National Library of Energy BETA

Sample records for mail stop ei-23

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  3. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  5. Alternative Fuels Data Center: Truck Stop Electrification Site Data

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Collection Methods Tools Printable Version Share this resource Send a link to Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods to someone by E-mail Share Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods on Facebook Tweet about Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods on Twitter Bookmark Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods

  6. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  7. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  8. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  9. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  10. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  11. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  12. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  13. Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Trucks Truck Stop Electrification for Heavy-Duty Trucks to someone by E-mail Share Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Facebook Tweet about Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Twitter Bookmark Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Google Bookmark Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Delicious Rank Alternative

  14. Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Conserve Fuel Printable Version Share this resource Send a link to Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations to someone by E-mail Share Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Facebook Tweet about Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Twitter Bookmark Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Google Bookmark Alternative Fuels Data Center: U.S. Truck Stop

  15. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  16. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  17. Full Hybrid: Stopped

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Braking button Stopped button STOPPED When the vehicle is stopped, such as at a red light, the gasoline engine and electric motor shut off automatically so that energy is not wasted in idling. All other systems, including the electric air conditioning, continue to run. stage graphic: vertical blue rule Main stage: See through car with battery, engine, generator, power split device, and electric motor visible. the car is stopped at an intersection. Main stage: See through car with battery,

  18. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  19. Stop/Start: Overview

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    highlighted Driving button Braking button subbanner graphic: gray bar OVERVIEW Stop/Start hybrids are not true hybrids since electricity from the battery is not used to propel the vehicle. However, the Stop/Start feature is an important, energy-saving building block used in hybrid vehicles. Stop/Start technology conserves energy by shutting off the gasoline engine when the vehicle is at rest, such as at a traffic light, and automatically re-starting it when the driver pushes the gas pedal to go

  20. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  1. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  2. Sneaky light stop

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Eifert, Till; Nachman, Benjamin


    A light supersymmetric top quark partner (stop) with a mass nearly degenerate with that of the standard model (SM) top quark can evade direct searches. The precise measurement of SM top properties such as the cross-section has been suggested to give a handle for this ‘stealth stop’ scenario. We present an estimate of the potential impact a light stop may have on top quark mass measurements. The results indicate that certain light stop models may induce a bias of up to a few GeV, and that this effect can hide the shift in, and hence sensitivity from, cross-section measurements. Duemore » to the different initial states, the size of the bias is slightly different between the LHC and the Tevatron. The studies make some simplifying assumptions for the top quark measurement technique, and are based on truth-level samples.« less

  3. Quick stop device

    DOE Patents [OSTI]

    Hipwell, Roger L. (35 Hounds Ditch La., Duxbury, MA 02332); Hazelton, Andrew J. (3877 Army St., San Francisco, CA 94131)


    A quick stop device for abruptly interrupting the cutting of a workpiece by a cutter is disclosed. The quick stop device employs an outer housing connected to an inner workpiece holder by at least one shear pin. The outer housing includes an appropriate shank designed to be received in the spindle of a machine, such as a machine tool. A cutter, such as a drill bit, is mounted in a stationary position and the workpiece, mounted to the workpiece holder, is rotated during engagement with the cutter. A trigger system includes at least one spring loaded punch disposed for movement into engagement with the workpiece holder to abruptly stop rotation of the workpiece holder. This action shears the shear pin and permits continued rotation of the spindle and outer housing without substantially disturbing the chip root formed during cutting.

  4. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  5. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  6. Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New York Times covers "National Labs Race to Stop Iran" May 15, 2015 National labs race to stop Iran Given the stakes in the sensitive negotiations with Iran, the labs would...

  7. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  8. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  9. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  10. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  11. Mixing stops at the LHC

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Agrawal, Prateek; Frugiuele, Claudia


    We study the phenomenology of a light stop NLSP in the presence of large mixing with either the first or the second generation. R-symmetric models provide a prime setting for this scenario, but our discussion also applies to the MSSM when a significant amount of mixing can be accommodated. In our framework the dominant stop decay is through the flavor violating mode into a light jet and the LSP in an extended region of parameter space. There are currently no limits from ATLAS and CMS in this region. We emulate shape-based hadronic SUSY searches for this topology, and find thatmore » they have potential sensitivity. If the extension of these analyses to this region is robust, we find that these searches can set strong exclusion limits on light stops. If not, then the flavor violating decay mode is challenging and may represent a blind spot in stop searches even at 13 TeV. Thus, an experimental investigation of this scenario is well motivated.« less

  12. Stopping power: Effect of the projectile deceleration

    SciTech Connect (OSTI)

    Kompaneets, Roman Ivlev, Alexei V.; Morfill, Gregor E.


    The stopping force is the force exerted on the projectile by its wake. Since the wake does not instantly adjust to the projectile velocity, the stopping force should be affected by the projectile deceleration caused by the stopping force itself. We address this effect by deriving the corresponding correction to the stopping force in the cold plasma approximation. By using the derived expression, we estimate that if the projectile is an ion passing through an electron-proton plasma, the correction is small when the stopping force is due to the plasma electrons, but can be significant when the stopping force is due to the protons.

  13. Apparatus for stopping a vehicle

    DOE Patents [OSTI]

    Wattenburg, Willard H.; McCallen, David B.


    An apparatus for externally controlling one or more brakes on a vehicle having a pressurized fluid braking system. The apparatus can include a pressurizable vessel that is adapted for fluid-tight coupling to the braking system. Impact to the rear of the vehicle by a pursuit vehicle, shooting a target mounted on the vehicle or sending a signal from a remote control can all result in the fluid pressures in the braking system of the vehicle being modified so that the vehicle is stopped and rendered temporarily inoperable. A control device can also be provided in the driver's compartment of the vehicle for similarly rendering the vehicle inoperable. A driver or hijacker of the vehicle preferably cannot overcome the stopping action from the driver's compartment.

  14. NREL: Transportation Research - Truck Stop Electrification Testing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Truck Stop Electrification Testing Photo of series of truck stop electrification pedestals near highway with heavy-duty truck parked in the background. NREL is monitoring the use of truck stop electrification sites across the nation. Photo courtesy of Shorepower Technologies NREL's fleet test and evaluation team is evaluating and documenting the use of 50 truck stop electrification (TSE) sites along the busiest transportation corridors in the United States. Truck drivers typically idle their

  15. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  16. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  17. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  18. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  19. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  20. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  1. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  2. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  3. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  4. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  5. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  6. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  7. Quality Procedure - Stop Work | Department of Energy

    Energy Savers [EERE]

    Stop Work Quality Procedure - Stop Work This Quality Procedure establishes the Office of Standards and Quality Assurance authority, responsibilities, and instructions to direct that unsafe work be stopped, during the execution and operations of its activities, specifically in oversight activities. this procedure is utilized and accomplished upon coordination with management of the Environmental Management (EM) Headquarters and Field Office. This procedure also provides provisions for the restart

  8. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  9. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  10. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  11. Boondocks Truck Stop Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    In Service Owner Boondocks Truck Stop Energy Purchaser Boondocks Truck Stop Location IA Coordinates 42.4703, -93.5624 Show Map Loading map... "minzoom":false,"mappingservi...

  12. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  13. Epoxy bond and stop etch fabrication method

    DOE Patents [OSTI]

    Simmons, Jerry A.; Weckwerth, Mark V.; Baca, Wes E.


    A class of epoxy bond and stop etch (EBASE) microelectronic fabrication techniques is disclosed. The essence of such techniques is to grow circuit components on top of a stop etch layer grown on a first substrate. The first substrate and a host substrate are then bonded together so that the circuit components are attached to the host substrate by the bonding agent. The first substrate is then removed, e.g., by a chemical or physical etching process to which the stop etch layer is resistant. EBASE fabrication methods allow access to regions of a device structure which are usually blocked by the presence of a substrate, and are of particular utility in the fabrication of ultrafast electronic and optoelectronic devices and circuits.

  14. Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New York Times covers "National Labs Race to Stop Iran" May 15, 2015 National labs race to stop Iran Given the stakes in the sensitive negotiations [with Iran], the labs would check and recheck one another, making sure the answers held up. The natural rivalries among the labs sometimes worked to the negotiators' advantage: Los Alamos National Laboratory, in the mountains of New Mexico, the birthplace of the bomb, was happy to find flaws in calculations done elsewhere, and vice versa.

  15. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  16. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  17. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  18. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  19. Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades...

    Office of Environmental Management (EM)

    Your One Stop Shop for Energy Efficiency Upgrades Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades This is a presentation from Energy Impact Illinois posted on the...

