. E.

    2001-01-01

    The proper characterization of Hazardous, Mixed Low-Level, and Mixed Transuranic waste enhances productivity and safety. Hazardous material criteria that need to be considered include physical and health hazards inherent to the waste stream. Other factors that may influence characterization include: particulate diameter, complexing or chelating agent properties, lead, and mercury content, pressurized containers, and P-listed wastes. To meet these requirements are only a simple matter of generating a database with the proper fields. Manufactures and institutional databases bank huge sources of information, such as, work control documents, substance identification, container types, components of mixtures, physical property data, and regulatory data. In this report, utilization of commercially available software programs to take advantage of these resources in addressing waste characterization issues are presented. The application of user-friendly programs eliminates part of the tediousness associated with the complex requirements of certifying to general waste acceptance criteria with minimal impact on programmatic work. In other words, tapping into manufacturer and institutional database provides a way to take advantage of the combined expertise of these resources in managing a cost effective waste certification program as well as adding a quality assurance element to the program.

  12. Addressing the Need for Independence in the CSE Model

    SciTech Connect (OSTI)

    Abercrombie, Robert K; Ferragut, Erik M; Sheldon, Frederick T; Grimaila, Michael R

    2011-01-01

    Abstract Information system security risk, defined as the product of the monetary losses associated with security incidents and the probability that they occur, is a suitable decision criterion when considering different information system architectures. Risk assessment is the widely accepted process used to understand, quantify, and document the effects of undesirable events on organizational objectives so that risk management, continuity of operations planning, and contingency planning can be performed. One technique, the Cyberspace Security Econometrics System (CSES), is a methodology for estimating security costs to stakeholders as a function of possible risk postures. In earlier works, we presented a computational infrastructure that allows an analyst to estimate the security of a system in terms of the loss that each stakeholder stands to sustain, as a result of security breakdowns. Additional work has applied CSES to specific business cases. The current state-of-the-art of CSES addresses independent events. In typical usage, analysts create matrices that capture their expert opinion, and then use those matrices to quantify costs to stakeholders. This expansion generalizes CSES to the common real-world case where events may be dependent.

  13. Hidden benefits of electric vehicles for addressing climate change

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Li, Canbing; Cao, Yijia; Zhang, Mi; Wang, Jianhui; Liu, Jianguo; Shi, Haiqing; Geng, Yinghui

    2015-03-19

    There is an increasingly hot debate on whether the replacement of conventional vehicles (CVs) by electric vehicles (EVs) should be delayed or accelerated since EVs require higher cost and cause more pollution than CVs in the manufacturing process. Here we reveal two hidden benefits of EVs for addressing climate change to support the imperative acceleration of replacing CVs with EVs. As EVs emit much less heat than CVs within the same mileage, the replacement can mitigate urban heat island effect (UHIE) to reduce the energy consumption of air conditioners, benefitting local and global climates. To demonstrate these effects brought bymore » the replacement of CVs by EVs, we take Beijing, China, as an example. EVs emit only 19.8% of the total heat emitted by CVs per mile. The replacement of CVs by EVs in 2012 could have mitigated the summer heat island intensity (HII) by about 0.94°C, reduced the amount of electricity consumed daily by air conditioners in buildings by 14.44 million kilowatt-hours (kWh), and reduced daily CO₂ emissions by 10,686 tonnes.« less

  14. IMPACTS: Industrial Technologies Program, Summary of Program Results for CY2009, Appendix 1: ITP-Sponsored Technologies Commercially Available

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    15 DOE Industrial Technologies Program Appendix 1: ITP-Sponsored Technologies Commercially Available Aluminum ........................................................................................................................................... 19 u Aluminum Reclaimer for Foundry Applications .................................................................................................................................. 20 u Isothermal