  20. Searching for Stopped Gluinos at CMS

    SciTech Connect (OSTI)

    Ratnikov, Fedor


    We describe plans for a search for long-lived particles which will become stopped by the CMS detector. We will look for the subsequent decay of these particles during time intervals where there are no pp collisions in CMS: during gaps between crossings in the LHC beam structure, and during inter-fill periods between the beam being dumped and re-injection. Such long living particles decays will be recorded with dedicated calorimeter triggers. For models predicting these particles, such as split-susy gluinos, the large cross-section combined with good stopping power of CMS, yields a significant number of triggerable decays. If LHC instantaneous luminosity approaches 10{sup 32} cm{sup -2}s{sup -1} in 2009-10, 5sigma significance can be established in a matter of days, since these decays occur on top of a negligible background.Due to limited size, this paper concentrates on main idea and expected results. More details are available in

  1. Stop Codon Reassignment in the Wild

    SciTech Connect (OSTI)

    Ivanova, Natalia; Schwientek, Patrick; Tripp, H. James; Rinke, Christian; Pati, Amrita; Huntemann, Marcel; Visel, Axel; Woyke, Tanja; Kyrpides, Nikos; Rubin, Edward


    Since the discovery of the genetic code and protein translation mechanisms (1), a limited number of variations of the standard assignment between unique base triplets (codons) and their encoded amino acids and translational stop signals have been found in bacteria and phages (2-3). Given the apparent ubiquity of the canonical genetic code, the design of genomically recoded organisms with non-canonical codes has been suggested as a means to prevent horizontal gene transfer between laboratory and environmental organisms (4). It is also predicted that genomically recoded organisms are immune to infection by viruses, under the assumption that phages and their hosts must share a common genetic code (5). This paradigm is supported by the observation of increased resistance of genomically recoded bacteria to phages with a canonical code (4). Despite these assumptions and accompanying lines of evidence, it remains unclear whether differential and non-canonical codon usage represents an absolute barrier to phage infection and genetic exchange between organisms. Our knowledge of the diversity of genetic codes and their use by viruses and their hosts is primarily derived from the analysis of cultivated organisms. Advances in single-cell sequencing and metagenome assembly technologies have enabled the reconstruction of genomes of uncultivated bacterial and archaeal lineages (6). These initial findings suggest that large scale systematic studies of uncultivated microorganisms and viruses may reveal the extent and modes of divergence from the canonical genetic code operating in nature. To explore alternative genetic codes, we carried out a systematic analysis of stop codon reassignments from the canonical TAG amber, TGA opal, and TAA ochre codons in assembled metagenomes from environmental and host-associated samples, single-cell genomes of uncultivated bacteria and archaea, and a collection of phage sequences

  2. Report on the first VLHC photon stop cryogenic design experiment

    SciTech Connect (OSTI)

    Michael Geynisman et al.


    As part of Fermilab's study of a Very Large Hadron Collider, a water-cooled photon stop was proposed as a device to intercept the synchrotron radiation emitted by the high-energy proton beams in the high field superconducting magnets with minimal plug-cooling power. Photon stops are radiation absorbers operating at room temperature that protrude into the beam tube at the end of each bending magnet to scrape the synchrotron light emitted by the beam one magnet up-stream. Among the technological challenges regarding photon stops is their cryo-design. The photon stop is water-cooled and operates in a cryogenic environment. A careful cryo-design is therefore essential to enable operation at minimum heat transfer between the room temperature sections and the cryogenic parts. A photon stop cryo-design was developed and a prototype was built. This paper presents the results of the cryogenic experiments conducted on the first VLHC photon stop prototype.

  3. Mobile Truck Stop Electrification Locator Now Available - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Mobile Truck Stop Electrification Locator Now Available Truck drivers can find idle reduction facilities using cell phones and PDAs September 15, 2009 The U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) expanded its suite of Web-based, fuel-efficiency tools by launching the Mobile Truck Stop Electrification Locator. This comprehensive mobile application helps truck drivers find public truck stops with idle reduction facilities using a cell phone,


    Energy Science and Technology Software Center (OSTI)


    STOPOW calculates a set of stopping power values and ranges of fast ions in matter for any materials. Furthermore STOPOW can calculate a set of values for one special auxiliary function (e.g. kinematic factors, track structure parameters, time of flight or correction factors in the stopping function) . The user chooses the physical units for stopping powers and ranges and the energy range for calculations.

  5. Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Your One Stop Shop for Energy Efficiency Upgrades Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades This is a presentation from Energy Impact Illinois posted on the website of the U.S. Department of Energy's Better Buildings Neighborhood Program. PDF icon Energy Savers from CNT Energy More Documents & Publications Energy Savers: A one-stop energy efficiency shop for multifamily building owners Energy Savers: Fireplaces


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  7. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  8. Fact #787: July 8, 2013 Truck Stop Electrification Reduces Idle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    heating, cooling and use of electrical appliances. Electrification at truck stops allows truckers to "plug-in" vehicles to operate the necessary systems without idling the engine. ...

  9. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  10. Nanomachines: How Viruses Work, and How We Can Stop Them

    ScienceCinema (OSTI)

    Carolyn Bertozzi


    Nature's Nasty Nanomachines: How Viruses Work, and How We Can Stop Them. Carolyn Bertozzi, director of Berkeley Lab's Molecular Foundry, discusses this topic at a Feb. 21, 2009 Nano*High talk.

  11. Subfreezing Start/Stop Protocol for and Advanced Metallic Open...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Subfreezing StartStop Protocol for and Advanced Metallic Open-Flowfield Fuel Cell Stack Part of a 100 million fuel cell award announced by DOE Secretary Bodman on Oct. 25, 2006. ...

  12. Fact #628: June 21, 2010 Truck Stop Electrification Sites

    Broader source: [DOE]

    Long haul truck drivers routinely idle their engines to heat or cool their cab during their rest period. (Federal laws require 10 hours of rest for every 11 hours on the road.) Truck Stop...

  13. Using laser-driven neutrons to stop nuclear smugglers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using laser-driven neutrons to stop nuclear smugglers Using laser-driven neutrons to stop nuclear smugglers Researchers have successfully demonstrated for the first time that laser-generated neutrons can be enlisted as a useful tool in the War on Terror. June 4, 2013 A burst of laser energy 50 times greater than the worldwide output of electrical power slams into an extremely thin foil target to produce neutrons at Los Alamos National Laboratory's TRIDENT laser facility during a recent

  14. New Truck Stop Electrification Station Maps Help Truckers Reduce Idling -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL New Truck Stop Electrification Station Maps Help Truckers Reduce Idling April 21, 2006 Golden, Colo. - A new internet-based mapping program is helping truckers find truck stops with idle reduction facilities-on-site systems that can substantially cut fuel use while reducing air emissions. Idle reduction systems hold great promise for the approximately 500,000 long-haul trucks with sleeper cabs currently operating in the United States. Estimates show idle reduction

  15. Newly Invented Shielding For Stopping Neutrons Cold | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Newly Invented Shielding For Stopping Neutrons Cold Newly Invented Shielding For Stopping Neutrons Cold NEWPORT NEWS, VA, Dec. 9, 2013 - When faced with the challenge of protecting sensitive scientific equipment and computers from radiation, engineers at the U.S. Department of Energy's Thomas Jefferson National Accelerator Facility decided to take matters into their own hands. They came up with three innovative products that could soon find their way to nuclear power plants, particle

  16. Nuclear stopping power in warm and hot dense matter

    SciTech Connect (OSTI)

    Faussurier, Gerald; Blancard, Christophe; Gauthier, Maxence


    We present a method to estimate the nuclear component of the stopping power of ions propagating in dense matter. Three kinds of effective pair potentials are proposed. Results from the warm dense matter regime and the domain of high energy density physics are presented and discussed for proton and helium. The role of ionic temperature is examined. The nuclear stopping power can play a noticeable role in hot dense matter.

  17. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  18. New Online Tool Creates One-Stop Shop for Federal Program Opportunitie...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Online Tool Creates One-Stop Shop for Federal Program Opportunities That Support Tribal Energy Development New Online Tool Creates One-Stop Shop for Federal Program Opportunities ...

  19. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic...

    Office of Scientific and Technical Information (OSTI)

    Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Authors: ...

  20. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic...

    Office of Scientific and Technical Information (OSTI)

    Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules You are ...

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  2. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  3. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  4. Stopping Power and Range of Ions in Matter

    Energy Science and Technology Software Center (OSTI)


    SRIM is a group of programs which calculate the stopping and range of ions (10ev - 2 GeV/amu) into matter. TRIM (the Transport of Ions in Matter) is the most comprehensive program included. Trim will accept complex targets made of compound materials with up to eight layers, each with different materials. It will calculate both the final 3d distribution of the inner ions and also all kinetic phenomena associated with the ion''s energy loss; targetmore » damage, sputtering, ionization, and phonon production. All targets atom cascades in the target are followed in detail. It can be used for physics of recoil cascades, physics of sputtering, the stopping of ions in compounds and stopping power for ions in gases; This included radiation damage from neutron , electrons, and photons.« less

  5. NNSA-developed simulation seeks to understand and stop terrorist

    National Nuclear Security Administration (NNSA)

    recruitment | National Nuclear Security Administration NNSA-developed simulation seeks to understand and stop terrorist recruitment Friday, April 29, 2016 - 11:14am NNSA Blog As NNSA verifies and maintains the U.S. nuclear deterrent without underground explosive nuclear testing, computer simulation has become a key capability and a vital part of the nuclear security enterprise. By modeling the extreme physics that make up nuclear reactions, scientists can ensure our stockpile is safe,

  6. Stopping executions, saving computers with new malware detection tool

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Saving computers with new malware detection tool Stopping executions, saving computers with new malware detection tool A computer tool that allows the machine to identify malicious executable files without being exposed to their harmful actions. October 21, 2009 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma

  7. Energy Savers: A one-stop energy efficiency shop for multifamily...

    Office of Environmental Management (EM)

    A one-stop energy efficiency shop for multifamily building owners Energy Savers: A one-stop energy efficiency shop for multifamily building owners This is a document from Energy...

  8. Your First Stop for Clean Energy Policy Support (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    The Clean Energy Solutions Center, an initiative of the Clean Energy Ministerial and UN-Energy, helps governments design and adopt policies and programs that support the deployment of transformational low-carbon technologies. The Solutions Center serves as a first-stop clearinghouse of clean energy policy reports, data, and tools and provides expert assistance and peer-to-peer learning forums. This factsheet highlights key Solutions Center offerings, including 'ask an expert' assistance on clean energy policy matters, training and peer learning, and technical resources for policy makers worldwide.

  9. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  10. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  11. Oil Stop Valve : Oil Spill Containment Research and Development Project.

    SciTech Connect (OSTI)

    Bourn, Robert D.


    This report summarizes the research and development project conducted by the Civil Engineering Section, Division of Substation and Control Engineering, to determine the effectiveness of the oil stop valve for use in the Bonneville Power Administration's Oil Spill Containment and Countermeasure Program. The most attractive alternative to lagoons and separator tanks was found in the oil stop valve manufactured by AFL/Clark Industries of Riviera Beach, Florida. This small, direct-acting and relatively inexpensive valve requires little maintenance and can either be employed independently, using existing drain lines for effluent storage, or in conjunction with oil separator tanks and lagoon systems. The AFL/Clark valve requires no power and has only one moving part, a ballasted float having a specific gravity between that of oil and water. In water, the float rides above the throat of the discharge pipe allowing water to flow out. When oil enters the water the float begins losing its relative bouyancy and sinks until it seats itself over the throat of the outlet, closing the valve. Usually installed in a manhole within a typical storm drainage system, the valve backs spilled oil into drainways and contains it for temporary storage within the switchyard.

  12. AVTA: 2010 Volkswagon Golf Diesel Start-Stop Testing Results

    Broader source: [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe results of testing done on a 2010 Volkswagon Golf Diesel vehicle with stop-start technology. Baseline data, which provides a point of comparison for the other test results, was collected at two different research laboratories. Baseline and other data collected at Idaho National Laboratory is in the attached documents. Baseline and battery testing data collected at Argonne National Laboratory is available in summary and CSV form on the Argonne Downloadable Dynometer Database site ( Taken together, these reports give an overall view of how this vehicle functions under extensive testing.

  13. AVTA: 2010 Mazda 3 Hatchback Start-Stop Testing Results

    Broader source: [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe results of testing done on a 2010 Mazda3 hatchback with stop-start technology. Baseline and other data collected at Idaho National Laboratory is in the attached documents. Baseline and battery testing data collected at Argonne National Laboratory is available in summary and CSV form on the Argonne Downloadable Dynometer Database site ( Taken together, these reports give an overall view of how this vehicle functions under extensive testing.

  14. Low velocity ion stopping in binary ionic mixtures

    SciTech Connect (OSTI)

    Tashev, Bekbolat; Baimbetov, Fazylkhan; Deutsch, Claude; Fromy, Patrice


    Attention is focused on the low ion velocity stopping mechanisms in multicomponent and dense target plasmas built of quasiclassical electron fluids neutralizing binary ionic mixtures, such as, deuterium-tritium of current fusion interest, proton-heliumlike iron in the solar interior or proton-helium ions considered in planetology, as well as other mixtures of fiducial concern in the heavy ion beam production of warm dense matter at Bragg peak conditions. The target plasma is taken in a multicomponent dielectric formulation a la Fried-Conte. The occurrence of projectile ion velocities (so-called critical) for which target electron slowing down equals that of given target ion components is also considered. The corresponding multiquadrature computations, albeit rather heavy, can be monitored analytical through a very compact code operating a PC cluster. Slowing down results are systematically scanned with respect to target temperature and electron density, as well as ion composition.

  15. Search for stop pairs in the emu channel

    SciTech Connect (OSTI)

    Tissandier, Fabrice; /Clermont-Ferrand U.


    The Standard Model gives a satisfying description of subatomic processes at low energy (< 1 TeV). Beyond this energy scale, other models must be considered. Supersymmetry is one of them. It gives in an elegant way, solutions to several Standard Model short comings. This document reports the search for a supersymmetric signal characterized by the production of two stops decaying into two b-jets, one electron, one muon and missing energy. This study has been performed at the D0 experiment, located on the ring of Tevatron collider at FermiLab, (Chicago, USA), whose energy in the center of mass reaches {radical}s = 1.96 TeV. The data used for this analysis have been collected during Run IIa of D0 detector; from april 2003 to march 2006 ({approx} 1fb{sup -1}). The objects handled for this analysis require a good understanding of both calorimeters, muon detectors and trackers. As Tevatron is an hadronic collider and the number of Standard Model processes with the same signature as the signal is low, the background is thus dominated by QCD processes. After the selection cuts, no excess of data has been observed with respect to the Standard Model expectation. D0 experiment sensibility has been improved and the 95% CL exclusion area in [m{sub {bar {nu}}}, m{sub {bar t}{sub 1}}], extended up to stop masses of 170 GeV/c{sup 2} and sneutrino masses of 105 GeV/c{sup 2}. Besides, a part of my work for the collaboration consisted in elaborating a tool to discriminate calorimetric objects at level 3 trigger system; and also in calibrating the two simulated level 1 readouts.

  16. Stopping distance for high energy jets in weakly coupled quark-gluon plasmas

    SciTech Connect (OSTI)

    Arnold, Peter; Cantrell, Sean; Xiao Wei


    We derive a simple formula for the stopping distance for a high-energy quark traveling through a weakly coupled quark-gluon plasma. The result is given to next-to-leading order in an expansion in inverse logarithms ln(E/T), where T is the temperature of the plasma. We also define a stopping distance for gluons and give a leading-log result. Discussion of stopping distance has a theoretical advantage over discussion of energy loss rates in that stopping distances can be generalized to the case of strong coupling, where one may not speak of individual partons.

  17. The New York Times covers "National Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The New York Times covers "National Labs Race to Stop Iran" The New York Times covers "National Labs Race to Stop Iran" Given the stakes in the sensitive negotiations [with Iran], the labs would check and recheck one another, making sure the answers held up. May 15, 2015 The New York Times covers "National Labs Race to Stop Iran" Los Alamos National Laboratory's main complex, Los Alamos, New Mexico National labs race to stop Iran Given the stakes in the sensitive

  18. Fact #853 December 29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced

    Broader source: [DOE]

    Stop/Start technology improves fuel economy by reducing engine idle time. As a vehicle slows to a stop, the engine is shut down but then immediately restarts when the break pedal is released so...

  19. Study of stopping power for a proton moving in a plasma with arbitrary degeneracy

    SciTech Connect (OSTI)

    Zhang, Ya; Song, Yuan-Hong; Wang, You-Nian [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)] [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)


    Excitation of bulk solid electrons with arbitrary degeneracy, by external charged particles, is investigated by a two-dimensional nonlinear quantum hydrodynamic (QHD) model. The nonlinear stopping power and wake potential are calculated by solving the nonlinear QHD equations with the flux corrected transport numerical method. Two cases of fully degenerated and partially degenerated electrons are compared and discussed in the same self-consistent QHD model. Our results are consistent with the well known dielectric calculation of the stopping power at higher velocity, but include the nonlinear terms of the interactions and give larger stopping power at smaller velocity.

  20. Optimization of the muon stopping target for the MU2E collaboration

    SciTech Connect (OSTI)

    Hodge, Zachary Donovan


    The Mu2e Experiment utilizes state of the art accelerators, superconducting magnets, detectors, electronics, and other equipment to maximize the sensitivity to such a rare process. Many of the components of the Mu2e hardware are critical to the overall physics capability of the experiment. The muon stopping target, where muons are stopped and may interact via this very rare process, is one such component where any improvements beyond the base design can have a significant impact on the experiment. This thesis explores possible modifications to the geometry of the muon stopping target. The goal is to determine if any modifications can improve the sensitivity of observing the muon conversion process.

  1. Automatic generation of stop word lists for information retrieval and analysis

    DOE Patents [OSTI]

    Rose, Stuart J


    Methods and systems for automatically generating lists of stop words for information retrieval and analysis. Generation of the stop words can include providing a corpus of documents and a plurality of keywords. From the corpus of documents, a term list of all terms is constructed and both a keyword adjacency frequency and a keyword frequency are determined. If a ratio of the keyword adjacency frequency to the keyword frequency for a particular term on the term list is less than a predetermined value, then that term is excluded from the term list. The resulting term list is truncated based on predetermined criteria to form a stop word list.

  2. Heavy standard model-like Higgs boson and a light stop fromYukawa...

    Office of Scientific and Technical Information (OSTI)

    Title: Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Authors: Kang, Zhaofeng ; Li, Tianjun ; Liu, Tao ; Tong, Chunli ; Yang, Jin Min ...

  3. Fact #787: July 8, 2013 Truck Stop Electrification Reduces Idle Fuel Consumption

    Broader source: [DOE]

    The U.S. Department of Transportation mandates that truckers rest for 10 hours after driving for 11 hours, during which time they often park at truck stops idling the engines to provide heating,...

  4. Vehicle Technologies Office Merit Review 2015: A 12V Start-Stop Li Polymer Battery Pack

    Broader source: [DOE]

    Presentation given by LG Chem Power at 2015 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about A 12V start-stop Li polymer...

  5. Fact #853 December 29, 2014 Stop/Start Technology is in nearly...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Note: 2014 estimates are preliminary. Fact 853 Dataset Supporting Information Penetration of Non-Hybrid StopStart in New Light Vehicles Model Year Cars Light Trucks All Cars and ...

  6. Method and apparatus for rapid stopping and starting of a thermoacoust...

    Office of Scientific and Technical Information (OSTI)

    Title: Method and apparatus for rapid stopping and starting of a thermoacoustic engine A thermoacoustic engine-driven system with a hot heat exchanger, a regenerator or stack, and ...

  7. Hanford Railcars Make Final Stop at B Reactor: Move Enhances Visitor Experience at Historic Reactor

    Broader source: [DOE]

    RICHLAND, WASH. – Two locomotives that hauled irradiated fuel around the Hanford Site for a half-century will reach their final stop this week when they are delivered to the Historic B Reactor for preservation and public display.