  15. Contract No. DE-AC02-09CH11466 Section J - Appendix F J-F-1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    52 Contract No. DE-AC02-09CH11466 Section J - Appendix F J-F-1 Attachment J.6 APPENDIX F Contractor Resources, Commitments, and Agreements Contract No. DE-AC02-09CH11466 Modification No. 0152 Contract No. DE-AC02-09CH11466 Section J - Appendix F J-F-2 This page intentionally blank Modification No. 0152 Contract No. DE-AC02-09CH11466 Section J - Appendix F J-F-3 RESOURCES, SERVICES, AND SUPPORT PROVIDED TO PPPL Princeton University has committed substantial resources and services over the first

  16. Existing technology transfer report: analytical capabilities. Appendix B. Volume 3

    SciTech Connect (OSTI)

    Tewari, K.C.

    1984-06-01

    The overall objective of the on-going analytical efforts was to develop in-house expertise and analytical capability for the analysis of coal and coal-derived products in support of SRC-I process technology. The approach taken and work accomplished involved: identification of test methods and associated equipment; review and implementation of analytical facility plan; evaluation of existing instrumentation; evaluation and purchase of new instruments; training of laboratory personnel; validation or development of analytical methods; development of standard product work-up methods and development of analytical protocol for detailed characterization of SRC-I solid and liquid products. This volume contains Appendix B with the following attachments: solvent separation procedure A; Wilsonville solvent separation procedure, distillation separation procedure; solvent separation modified Wilsonville Procedure W; statistical comparison of 3 solvent separation procedures; methods development for column chromatography, and application of gas chromatography to characterization of a hydrogen donor solvent; and high performance liquid chromatographic procedure.

  17. Appendix MgO: Magnesium Oxide as an Engineered Barrier

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MgO-2014 Magnesium Oxide as an Engineered Barrier United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Compliance Recertification Application 2014 Appendix MgO-2014 Table of Contents MgO-1.0 Introduction MgO-2.0 Description of the Engineered Barrier System MgO-2.1 Emplacement of MgO MgO-2.1.1 Supersacks MgO-2.1.2 Minisacks MgO-2.1.3 Use of Racks to Emplace Additional MgO MgO-2.1.4 Changes since the CRA-2009 MgO-2.2 MgO Vendors MgO-3.0

  18. Regulatory approaches for addressing dissolved oxygen concerns at hydropower facilities

    SciTech Connect (OSTI)

    Peterson, Mark J.; Cada, Glenn F.; Sale, Michael J.; Eddlemon, Gerald K.

    2003-03-01

    Low dissolved oxygen (DO) concentrations are a common water quality problem downstream of hydropower facilities. At some facilities, structural improvements (e.g. installation of weir dams or aerating turbines) or operational changes (e.g., spilling water over the dam) can be made to improve DO levels. In other cases, structural and operational approaches are too costly for the project to implement or are likely to be of limited effectiveness. Despite improvements in overall water quality below dams in recent years, many hydropower projects are unable to meet state water quality standards for DO. Regulatory agencies in the U.S. are considering or implementing dramatic changes in their approach to protecting the quality of the Nations waters. New policies and initiatives have emphasized flexibility, increased collaboration and shared responsibility among all parties, and market-based, economic incentives. The use of new regulatory approaches may now be a viable option for addressing the DO problem at some hydropower facilities. This report summarizes some of the regulatory-related options available to hydropower projects, including negotiation of site-specific water quality criteria, use of biological monitoring, watershed-based strategies for the management of water quality, and watershed-based trading. Key decision points center on the health of the local biological communities and whether there are contributing impacts (i.e., other sources of low DO effluents) in the watershed. If the biological communities downstream of the hydropower project are healthy, negotiation for site-specific water quality standards or biocriteria (discharge performance criteria based on characteristics of the aquatic biota) might be pursued. If there are other effluent dischargers in the watershed that contribute to low DO problems, watershed-scale strategies and effluent trading may be effective. This report examines the value of regulatory approaches by reviewing their use in other

  19. Addressing Water Consumption of Evaporative Coolers with Greywater

    SciTech Connect (OSTI)