  8. Heavy standard model-like Higgs boson and a light stop from

    Office of Scientific and Technical Information (OSTI)

    Yukawa-deflected gauge mediation (Journal Article) | SciTech Connect Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Citation Details In-Document Search Title: Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Authors: Kang, Zhaofeng ; Li, Tianjun ; Liu, Tao ; Tong, Chunli ; Yang, Jin Min Publication Date: 2012-11-16 OSTI Identifier: 1101779 Type: Publisher's Accepted Manuscript Journal Name: Physical

  9. U.S. Works With Kazakhstan to Stop Nuclear and Radioactive Material

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smuggling | Department of Energy Works With Kazakhstan to Stop Nuclear and Radioactive Material Smuggling U.S. Works With Kazakhstan to Stop Nuclear and Radioactive Material Smuggling May 6, 2006 - 10:34am Addthis WASHINGTON, DC - As part of the overall U.S. strategy to prevent nuclear and dangerous radiological materials from falling into the hands of terrorists, the Department of Energy's National Nuclear Security Administration (NNSA) announced today that an agreement with the government

  10. Stop-catalyzed baryogenesis beyond the MSSM (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Stop-catalyzed baryogenesis beyond the MSSM Citation Details In-Document Search Title: Stop-catalyzed baryogenesis beyond the MSSM Authors: Katz, Andrey ; Perelstein, Maxim ; Ramsey-Musolf, Michael J. ; Winslow, Peter Publication Date: 2015-11-19 OSTI Identifier: 1226507 Grant/Contract Number: SC0011095 Type: Published Article Journal Name: Physical Review D Additional Journal Information: Journal Volume: 92; Journal Issue: 9; Journal ID: ISSN 1550-7998 Publisher: American Physical

  11. DOE Takes Action to Stop the Sales of Air-Con Air Conditioner Models Shown

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Violate Federal Energy Efficiency Appliance Standards | Department of Energy Action to Stop the Sales of Air-Con Air Conditioner Models Shown to Violate Federal Energy Efficiency Appliance Standards DOE Takes Action to Stop the Sales of Air-Con Air Conditioner Models Shown to Violate Federal Energy Efficiency Appliance Standards September 23, 2010 - 12:00am Addthis Washington, DC - The Department of Energy announced today that it has taken action against Air-Con, International, requiring

  12. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF

    Office of Scientific and Technical Information (OSTI)

    Capsules (Conference) | SciTech Connect Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Authors: Hayes-Sterbenz, Anna Catherine [1] ; Jungman, Gerard [1] ; Boswell, Melissa [1] ; Fowler, Malcolm M. [1] ; Grim, Gary P. [1] ; Klein, Andreas [1] ; Rundberg, Robert S. [1] ; Wilhelmy, Jerry B. [1] ; Wilson, Douglas Carl [1] ; Cerjan, Charles [2] ;

  13. Reducing or stopping the uncontrolled flow of fluid such as oil from a well

    DOE Patents [OSTI]

    Hermes, Robert E


    The uncontrolled flow of fluid from an oil or gas well may be reduced or stopped by injecting a composition including 2-cyanoacrylate ester monomer into the fluid stream. Injection of the monomer results in a rapid, perhaps instantaneous, polymerization of the monomer within the flow stream of the fluid. This polymerization results in formation of a solid plug that reduces or stops the flow of additional fluid from the well.

  14. Method and apparatus for rapid stopping and starting of a thermoacoustic engine

    DOE Patents [OSTI]

    Swift, Gregory W.; Backhaus, Scott N.; Gardner, David L.


    A thermoacoustic engine-driven system with a hot heat exchanger, a regenerator or stack, and an ambient heat exchanger includes a side branch load for rapid stopping and starting, the side branch load being attached to a location in the thermoacoustic system having a nonzero oscillating pressure and comprising a valve, a flow resistor, and a tank connected in series. The system is rapidly stopped simply by opening the valve and rapidly started by closing the valve.

  15. Light Stops, Light Staus and the 125 GeV Higgs

    SciTech Connect (OSTI)

    Carena, Marcela; Gori, Stefania; Shah, Nausheen R.; Wagner, Carlos E.M.; Wang, Lian-Tao


    The ATLAS and CMS experiments have recently announced the discovery of a Higgs-like resonance with mass close to 125 GeV. Overall, the data is consistent with a Standard Model (SM)-like Higgs boson. Such a particle may arise in the minimal supersymmetric extension of the SM with average stop masses of the order of the TeV scale and a sizable stop mixing parameter. In this article we discuss properties of the SM-like Higgs production and decay rates induced by the possible presence of light staus and light stops. Light staus can affect the decay rate of the Higgs into di-photons and, in the case of sizable left-right mixing, induce an enhancement in this production channel up to $\\sim$ 50% of the Standard Model rate. Light stops may induce sizable modifications of the Higgs gluon fusion production rate and correlated modifications to the Higgs diphoton decay. Departures from SM values of the bottom-quark and tau-lepton couplings to the Higgs can be obtained due to Higgs mixing effects triggered by light third generation scalar superpartners. We describe the phenomenological implications of light staus on searches for light stops and non-standard Higgs bosons. Finally, we discuss the current status of the search for light staus produced in association with sneutrinos, in final states containing a $W$ gauge boson and a pair of $\\tau$s.

  16. USABC Development of 12 Volt Battery for Start-Stop Application: Preprint

    SciTech Connect (OSTI)

    Tataria, H.; Gross, O.; Bae, C.; Cunningham, B.; Barnes, J. A.; Deppe, J.; Neubauer, J.


    Global automakers are accelerating the development of fuel efficient vehicles, as a part of meeting regional regulatory CO2 emissions requirements. The micro hybrid vehicles with auto start-stop functionality are considered economical solutions for the stringent European regulations. Flooded lead acid batteries were initially considered the most economical solution for idle-stop systems. However, the dynamic charge acceptance (DCA) at lower state-of-charge (SOC) was limiting the life of the batteries. While improved lead-acid batteries with AGM and VRLA features have improved battery longevity, they do not last the life of the vehicle. The United States Advanced Battery Consortium (or USABC, a consortium of GM, Ford, and Chrysler) analyzed energy storage needs for a micro hybrid automobile with start-stop capability, and with a single power source. USABC has analyzed the start-stop behaviors of many drivers and has developed the requirements for the start-stop batteries (Table 3). The testing procedures to validate the performance and longevity were standardized and published. The guideline for the cost estimates calculations have also been provided, in order to determine the value of the newly developed modules. The analysis effort resulted in a set of requirements which will help the battery manufacturers to develop a module to meet the automotive Original Equipment Manufacturers (OEM) micro hybrid vehicle requirements. Battery developers were invited to submit development proposals and two proposals were selected for 50% cost share with USABC/DOE.

  17. Stop Paying for Energy You Aren't Using | Department of Energy

    Energy Savers [EERE]

    Stop Paying for Energy You Aren't Using Stop Paying for Energy You Aren't Using January 6, 2009 - 4:00am Addthis Allison Casey Senior Communicator, NREL Back in October, we heard a lot about "energy vampires." A very convenient holiday metaphor, to be sure, but you're probably not in the Halloween spirit in January. Nonetheless, you may be in the mood to reduce your energy costs, and standby power is something worth considering all year round. Standby power is the minimum power used

  18. Energy Efficiency Tricks to Stop Your Energy Bill from Haunting You |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Tricks to Stop Your Energy Bill from Haunting You Energy Efficiency Tricks to Stop Your Energy Bill from Haunting You October 26, 2015 - 10:49am Addthis This Halloween, keep ghosts and goblins at bay -- while saving energy and money -- with these home energy efficiency tricks. | Infographic by <a href="/node/379579">Sarah Gerrity</a>, Energy Department. This Halloween, keep ghosts and goblins at bay -- while saving energy and money -- with these

  19. Energy Vampires are Attacking Your Home - Here's How to Stop Them |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Vampires are Attacking Your Home - Here's How to Stop Them Energy Vampires are Attacking Your Home - Here's How to Stop Them October 20, 2014 - 2:09pm Addthis Using a power strip to switch off appliances ensures your home won't be plagued by energy vampires. | Photo courtesy of © Using a power strip to switch off appliances ensures your home won't be plagued by energy vampires. | Photo courtesy of © Erik Hyrkas Erik

  20. DOE and FERC Joint Public Statement on Back Stop Siting | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FERC Joint Public Statement on Back Stop Siting DOE and FERC Joint Public Statement on Back Stop Siting October 11, 2011 - 1:32pm Addthis Washington, D.C. - U.S. Energy Secretary Steven Chu announced today his decision that the Department of Energy will work more closely with the Federal Energy Regulatory Commission (FERC) in reviewing proposed electric transmission projects under section 216 of the Federal Power Act (FPA), as an alternative to delegating additional authority to FERC.

  1. Battery Test Manual For 12 Volt Start/Stop Hybrid Electric Vehicles

    SciTech Connect (OSTI)

    Belt, Jeffrey R.


    This manual was prepared by and for the United Stated Advanced Battery Consortium (USABC) Electrochemical Energy Storage Team. It is based on the targets established for 12 Volt Start/Stop energy storage development and is similar (with some important changes) to an earlier manual for the former FreedomCAR program. The specific procedures were developed primarily to characterize the performance of energy storage devices relative to the USABC requirements. However, it is anticipated that these procedures will have some utility for characterizing 12 Volt Start/Stop hybrid energy storage device behavior in general.

  2. Fact #853 December 29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced- Dataset

    Broader source: [DOE]

    Excel file with dataset for Fact #853: December  29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced

  3. Vehicle Technologies Office: AVTA- Start-Stop (Micro) Hybrid Vehicles Performance Data

    Broader source: [DOE]

    The Advanced Vehicle Testing Activity (AVTA) uses standard procedures and test specifications to test and collect data from vehicles on dynamometers, closed test tracks, and on-the-road. Performance and testing data on the stop-start hybrid versions of the following vehicles is available: 2010 Smart Fortwo, 2010 Volkswagen Golf Diesel, and 2010 Mazda3 Hatchback.

  4. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  5. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  6. Measurement of charged-particle stopping in warm-dense plasma

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zylstra, A.  B.; Frenje, J.  A.; Grabowski, P. E.; Li, C.  K.; Collins, G.  W.; Fitzsimmons, P.; Glenzer, S.; Graziani, F.; Hansen, S.  B.; Hu, S. X.; et al


    We measured the stopping of energetic protons in an isochorically-heated solid-density Be plasma with an electron temperature of ~32 eV, corresponding to moderately-coupled [(e²/a/(kBTe + EF ) ~ 0.3] and moderately-degenerate [kBTe/EF ~2] 'warm dense matter' (WDM) conditions. We present the first high-accuracy measurements of charged-particle energy loss through dense plasma, which shows an increased loss relative to cold matter, consistent with a reduced mean ionization potential. The data agree with stopping models based on an ad-hoc treatment of free and bound electrons, as well as the average-atom local-density approximation; this work is the first test of these theories inmore » WDM plasma.« less

  7. AVTA: Quantifying the Effects of Idle Stop Systems on Fuel Economy

    Broader source: [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. This report gives an overall analysis of stop-start technology. This research was conducted by Idaho National Laboratory.