    Sahai, Rashmi; Shah, Nihar; Phadke, Amol

    2012-07-01

    Evaporative coolers (ECs) provide significant gains in energy efficiency compared to vapor compression air conditioners, but simultaneously have significant onsite water demand. This can be a major barrier to deployment in areas of the world with hot and arid climates. To address this concern, this study determined where in the world evaporative cooling is suitable, the water consumption of ECs in these cities, and the potential that greywater can be used reduce the consumption of potable water in ECs. ECs covered 69percent of the cities where room air conditioners are may be deployed, based on comfort conditions alone. The average water consumption due to ECs was found to be 400 L/household/day in the United States and Australia, with the potential for greywater to provide 50percent this amount. In the rest of the world, the average water consumption was 250 L/household/day, with the potential for greywater to supply 80percent of this amount. Home size was the main factor that contributed to this difference. In the Mediterranean, the Middle East, Northern India, and the Midwestern and Southwestern United States alkalinity levels are high and water used for bleeding will likely contribute significantly to EC water consumption. Although technically feasible, upfront costs for household GW systems are currently high. In both developed and developing parts of the world, however, a direct EC and GW system is cost competitive with conventional vapor compression air conditioners. Moreover, in regions of the world that face problems of water scarcity the benefits can substantially outweigh the costs.

  20. Appendix I - GPRA06 solar energy technologies program documentation

    SciTech Connect (OSTI)

    None, None

    2009-01-18

    This appendix provides detailed information on the assumptions and methods employed to estimate the benefits of EEREs Solar Energy Technologies Program. The benefits analysis for the Solar Program utilized both NEMS and MARKAL as the analytical tools for estimating the Programs benefits. As will be discussed below, a number of assumptions and structural modifications to the models were made in order to represent the suite of solar technologies funded by the program as accurately as possible (Photovoltaics, Concentrating Solar Power and Solar Water Heating). Many of the assumptions used in the FY06 analysis are the same as or similar to those employed in the FY05 analysis; however, two key changes are important to highlight up-front. First, the AEO2004 analysis used a new set of reference case assumptions with respect to photovoltaic technology cost reductions. The new sets of reference case assumptions are very similar to the Solar Programs targets for PV. This shift in assumptions necessitated developing a new approach for estimating the baseline (i.e., no program) input assumptions for PV. Second, the FY06 analysis included CSP technology benefits CSP benefits were not included in the FY05 analysis.

  1. Join @Energy for the 2015 State of the Union Address | Department...

    Energy Savers [EERE]

    Join @Energy for the 2015 State of the Union Address Join @Energy for the 2015 State of the Union Address January 20, 2015 - 12:08pm Addthis Join us for live coverage of the State...

  2. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges. RedSeal Comments ...

  3. GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges GridWise Alliance: Smart Grid RFI: Addressing Policy and Logistical Challenges The GridWise Alliance ...

  4. Comments of DRSG to DOE Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DRSG to DOE Smart Grid RFI: Addressing Policy and Logistical Challenges Comments of DRSG to DOE Smart Grid RFI: Addressing Policy and Logistical Challenges In light of the fact ...

  5. U-115: Novell GroupWise Client Address Book Processing Buffer Overflow Vulnerability

    Broader source: Energy.gov [DOE]

    The vulnerability is caused due to an error when processing Novell Address Book (".nab") files and can be exploited to cause a heap-based buffer overflow via an overly long email address.

  6. 2014 SunShot Initiative Portfolio Book: Appendix of SunShot Funding

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Programs | Department of Energy Appendix of SunShot Funding Programs 2014 SunShot Initiative Portfolio Book: Appendix of SunShot Funding Programs The 2014 SunShot Initiative Portfolio Book outlines the progress towards the goals outlined in the SunShot Vision Study. Contents include overviews of each of SunShot's five subprogram areas, as well as a description of every active project in the SunShot's project portfolio as of May 2014. This section provides an index list of every active

  7. Final New England Clean Power Link Project Environmental Impact Statement Appendix A-B

    Energy Savers [EERE]