  8. Freezing a Droplet to Stop the Ice | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Freezing a Droplet to Stop the Ice Advanced Scientific Computing Research (ASCR) ASCR Home About Research Facilities Science Highlights Benefits of ASCR Funding Opportunities Advanced Scientific Computing Advisory Committee (ASCAC) Community Resources Contact Information Advanced Scientific Computing Research U.S. Department of Energy SC-21/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-7486 F: (301) 903-4846 E: Email Us More Information » 08.01.15 Freezing a

  9. Method and apparatus to debug an integrated circuit chip via synchronous clock stop and scan

    DOE Patents [OSTI]

    Bellofatto, Ralph E.; Ellavsky, Matthew R.; Gara, Alan G.; Giampapa, Mark E.; Gooding, Thomas M.; Haring, Rudolf A.; Hehenberger, Lance G.; Ohmacht, Martin


    An apparatus and method for evaluating a state of an electronic or integrated circuit (IC), each IC including one or more processor elements for controlling operations of IC sub-units, and each the IC supporting multiple frequency clock domains. The method comprises: generating a synchronized set of enable signals in correspondence with one or more IC sub-units for starting operation of one or more IC sub-units according to a determined timing configuration; counting, in response to one signal of the synchronized set of enable signals, a number of main processor IC clock cycles; and, upon attaining a desired clock cycle number, generating a stop signal for each unique frequency clock domain to synchronously stop a functional clock for each respective frequency clock domain; and, upon synchronously stopping all on-chip functional clocks on all frequency clock domains in a deterministic fashion, scanning out data values at a desired IC chip state. The apparatus and methodology enables construction of a cycle-by-cycle view of any part of the state of a running IC chip, using a combination of on-chip circuitry and software.

  10. Reaction-in-flight neutrons as a test of stopping power in degenerate plasmas

    SciTech Connect (OSTI)

    Hayes, A. C.; Jungman, Gerard; Schulz, A. E.; Boswell, M.; Fowler, M. M.; Grim, G.; Klein, A.; Rundberg, R. S.; Wilhelmy, J. B.; Wilson, D.; Cerjan, C.; Schneider, D.; Sepke, S. M.; Tonchev, A.; Yeamans, C.


    We present the first measurements of reaction-in-flight (RIF) neutrons in an inertial confinement fusion system. The experiments were carried out at the National Ignition Facility, using both Low Foot and High Foot drives and cryogenic plastic capsules. In both cases, the high-energy RIF (En > 15 MeV) component of the neutron spectrum was found to be about 10–4 of the total. The majority of the RIF neutrons were produced in the dense cold fuel surrounding the burning hotspot of the capsule, and the data are consistent with a compressed cold fuel that is moderately to strongly coupled (Γ~ 0.6) and electron degenerate (θFermie~ 4). The production of RIF neutrons is controlled by the stopping power in the plasma. Thus, the current RIF measurements provide a unique test of stopping power models in an experimentally unexplored plasma regime. In conclusion, we find that the measured RIF data strongly constrain stopping models in warm dense plasma conditions, and some models are ruled out by our analysis of these experiments.

  11. Reaction-in-flight neutrons as a test of stopping power in degenerate plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hayes, A. C.; Jungman, Gerard; Schulz, A. E.; Boswell, M.; Fowler, M. M.; Grim, G.; Klein, A.; Rundberg, R. S.; Wilhelmy, J. B.; Wilson, D.; et al


    We present the first measurements of reaction-in-flight (RIF) neutrons in an inertial confinement fusion system. The experiments were carried out at the National Ignition Facility, using both Low Foot and High Foot drives and cryogenic plastic capsules. In both cases, the high-energy RIF (En > 15 MeV) component of the neutron spectrum was found to be about 10–4 of the total. The majority of the RIF neutrons were produced in the dense cold fuel surrounding the burning hotspot of the capsule, and the data are consistent with a compressed cold fuel that is moderately to strongly coupled (Γ~ 0.6) andmore » electron degenerate (θFermi/θe~ 4). The production of RIF neutrons is controlled by the stopping power in the plasma. Thus, the current RIF measurements provide a unique test of stopping power models in an experimentally unexplored plasma regime. In conclusion, we find that the measured RIF data strongly constrain stopping models in warm dense plasma conditions, and some models are ruled out by our analysis of these experiments.« less

  12. Stopping power for a charged particle moving through three-dimensional nonideal finite-temperature electron gases

    SciTech Connect (OSTI)

    Zhang Ya; Song Yuanhong; Wang Younian [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)


    We investigate the interaction of a charged particle with nonideal 3D electron gases by using the quantum hydrodynamic (QHD) theory. The stopping power for a nonideal electron gas at a finite-temperature has been theoretically analyzed and numerically calculated. In our calculation, the impact of nonideality and temperature on stopping power is stressed and clearly presented. The QHD dielectric function is obtained and compared to random-phase approximation result. It is shown that the QHD theory can properly describe the stopping power for higher particle velocities greater than the Bohr velocity.

  13. HIV/AIDS Information Resources from the National Library of Medicine-STOP

    SciTech Connect (OSTI)

    Templin-Branner, W. and N. Dancy


    The HIV/AIDS Information Resources from the National Library of Medicine training is designed specifically for the UNCFSP HBCU Screening, Testing, Outreach, and Prevention (STOP) HIV/AIDS Program project members to provide valuable health information resources from the National Library of Medicine and other reliable sources to increase awareness of the wealth of treatment information and educational materials that are available on the Internet and to improve prevention and treatment education for their clients. These resources will also meet the needs of community-based organizations

  14. WorldWideScience provides a one-stop search engine to mine global

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    scientific databases in the deep web | U.S. DOE Office of Science (SC) WorldWideScience provides a one-stop search engine to mine global scientific databases in the deep web News News Home Featured Articles Science Headlines 2016 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 Science Highlights Presentations & Testimony News Archives Communications and Public Affairs Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585

  15. DOE/SC-ARM-09-023 Ordering ARM Data One-Stop Shopping: Getting the

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23 Ordering ARM Data One-Stop Shopping: Getting the Data You Need From the ARM Data Archive,, users can select routine data by browsing in the new ARM Data Discovery Tool-the first interface listed on the page. This tool features pre-selected sorts and search logic to help you find atmospheric and climate data faster. As each selection is made, only ARM data meeting the criteria remain visible, leading to the datastream that best suits your needs. When data are ordered, the

  16. In-Cab Air Quality of Trucks Air Conditioned and Kept in Electrified Truck Stop

    SciTech Connect (OSTI)

    Lee, Doh-Won; Zietsman, Josias; Farzaneh, Mohamadreza; Li, Wen-Whai; Olvera, Hector; Storey, John Morse; Kranendonk, Laura


    At night, long-haul truck drivers rest inside the cabins of their vehicles. Therefore, the in-cab air quality while air conditioning (A/C) is being provided can be a great concern to the drivers health. The effect of using different A/C methods [truck's A/C, auxiliary power unit (APU), and truck stop electrification (TSE) unit] on in-cab air quality of a heavy-duty diesel vehicle was investigated at an electrified truck stop in the El Paso, Texas, area. The research team measured the in-cabin and the ambient air quality adjacent to the parked diesel truck as well as emissions from the truck and an APU while it was providing A/C. The measured results were compared and analyzed. On the basis of these results, it was concluded that the TSE unit provided better in-cab air quality while supplying A/C. Furthermore, the truck and APU exhaust emissions were measured, and fuel consumption of the truck (while idling) and the APU (during operation) were compared. The results led to the finding that emissions from the APU were less than those from the truck's engine idling, but the APU consumed more fuel than the engine while providing A/C under given conditions.

  17. Stopping Power of Different Ions in Si Measured with a Bulk Sample Method and Bayesian Inference Data Analysis

    SciTech Connect (OSTI)

    Barradas, N. P.; Alves, E.; Siketic, Z.; Radovic, I. Bogdanovic


    The accuracy of ion beam analysis experiments depends critically on the stopping power values available. While for H and He ions accuracies normally better than 5% are achieved by usual interpolative schemes such as SRIM, for heavier ions the accuracy is worse. One of the main reasons is that the experimental data bases are very sparse, even for important materials such as Si. New measurements are therefore needed. Measurement of stopping power is often made with transmission in thin films, with the usual problems of film thickness homogeneity. We have previously developed an alternative method based on measuring bulk spectra, and fitting the yield by treating the stopping power as a fit parameter in a Bayesian inference Markov chain Monte Carlo procedure included in the standard IBA code NDF. We report on improvements of the method and on its application to the determination of the stopping power of {sup 7}Li in Si. To validate the method, we also apply it to the stopping of {sup 4}He in Si, which is known with 2% accuracy.

  18. Resonant formation of {Lambda}(1405) by stopped-K{sup -} absorption in the deuteron

    SciTech Connect (OSTI)

    Esmaili, Jafar; Akaishi, Yoshinori; Yamazaki, Toshimitsu


    To solve the current debate on the position of the quasibound K{sup -}p state, namely, ''{Lambda}(1405) or {Lambda}*(1420),'' we propose to measure the T{sub 21}=T{sub {Sigma}{pi}<-K}-bar{sub N} {Sigma}{pi} invariant-mass spectrum in stopped-K{sup -} absorption in the deuteron, since the spectrum, reflecting the soft and hard deuteron momentum distribution, is expected to have a narrow quasifree component with an upper edge of M=1430 MeV/c{sup 2}, followed by a significant 'high-momentum' tail toward the lower mass region, where a resonant formation of {Lambda}(1405) of any mass and width in a wide range will be clearly revealed. We introduce a 'deviation' spectrum as defined by DEV = OBS (observed or calculated) / QF (nonresonant quasifree), in which the resonant component can be seen as an isolated peak free from the QF shape.