    A U.S. Department of Energy October 2015 A-1 APPENDIX A SCOPING SUMMARY REPORT Final New England Clean Power Link EIS Appendix A U.S. Department of Energy October 2015 A-2 This Page Intentionally Left Blank SCOPING SUMMARY REPORT NEW ENGLAND CLEAN POWER LINK TRANSMISSION LINE PROJECT ENVIRONMENTAL IMPACT STATEMENT U.S. Department of Energy Office of Electricity Delivery and Energy Reliability Washington, DC 20585 Cooperating Agencies: U.S. Environmental Protection Agency U.S. Army Corps of

  8. Technical Appendix for Development for Modified Streamflows 1928-1989 : Columbia River & Coastal Basin.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration; A.G. Crook Company

    1993-06-01

    The report ``Adjusted Streamflow and Storage 1928-1989`` contains listings of historical flows for the sites in the Columbia River and Coastal Basins. This section of the Technical Appendix provides for the site specific procedures used to determine those historical flows. The study purpose, authority, and definitions are given in the main report. The purpose of this section of the Technical Appendix is to document the computational procedures used at each of the project sites to develop historical flows for the period July 1928--September 1989.

  9. Keynote Address

    Broader source: Energy.gov [DOE]

    An overview and update on Environmental Management given by Alice Williams, Associate Principal Deputy Assistant Secretary of the Office of Environmental Management.

  10. Keynote Address

    Office of Environmental Management (EM)

    Planning & Policy EM-41 Safety Management EM-42 ... transuranic waste Moab (UT): Dispose of nearly ... 3.Water Resources 4.Human Health 5.Ecology 6.Socioeconomics ...

  11. 5-address

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  12. Columbia River System Operation Review : Final Environmental Impact Statement, Appendix J: Recreation.

    SciTech Connect (OSTI)

    Columbia River System Operation Review

    1995-11-01

    This Appendix J of the Final Environmental Impact Statement for the Columbia River System discusses impacts on the recreational activities in the region. Major sections include the following: scope and processes; recreation in the Columbia River Basin today - by type, location, participation, user characteristics, factors which affect usage, and managing agencies; recreation analysis procedures and methodology; and alternatives and their impacts.

  13. Data summary of municipal solid waste management alternatives. Volume 4, Appendix B: RDF technologies

    SciTech Connect (OSTI)

    1992-10-01

    This appendix contains background information, technical descriptions, economic data, mass and energy balances, and information on environmental releases for the refuse derived fuels (RDF) option in municipal solid waste management alternatives. Demonstration programs at St. Louis, Missouri; Franklin, Ohio; and Delaware are discussed. Information on pellet production and cofiring with coal is also presented.

  14. Special nuclear materials cutoff exercise: Issues and lessons learned, Volume 2 of 3: Appendixes A - C

    SciTech Connect (OSTI)

    Libby, R.A.; Davis, C.; Segal, J.E.; Stanbro, W.D.

    1995-08-01

    This document is the 2nd volume of the three volume set from the Special Nuclear Materials Cutoff Exercise held at Hanford in 1994. Volume 2 contains Appendices A-C, with Appendices A and B containing a discussion of the design of the PUREX process and Appendix C containing a discussion of the safeguards measures for the PUREX facility.

  15. GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Questions | Department of Energy GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions November 23, 2015 - 2:57pm Addthis GREET Model Expanded to Better Address Biofuel Life-Cycle Analysis Research Questions The Greenhouse gases, Regulated Emissions, and Energy use in Transportation (GREET) model allows researchers and analysts to fully evaluate the energy and emission

  16. U.S. Energy Secretary Addresses International Atomic Energy Agency General

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy Addresses International Atomic Energy Agency General Conference U.S. Energy Secretary Addresses International Atomic Energy Agency General Conference September 19, 2011 - 4:48pm Addthis VIENNA, AUSTRIA - U.S. Energy Secretary Steven Chu addressed the International Atomic Energy Agency's General Conference today in Vienna. Opening with a message from President Barack Obama, Secretary Chu highlighted the importance of safety and security in the nuclear