  19. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  20. Search for Stopped Gluinos in pp collisions at sqrt s = 7 TeV

    SciTech Connect (OSTI)

    Khachatryan, Vardan; et al.


    The results of the first search for long-lived gluinos produced in 7 TeV pp collisions at the CERN Large Hadron Collider are presented. The search looks for evidence of long-lived particles that stop in the CMS detector and decay in the quiescent periods between beam crossings. In a dataset with a peak instantaneous luminosity of 10^{32} cm^{-2} s^{-1}, an integrated luminosity of 10 inverse picobarns, and a search interval corresponding to 62 hours of LHC operation, no significant excess above background was observed. Limits at the 95% confidence level on gluino pair production over 13 orders of magnitude of gluino lifetime are set. For a mass difference between the gluino and the neutralino greater than 100 GeV/c^2, and assuming a branching ratio for gluino to gluon+neutralino of 100%, gluinos of mass less than 370 GeV/c^2 are excluded for lifetimes from 10 microseconds to 1000 s.

  1. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* Non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 Non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Contact Information General Inquiries New

  2. Theoretical studies on the stopping power of deuterium-tritium mixed with uranium plasmas for α particles

    SciTech Connect (OSTI)

    Wang, Zhigang; Fu, Zhen-Guo; Zhang, Ping


    The stopping power of a compressed and highly ionized deuterium-tritium (DT) and uranium (U) plasma for α particles at very high temperatures (T = 5 keV) is examined theoretically with the dimensional continuation method. We show that with increasing density of U, both the magnitude and width of the resonance peak in the stopping power (as a function of the α particle energy), increases because of the ions, while the penetration distance of the α particles decreases. A simple relation of decreasing penetration distance as a function of plasma density is observed, which may be useful for inertial confinement fusion experiments. Moreover, by comparing the results with the case of a DT plasma mixed with beryllium, we find that the effect of a higher Z plasma is stronger, with regard to energy loss as well as the penetration distance of α particles, than that of a lower Z plasma.

  3. A New Active DPF System for "Stop and Go" Duty-Cycle Vehicles | Department

    Broader source: (indexed) [DOE]

    of Energy 2004 Diesel Engine Emissions Reduction (DEER) Conference Presentation: Aaqius and Aaqius PDF icon 2004_deer_seguelong1.pdf More Documents & Publications The ExoClean Filter System for Stop and Go Vehicles Combination of Diesel fuel system architectures and Ceria-based fuel-borne catalysts for improvement and simplification of the Diesel Particulate Filter System in serial applications Diesel Particulate Filters: Market Introducution in Europe

  4. Dose calculations using MARS for Bremsstrahlung beam stops and collimators in APS beamline stations.

    SciTech Connect (OSTI)

    Dooling, J.; Accelerator Systems Division


    The Monte Carlo radiation transport code MARS is used to model the generation of gas bremsstrahlung (GB) radiation from 7-GeV electrons which scatter from residual gas atoms in undulator straight sections within the Advanced Photon Source (APS) storage ring. Additionally, MARS is employed to model the interactions of the GB radiation with components along the x-ray beamlines and then determine the expected radiation dose-rates that result. In this manner, MARS can be used to assess the adequacy of existing shielding or the specifications for new shielding when required. The GB radiation generated in the 'thin-target' of an ID straight section will consist only of photons in a 1/E-distribution up to the full energy of the stored electron beam. Using this analytical model, the predicted GB power for a typical APS 15.38-m insertion device (ID) straight section is 4.59 x 10{sup -7} W/nTorr/mA, assuming a background gas composed of air (Z{sub eff} = 7.31) at room temperature (293K). The total GB power provides a useful benchmark for comparisons between analytical and numerical approaches. We find good agreement between MARS and analytical estimates for total GB power. The extended straight section 'target' creates a radial profile of GB, which is highly peaked centered on the electron beam. The GB distribution reflects the size of the electron beam that creates the radiation. Optimizing the performance of MARS in terms of CPU time per incident trajectory requires the use of a relatively short, high-density gas target (air); in this report, the target density is {rho}L = 2.89 x 10{sup -2} g/cm{sup 2} over a length of 24 cm. MARS results are compared with the contact dose levels reported in TB-20, which used EGS4 for radiation transport simulations. Maximum dose-rates in 1 cc of tissue phantom form the initial basis for comparison. MARS and EGS4 results are approximately the same for maximum 1-cc dose-rates and attenuation in the photon-dominated regions; for thicker targets, however, the dose-rate no longer depends only on photon attenuation, as photoneutrons (PNs) begin to dominate. The GB radiation-induced photoneutron measurements from four different metals (Fe, Cu, W, and Pb) are compared with MARS predictions. The simulated dose-rates for beamline 6-ID are approximately 3-5 times larger than the measured values, whereas those for beamline 11-ID are much closer. Given the uncertainty in local values of pressure and Z, the degree of agreement between MARS and the PN measurements is good. MARS simulations of GB-induced radiation in and around the FOE show the importance of using actual pressure and gas composition (Z{sub eff}) to obtain accurate PN dose. For a beam current of 300 mA, extrapolating pressure data measured in previously published studies predicts an average background gas pressure of 27 nTorr. An average atomic number of Z{sub eff} = 4.0 is obtained from the same studies. In addition, models of copper masks presently in use at the APS are included. Simulations show that inclusion of exit masks make significant differences in both the radiation spatial distribution within the FOE, as well as the peak intensity. Two studies have been conducted with MARS to assess shielding requirements. First, dose levels in contact with the outside wall of the FOE are examined when GB radiation strikes Pb or W beam stops of varying transverse size within the FOE. Four separate phantom regions are utilized to measure the dose, two at beam elevation and two at the horizontal beam position. The first two phantoms are used for scoring FOE dose along the outside and back walls, horizontally; the second two collect dose on the roof and vertically on the back wall. In all cases, the beam stop depth is maintained at 30 cm. Inclusion of front end (FE) exit masks typically cause a 1-2 order-of-magnitude increase in the dose-rates relative to the case with no masks. Masks place secondary bremsstrahlung sources inside the FOE, and therefore they must be shielded appropriately. The MARS model does not fully account for all shielding present

  5. A search for long-lived particles that stop in the CMS detector and decay to muons

    SciTech Connect (OSTI)

    Alimena, Juliette


    A search for long-lived particles that are produced in proton-proton collisions at the CERN LHC, come to rest in the CMS detector, and decay to muons is presented. The decays of the stopped particles could be observed during the intervals between LHC beam crossings, at times that are well separated from any proton-proton collisions. The analysis uses 19.7 1/fb of 8 TeV data collected by CMS in 2012, during a search interval of 293 hours of trigger livetime. Massive, long-lived particles do not exist in the Standard Model, and so any sign of them would be an indication of new physics. The results are interpreted with a model that predicts a long-lived particle that has a charge of twice the electron charge and that behaves like a lepton. Cross section limits are set for each long-lived particle mass as a function of lifetime, for lifetimes between 100 ns and 10 days. These are the first limits for long-lived stopped particles that decay to muons.

  6. Nano-hillock formation in diamond-like carbon induced by swift heavy projectiles in the electronic stopping regime: Experiments and atomistic simulations

    SciTech Connect (OSTI)

    Schwen, D.; Bringa, E.; Krauser, J.; Weidinger, A.; Trautmann, C.; Hofsaess, H.


    The formation of surface hillocks in diamond-like carbon is studied experimentally and by means of large-scale molecular dynamics simulations with 5 Multiplication-Sign 10{sup 6} atoms combined with a thermal spike model. The irradiation experiments with swift heavy ions cover a large electronic stopping range between {approx}12 and 72 keV/nm. Both experiments and simulations show that beyond a stopping power threshold, the hillock height increases linearly with the electronic stopping, and agree extremely well assuming an efficiency of approximately 20% in the transfer of electronic energy to the lattice. The simulations also show a transition of sp{sup 3} to sp{sup 2} bonding along the tracks with the hillocks containing almost no sp{sup 3} contribution.

  7. Influence of a strong laser field on Coulomb explosion and stopping power of energetic H{sub 3}{sup +} clusters in plasmas

    SciTech Connect (OSTI)

    Wang Guiqiu; Gao Hong; Wang Yaochuan; Yao Li; Zhong Haiyang; Cheng Lihong; Yang Kun; Liu Wei [Department of Physics, Dalian Maritime University, Dalian 116026 (China); E Peng; Xu Dianguo [Department of Electrical Engineering, Harbin Institute of Technology, Harbin 150001 (China); Wang Younian; Hu Zhanghu [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116023 (China)


    The influence of a high-intensity laser field on the Coulomb explosion and stopping power for a swift H{sub 3}{sup +} cluster ion in a plasma target is studied by means of the molecular dynamic (MD) method based on the linearized Vlasov-Poisson theory. Excitations of the plasma are described by the classical plasma dielectric function. In the presence of the laser field, the general expressions for the induced potential in the target and the interaction force among the ions within the cluster are derived. Based on the numerical solution of the equations of motion for the constituent ions, the Coulomb explosion patterns and the cluster's stopping power are discussed for a range of laser parameters. Numerical results show that the laser field affects the correlation between the ions and contributes to weaken the wake effect and the stopping power as compared to the laser-free case. On the other hand, the stopping power ratio of H{sub 3}{sup +} cluster is higher than the situation of dicluster of H{sub 2}{sup +} due to the vicinage effect in the cluster.

  8. Unraveling resistive versus collisional contributions to relativistic electron beam stopping power in cold-solid and in warm-dense plasmas

    SciTech Connect (OSTI)

    Vauzour, B.; Laboratoire d'Optique Applique, ENSTA-CNRS-Ecole Polytechnique, UMR 7639, 91761 Palaiseau ; Debayle, A.; CEA, DAM, DIF, F-91297 Arpajon ; Vaisseau, X.; Hulin, S.; Nicola, Ph.; Dorchies, F.; Fourment, C.; D'Humires, E.; Tikhonchuk, V. T.; Santos, J. J.; Schlenvoigt, H.-P.; Baton, S. D.; Yahia, V.; Dipartimento di Fisica, Universit di Milano-Bicocca, Milano 20126 ; Honrubia, J. J.; Beg, F. N.; Chawla, S.; Jarrot, L. C.; Benocci, R.; Volpe, L.; and others


    We present results on laser-driven relativistic electron beam propagation through aluminum samples, which are either solid and cold or compressed and heated by laser-induced shock. A full numerical description of fast electron generation and transport is found to reproduce the experimental absolute K{sub ?} yield and spot size measurements for varying target thicknesses, and to sequentially quantify the collisional and resistive electron stopping powers. The results demonstrate that both stopping mechanisms are enhanced in compressed Al samples and are attributed to the increase in the medium density and resistivity, respectively. For the achieved time- and space-averaged electronic current density, ?j{sub h}??810{sup 10}?A/cm{sup 2} in the samples, the collisional and resistive stopping powers in warm and compressed Al are estimated to be 1.5?keV/?m and 0.8?keV/?m, respectively. By contrast, for cold and solid Al, the corresponding estimated values are 1.1?keV/?m and 0.6?keV/?m. Prospective numerical simulations involving higher j{sub h} show that the resistive stopping power can reach the same level as the collisional one. In addition to the effects of compression, the effect of the transient behavior of the resistivity of Al during relativistic electron beam transport becomes progressively more dominant, and for a significantly high current density, j{sub h}?10{sup 12}?A/cm{sup 2}, cancels the difference in the electron resistive stopping power (or the total stopping power in units of areal density) between solid and compressed samples. Analytical calculations extend the analysis up to j{sub h}=10{sup 14}?A/cm{sup 2} (representative of the full-scale fast ignition scenario of inertial confinement fusion), where a very rapid transition to the Spitzer resistivity regime saturates the resistive stopping power, averaged over the electron beam duration, to values of ?1?keV/?m.

  9. Quantifying the Effects of Idle-Stop Systems on Fuel Economy in Light-Duty Passenger Vehicles

    SciTech Connect (OSTI)

    Jeff Wishart; Matthew Shirk


    Vehicles equipped with idle-stop (IS) systems are capable of engine shut down when the vehicle is stopped and rapid engine re-start for the vehicle launch. This capability reduces fuel consumption and emissions during periods when the engine is not being utilized to provide propulsion or to power accessories. IS systems are a low-cost and fast-growing technology in the industry-wide pursuit of increased vehicle efficiency, possibly becoming standard features in European vehicles in the near future. In contrast, currently there are only three non-hybrid vehicle models for sale in North America with IS systems and these models are distinctly low-volume models. As part of the United States Department of Energy’s Advanced Vehicle Testing Activity, ECOtality North America has tested the real-world effect of IS systems on fuel consumption in three vehicle models imported from Europe. These vehicles were chosen to represent three types of systems: (1) spark ignition with 12-V belt alternator starter; (2) compression ignition with 12-V belt alternator starter; and (3) direct-injection spark ignition, with 12-V belt alternator starter/combustion restart. The vehicles have undergone both dynamometer and on-road testing; the test results show somewhat conflicting data. The laboratory data and the portion of the on-road data in which driving is conducted on a prescribed route with trained drivers produced significant fuel economy improvement. However, the fleet data do not corroborate improvement, even though the data show significant engine-off time. It is possible that the effects of the varying driving styles and routes in the fleet testing overshadowed the fuel economy improvements. More testing with the same driver over routes that are similar with the IS system-enabled and disabled is recommended. There is anecdotal evidence that current Environmental Protection Agency fuel economy test procedures do not capture the fuel economy gains that IS systems produce in real-world driving. The program test results provide information on the veracity of these claims.

  10. A High Resolution, Multi-stop, Time-to-Digital Converter for Nuclear Time-of-Flight Measurements

    SciTech Connect (OSTI)

    D. F. Spencer; J. Cole; M. Drigert; R. Aryaeinejad


    A high-resolution, multi-stop, time-to-digital converter (TDC) was designed and developed to precisely measure the times-of-flight (TOF) of incident neutrons responsible for induced fission and capture reactions on actinide targets. The minimum time resolution is 1 ns. The TDC design was implemented into a single, dual-wide CAMAC module. The CAMAC bus is used for command and control as well as an alternative data output. A high-speed ECL interface, compatible with LeCroy FERA modules, was also provided for the principle data output path. An Actel high-speed field programmable gate array (FPGA) chip was incorporated with an external oscillator and an internal multiple clock phasing system. This device implemented the majority of the high-speed register functions, the state machine for the FERA interface, and the high-speed counting circuit used for the TDC conversion. An external microcontroller was used to monitor and control system-level changes. In this work we discuss the performance of this TDC module as well as its application.

  11. Projectile stopping system

    DOE Patents [OSTI]

    Karr, T.J.; Pittenger, L.C.


    A projectile interceptor launches a projectile catcher into the path of a projectile. In one embodiment, signals indicative of the path of a projectile are received by the projectile interceptor. A flinger mechanism has a projectile catcher releasably attached thereto, such that the projectile catcher can be released and launched from the flinger mechanism. A controller connected to the flinger mechanism uses the signals indicative of the path of the projectile to determine the launch parameters of the projectile catcher. The controller directs the flinger mechanism to release the projectile catcher such that the projectile catcher is launched into the path of the projectile and intercepts the projectile. 13 figs.

  12. Projectile stopping system

    DOE Patents [OSTI]

    Karr, Thomas J. (Alamo, CA); Pittenger, Lee C. (Livermore, CA)


    A projectile interceptor launches a projectile catcher into the path of a projectile. In one embodiment, signals indicative of the path of a projectile are received by the projectile interceptor. A flinger mechanism has a projectile catcher releasably attached thereto, such that the projectile catcher can be released and launched from the flinger mechanism. A controller connected to the flinger mechanism uses the signals indicative of the path of the projectile to determine the launch parameters of the projectile catcher. The controller directs the flinger mechanism to release the projectile catcher such that the projectile catcher is launched into the path of the projectile and intercepts the projectile.

  13. Stop/Start: Overview

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Battery: The battery is used to store energy generated from the gasoline engine or, during regenerative braking, from the electric motor. These batteries are only used to power the ...

  14. Stop/Start: Driving

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Battery: The battery is used to store energy generated from the gasoline engine or, during regenerative braking, from the electric motor. These batteries are only used to power the ...

  15. Study of the K{sub stop}{sup -}A{yields}{Sigma}{sup {+-}}{pi}{sup {+-}}A' reaction at DA{Phi}NE

    SciTech Connect (OSTI)

    Agnello, M.; Benussi, L.; Bertani, M.; Fabbri, F. L.; Gianotti, P.; Lucherini, V.; Bhang, H. C.; Bonomi, G.; Moia, F.; Zenoni, A.; Botta, E.; Bressani, T.; Bufalino, S.; Busso, L.; Calvo, D.; De Mori, F.; Feliciello, A.; Filippi, A.; Marcello, S.; Wheadon, R.


    This work describes an experimental study of the K{sub stop}{sup -}A{yields}{pi}{sup {+-}}{Sigma}{sup {+-}}A' reaction performed with the FINUDA spectrometer at the DA{Phi}NE {phi}-factory. The reaction is studied via the detection of {pi}{sup +}{pi}{sup -}n events on {sup 6,7}Li, {sup 9}Be, {sup 13}C and {sup 16}O.

  16. Study of collisons of supersymmetric top Quark in the channel stop anti-stop -> e+- mu-+ sneutrino anti-sneutrino b anti-b with the experience of D0 at the Tevatron. Callibration of the electromagnetic calorimeter at D0.

    SciTech Connect (OSTI)

    Mendes, Aurelien; /Marseille U., Luminy


    Supersymmetry is one of the most natural extensions of the Standard Model. At low energy it may consist in the Minimal Supersymmetric Standard Model which is the framework chosen to perform the search of the stop with 350 pb{sup -1} of data collected by D0 during the RunIIa period of the TeVatron. They selected the events with an electron, a muon, missing transverse energy and non-isolated tracks, signature for the stop decay in 3-body ({bar t} {yields} bl{bar {nu}}). Since no significant excess of signal is seen, the results are interpreted in terms of limit on the stop production cross-sections, in such a way that they extend the existing exclusion region in the parameter space (m{sub {bar t}},m{sub {bar {nu}}}) up to stop masses of 168 (140) GeV for sneutrino masses of 50 (94) GeV. Finally because of the crucial role of the electromagnetic calorimeter, a fine calibration was performed using Z {yields} e{sup +}e{sup -} events, which improved significantly the energy resolution.

  17. Search for decays of stopped long-lived particles produced in protonproton collisions at ?s = 8 TeV

    SciTech Connect (OSTI)

    Khachatryan, V.


    A search has been performed for long-lived particles that could have come to rest within the CMS detector, using the time intervals between LHC beam crossings. The existence of such particles could be deduced from observation of their decays via energy deposits in the CMS calorimeter appearing at times that are well separated from any protonproton collisions. Using a data set corresponding to an integrated luminosity of 18.6fb? of 8TeV protonproton collisions, and a search interval corresponding to 281 h of trigger livetime, 10 events are observed, with a background prediction of 13.2+3.62.5 events. Limits are presented at 95 % confidence level on gluino and top squark production, for over 13 orders of magnitude in the mean proper lifetime of the stopped particle. Assuming a cloud model of R-hadron interactions, a gluino with mass ?1000GeV and a top squark with mass ?525GeV are excluded, for lifetimes between 1 ?s and 1000s. These results are the most stringent constraints on stopped particles to date.