  17. NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Implementation. September 10, 2009 | Department of Energy NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 The Telecommunications Industry Association (TIA) is pleased to provide comments on how to address the numerous challenges facing the development and deployment of smart grid technologies. Smart grid is a more robust application of

  18. Response to Request for Information titled "Addressing Policy and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Logistical Challenges to Smart Grid Implementation" | Department of Energy to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation." urrent smart grid initiatives are

  19. U-237: Mozilla Firefox CVE-2012-1950 Address Bar URI Spoofing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addthis PROBLEM: Mozilla Firefox CVE-2012-1950 Address Bar URI Spoofing Vulnerability PLATFORM: Version(s): Mozilla Firefox 6 - 12 ABSTRACT: To exploit this issue, an attacker...

  20. Challenges to be Addressed | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Challenges to be Addressed Advanced Scientific Computing Research (ASCR) ASCR Home About Research Applied Mathematics Computer Science Exascale Tools Workshop Programming ...

  1. JLab Will Begin Testing its Public Address System on a Monthly Basis |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jefferson Lab Will Begin Testing its Public Address System on a Monthly Basis On April 20, Jefferson Lab Will Begin Testing its Public Address System on a Monthly Basis On Wednesday, April 20, Jefferson Lab will begin conducting a monthly test of its Public Address (PA) System - the live audible announcement feature - available through the lab's Cisco phones. Starting on April 20, these tests will occur at 5:30 p.m. on the third Wednesday of each month. The Public Address System may be used

  2. RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MBG Auditorium RE-SCHEDULED FROM JAN 22 TO JAN 28 - COLLOQUIUM: Addressing Big Data Challenges in Simulation-based Science Professor Manish Parashar Rutgers University ...

  3. Addressing the Challenges of RCCI Operation on a Light-Duty Multi-Cylinder Engine

    Broader source: Energy.gov [DOE]

    ORNL and UW collaboration in evaluating and developing RCCI operation in fully built multi-cylinder engine to address hardware, aftertreatment, and control challenges

  4. The Lessons of Practice: Domestic Policy Reform as a Way to Address...

    Open Energy Info (EERE)

    Lessons of Practice: Domestic Policy Reform as a Way to Address Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: The Lessons of Practice: Domestic Policy...

  5. Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Galvin Electricity Initiative DOE RFI DOE RFI 2010-23251: Addressing Policy and Logistical Challenges to Smart Grid Implementation Galvin Electricity Initiative DOE RFI DOE RFI ...

  6. Addressing the Challenges of RCCI Operation on a Light-Duty Multi...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ORNL and UW collaboration in evaluating and developing RCCI operation in fully built multi-cylinder engine to address hardware, aftertreatment, and control challenges PDF icon ...

  7. Genes and Genomics for Improving Energy Crops (Keynote Address - 2010 JGI User Meeting)

    ScienceCinema (OSTI)

    Pennell, Roger

    2011-04-28

    Roger Pennell, Vice President of Trait Development at Ceres, Inc., delivers a keynote address at the 5th Annual DOE JGI User Meeting on March 25, 2010

  8. Potential enhancements to addressing programmatic risk in the tank waste remediation system (TWRS) program

    SciTech Connect (OSTI)

    Brothers, A.; Fassbender, L.; Bilyard, G.; Levine, L.

    1996-04-01

    Pacific Northwest National Laboratory (PNNL) conducted a Tank Waste Remediation System (TWRS) Risk Management methodology development task. The objective of this task was to develop risk management methodology focused on (1) the use of programmatic risk information in making TWRS architecture selection decisions and (2) the identification/evaluation/selection of TWRS risk-handling actions. Methods for incorporating programmatic risk/uncertainty estimates into trade studies are provided for engineers/analysts. Methods for identifying, evaluating, and selecting risk-handling actions are provided for managers. The guidance provided in this report is designed to help decision-makers make difficult judgments. Current approaches to architecture selection decisions and identification/evaluation/selection of risk-handling actions are summarized. Three categories of sources of programmatic risk (parametric, external, and organizational) are examined. Multiple analytical approaches are presented to enhance the current alternative generation and analysis (AGA) and risk-handling procedures. Appendix A describes some commercially available risk management software tools and Appendix B provides a brief introduction to quantification of risk attitudes. The report provides three levels of analysis for enhancing the AGA Procedure: (1) qualitative discussion coupled with estimated uncertainty ranges for scores in the alternatives-by-criteria matrix; (2) formal elicitation of probability distributions for the alternative scores; and (3) a formal, more structured, comprehensive risk analysis. A framework is also presented for using the AGA programmatic risk analysis results in making better decisions. The report also presents two levels of analysis for evaluation and selection of risk-handling actions: (1) qualitative analysis and judgmental rankings of alternative actions, and (2) Simple Multi-Attribute Rating Technique (SMART).

  9. Microsoft Word - Appendix C - Soil Disturbance Evaluation Procedure.docx

    Office of Legacy Management (LM)

    Rocky Flats Site Soil Disturbance Evaluation Procedure This page intentionally left blank U.S. Department of Energy Rocky Flats Site Operations Guide July 2013 Doc. No. S03037-6.0 Page C-1 Soil Disturbance Evaluation Process Purpose: The purpose of this Soil Disturbance Evaluation Process is to identify hazards and regulatory requirements so that appropriate work control steps, including regulatory agency and/or engineering approvals, are implemented to address and mitigate the hazard and/or

  10. Remedial investigation/feasibility study for the David Witherspoon, Inc., 901 Site, Knoxville, Tennessee: Volume 2, Appendixes

    SciTech Connect (OSTI)

    1996-10-01

    This document contains the appendixes for the remedial investigation and feasibility study for the David Witherspoon, Inc., 901 site in Knoxville, Tennessee. The following topics are covered in the appendixes: (A) David Witherspoon, Inc., 901 Site Historical Data, (B) Fieldwork Plans for the David Witherspoon, Inc., 901 Site, (C) Risk Assessment, (D) Remediation Technology Discussion, (E) Engineering Support Documentation, (F) Applicable or Relevant and Appropriate Requirements, and (G) Cost Estimate Documentation.

  11. Recommendations to Address Power Reliability Concerns Raised as a Result of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pending Environmental Regulations for Electric Generation Stations | Department of Energy to Address Power Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Memorandum from the Electricity Advisory Committee to Secretary Chu and Assistant Secretary Patricia Hoffman on recommendations to

  12. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  13. Groundwater heat pumps: an examination of hydrogeologic, environmental, legal, and economic factors affecting their use. Volume II. Appendix D, state hydrogeologic descriptions and maps

    SciTech Connect (OSTI)

    Armitage, Dana M.; Bacon, Douglas J.; Massey-Norton, John T.; Miller, James M.

    1980-11-01

    This appendix to the groundwater heat pump report contains hydrogeologic descriptions of the 48 conterminous US with data on ground water quality.

  14. Multi-Path Transportation Futures Study: Vehicle Characterization and Scenario Analyses. Appendix E. Other NEMS-MP Results or the Base Case and Scenarios

    SciTech Connect (OSTI)

    Plotkin, Steve; Singh, Margaret; Patterson, Phil; Ward, Jake; Wood, Frances; Kydes, Niko; Holte, John; Moore, Jim; Miller, Grant; Das, Sujit; Greene, David

    2009-07-22

    This appendix examines additional findings beyond the primary results reported in the report for Phase 2 of the Multi-Path Transportation Futures Study.

  15. Significant issues and changes for ANSI/ASME OM-1 1981, part 1, ASME OMc code-1994, and ASME OM Code-1995, Appendix I, inservice testing of pressure relief devices in light water reactor power plants

    SciTech Connect (OSTI)

    Seniuk, P.J.

    1996-12-01

    This paper identifies significant changes to the ANSI/ASME OM-1 1981, Part 1, and ASME Omc Code-1994 and ASME OM Code-1995, Appendix I, {open_quotes}Inservice Testing of Pressure Relief Devices in Light-Water Reactor Power Plants{close_quotes}. The paper describes changes to different Code editions and presents insights into the direction of the code committee and selected topics to be considered by the ASME O&M Working Group on pressure relief devices. These topics include scope issues, thermal relief valve issues, as-found and as-left set-pressure determinations, exclusions from testing, and cold setpoint bench testing. The purpose of this paper is to describe some significant issues being addressed by the O&M Working Group on Pressure Relief Devices (OM-1). The writer is currently the chair of OM-1 and the statements expressed herein represents his personal opinion.

  16. Vulnerability reduction study. Coal and synthetics (Section III a). Technical Appendix

    SciTech Connect (OSTI)

    Not Available

    1980-08-01

    This Appendix supports and explains key statements made in the chapter on Coal and Synthetics. The reader will find information and documentation on points that lend themselves to quantification. Evidence is presented that coal supply will not be constrained by production or transportation factors through the 1980s. Any program to increase the direct use of coal in the industrial sector must take into account a number of identifiable difficulties. A deployment schedule for 10 oil shale projects has been developed by the Office of Technology Assessment. This schedule, if adhered to, would result in an initial deployment of an oil shale industry of 400,000 bpd oil equivalent by 1990. In addition, the Appendix provides descriptions of those major elements of Federal legislation that bear directly on coal, notably portions of the Powerplant and Industrial Fuel Use Act of 1978, the Energy Tax Act of 1978, the Energy Security Act of 1980, and the Clean Air Act.

  17. Puget Sound Area Electric Reliability Plan. Appendix B : Local Generation Evaluation : Draft Environmental Impact Statement.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration.

    1991-09-01

    The information and data contained in this Appendix was extracted from numerous sources. The principle sources used for technical data were Bonneville Power Administration's 1990 Resource Program along with its technical appendix, and Chapter 8 of the Draft 1991 Northwest Conservation and Electric Power Plan. All cost data is reported 1988 dollars unless otherwise noted. This information was supplemented by other data developed by Puget Sound utilities who participated on the Local Generation Team. Identifying generating resources available to the Puget Sound area involved a five step process: (1) listing all possible resources that might contribute power to the Puget Sound area, (2) characterizing the technology/resource status, cost and operating characteristics of these resources, (3) identifying exclusion criteria based on the needs of the overall Puget Sound Electric Reliability Plan study, (4) applying these criteria to the list of resources, and (5) summarizing of the costs and characteristics of the final list of resources. 15 refs., 20 tabs.

  18. U.S.-China Clean Energy Research Center Issues Solicitation to Address the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Water Nexus | Department of Energy China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus U.S.-China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus March 4, 2015 - 4:31pm Addthis News Media Contact 202 586 4940 DOENews@hq.doe.gov U.S.-China Clean Energy Research Center Issues Solicitation to Address the Energy-Water Nexus WASHINGTON - Today the U.S. Department of Energy (DOE) issued a $12.5 million Funding

  19. When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! When the Internet Runs Out of Addresses, It'll be IPv6 to the Rescue! June 8, 2011 - 5:25pm Addthis Wendy Wolfson Tsabba Communications Specialist, Lawrence Berkeley National Laboratory What does this mean for me? There are "only" 3.2 billion unique addresses available across the Internet and we are quickly approaching that limit. Network engineers have been working on a new protocol called

  20. Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation

    Energy Savers [EERE]

    | Department of Energy Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation Second Five-Year Plan to Address Uranium Contamination in the Navajo Nation April 3, 2015 - 4:31pm Addthis What does this project do? Goal 1. Protect human health and the environment. Federal agencies recently completed a second Five-Year Plan to address uranium contamination on the Navajo Nation, which follows a progress report on the first plan that was initiated in January 2007. Contributing