  18. Search for decays of stopped long-lived particles produced in protonproton collisions at ?s = 8 TeV

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Khachatryan, V.


    A search has been performed for long-lived particles that could have come to rest within the CMS detector, using the time intervals between LHC beam crossings. The existence of such particles could be deduced from observation of their decays via energy deposits in the CMS calorimeter appearing at times that are well separated from any protonproton collisions. Using a data set corresponding to an integrated luminosity of 18.6fb? of 8TeV protonproton collisions, and a search interval corresponding to 281 h of trigger livetime, 10 events are observed, with a background prediction of 13.2+3.62.5 events. Limits are presented at 95 %moreconfidence level on gluino and top squark production, for over 13 orders of magnitude in the mean proper lifetime of the stopped particle. Assuming a cloud model of R-hadron interactions, a gluino with mass ?1000GeV and a top squark with mass ?525GeV are excluded, for lifetimes between 1 ?s and 1000s. These results are the most stringent constraints on stopped particles to date.less

  19. Search for decays of stopped long-lived particles produced in proton–proton collisions at $$\\sqrt{s}= 8\\,\\text {TeV} $$

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Khachatryan, Vardan


    A search has been performed for long-lived particles that could have come to rest within the CMS detector, using the time intervals between LHC beam crossings. The existence of such particles could be deduced from observation of their decays via energy deposits in the CMS calorimeter appearing at times that are well separated from any proton–proton collisions. Using a data set corresponding to an integrated luminosity of 18.6 fb-1 of 8 TeV proton–proton collisions, and a search interval corresponding to 281 h of trigger livetime, 10 events are observed, with a background prediction of 13.2+3.6 -2.5 events. Limits are presentedmore » at 95 % confidence level on gluino and top squark production, for over 13 orders of magnitude in the mean proper lifetime of the stopped particle. Assuming a cloud model of R-hadron interactions, a gluino with mass ≤1000 GeV and a top squark with mass ≤525 GeV are excluded, for lifetimes between 1 µs and 1000 s. Finally, these results are the most stringent constraints on stopped particles to date.« less

  20. Contacts | Department of Energy

    Broader source: (indexed) [DOE]

    information to contact the State and Local Solution Center by mail or email: U.S. Department of Energy State and Local Solution Center Mail Stop EE-5W 1000 Independence Ave., SW...

  1. Thick-target neutron, gamma-ray, and radionuclide production for protons below 12 MeV on nickel and carbon beam-stops

    SciTech Connect (OSTI)

    Chadwick, M.B.; Young, P.G.; Wilson, W.B.


    Nuclear model calculations using the GNASH code are described for protons below 12 MeV incident on nickel and carbon isotopes, for beam stop design in the Los Alamos Accelerator Production of Tritium Low Energy Demonstration Accelerator (LEDA) project. The GNASH calculations apply Hauser-Feshbach and preequilibrium reaction theories and can make use of pre-calculated direct reaction cross sections to low-lying residual nucleus states. From calculated thin target cross sections, thick target 6.7 MeV and 12 MeV proton-induced production of neutrons, gamma rays, and radionuclides are determined. Emission spectra of the secondary neutrons and gamma rays are also determined. The model calculations are validated through comparisons with experimental thin- and thick-target measurements. The results of this work are being utilized as source terms in MCNP analyses for LEDA.

  2. Fred Loebl

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Stop 100PGF Berkeley, CA 94720 US Biographical Sketch Fred has a master's degree in Biomedical Engineering from the University of Virginia. He has been administering and...

  3. National Security Science | Los National Alamos Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this Issue (pdf) In 2012 NSS received an NNSA Defense Programs AWARD OF EXCELLENCE National Security Science Mail Stop A142 Los Alamos National Laboratory Los Alamos, NM...

  4. outstandingcheckform_new

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated: 042010 Chief Financial Officer Division Treasury Cashiers Office Treasury, Pension, & Tax CFO-TPT, Mail Stop P231 Los Alamos National Laboratory Los Alamos, NM 87544...

  5. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Identification Device User print name Government AgencySponsored Company Visitor's Z Number or ID Number Email Address Phone Number Fax Number Mail Stop and Office Location...

  6. Microsoft Word - fellows_nomination_reworked.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name:...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project (208) 360-3552 McGary, ...

  8. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  9. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  10. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  11. Alternative Fuels Data Center: Saving Fuel in the Garden State with Truck

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Stop Electrification Saving Fuel in the Garden State with Truck Stop Electrification to someone by E-mail Share Alternative Fuels Data Center: Saving Fuel in the Garden State with Truck Stop Electrification on Facebook Tweet about Alternative Fuels Data Center: Saving Fuel in the Garden State with Truck Stop Electrification on Twitter Bookmark Alternative Fuels Data Center: Saving Fuel in the Garden State with Truck Stop Electrification on Google Bookmark Alternative Fuels Data Center:

  12. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  13. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  15. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  16. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  18. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  19. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  20. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  1. Staff

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Staff Staff Iwona Sakrejda PDSF Project Lead email: phone: 510/486-4078 fax: 510/486-4316 Mail Stop 943 Lawrence Berkeley National Laboratory 1 Cyclotron Rd. Berkeley, CA 94720 Larry Pezzaglia PDSF System Analyst email: phone: 510/495-2318 fax: 510/486-4316 Mail Stop 943 Lawrence Berkeley National Laboratory 1 Cyclotron Rd. Berkeley, CA 94720 Lisa Gerhardt PDSF User Support email: phone: 510/486-4680 Mail Stop 943 Lawrence Berkeley National

  2. Recoding of the stop codon UGA to glycine by a BD1-5/SN-2 bacterium and niche partitioning between Alpha- and Gammaproteobacteria in a tidal sediment microbial community naturally selected in a laboratory chemostat

    SciTech Connect (OSTI)

    Hanke, Anna; Hamann, Emmo; Sharma, Ritin; Geelhoed, Jeanine; Hargesheimer, Theresa; Kraft, Beate; Meyer, Volker; Lenk, Sabine; Osmers, Harald; Wu, Rong; Makinwa, Kofi; Hettich, Robert {Bob} L; Banfield, Jillian F.; Tegetmeyer, Halina; Strouss, Marc


    Sandy coastal sediments are global hot spots for microbial mineralization of organic matter and denitrification. These sediments are characterized by advective pore water flow, tidal cycling and an active and complex microbial community. Metagenomic sequencing of microbial communities sampled from such sediments showed that potential sulfuroxidizing Gammaproteobacteria and members of the enigmaticBD1-5/ SN-2 candidatephylumwereabundantinsitu (>10% and 2% respectively). By mimicking the dynamic oxic/anoxic environmental conditions of the sedimentin a laboratory chemostat, a simplified microbial community was selected from the more complex inoculum. Metagenomics, proteomics and fluorescenceinsituhybridization showed that this simplified community contained both a potential sulfuroxidizing Gamma proteobacteria (at 24 2% abundance) and a member of the BD1-5 / SN-2candidatephylum (at 7 6%abundance). Despite the abundant supply of organic substrates to the chemostat, proteomic analysis suggested that the selected gamma proteobacterium grew partially auto trophically and performed hydrogen/formate oxidation. The enrichment of a member of the BD1-5/SN-2candidatephylum enabled, for the first time, direct microscopic observation by fluorescent insitu hybridization and the experimental validation of the previously predicted translation of the stop codon UGA into glycine.

  3. --No Title--

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    575 Sand Hill Road * Mail Stop 103 * Menlo Park, CA 94025-7015 650-926-2288 * Fax 650-926-4695 SLAC is operated by Stanford University for the U.S. Department of Energy SLAC...

  4. BPA-2012-01616-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (ECE1VED IOTA OFFICE TWS June 29, 2012 TE: F DATE: Bonneville Power Administration Christina J. Munro, FOIA Officer Mail Stop DK-7 r - P.O. Box 3621 Portland, OR 97208 RE: FOIA...

  5. Energy Citations Database (ECD) - Availability

    Office of Scientific and Technical Information (OSTI)

    vente des publications des Communautes Europeenes 37, rue Glesener-Luxembourg. FD U.S. Fish and Wildlife Service, 18th and C Streets, N.W., Mail Stop 1111, Arlington Square Bldg.,...

  6. Lisa Gerhardt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lisa Gerhardt Lisa Gerhardt Lisa Gerhardt Big Data Architect Phone: (510) 486-4680 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 ...

  7. SF 2050P (rev. 795)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in Medical Case No. Date received in Safety Name(Last, First, MI) Org. Mail Stop Sex Date of Birth Age Social Security Number Date of Incident Incident Day of Week Time of ...

  8. Yunjie Liu

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yunjie Liu Yunjie Liu Yunjie Liu Computer System Engineer (Climate Data Analyst) Data & Analytics Services 1 Cyclotron Road Mail Stop 59-4010A Berkeley, CA 94720 ...

  9. Notice of Intent to Investigate

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4, 2014 Dr. Charles F. McMillan President and Laboratory Director Los Alamos National Security, LLC Mail Stop A-100, Drop Point 03140071S Bikini Atoll Road, TA-3 Los Alamos, New...

  10. James Craw

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    James Craw James Craw jcraw.jpg James (Jim ) M. Craw Risks and Energy Manager Phone: (510) 486-5920 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley,...

  11. STOP WORK POLICY for Hanford Site Contractors

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Conditions exist that pose a danger to the health and safety of workers or the public; or Conditions exist, that if allowed to continue, could adversely affect the...

  12. Mobile Truck Stop Electrification Site Locator

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    of the zip code area instead of the actual location. If you're having difficulty, please contact the technical response team at 800-254-6735. They will be able to assist you. TSE...

  13. Monodisperse microdroplet generation and stopping without coalescence

    DOE Patents [OSTI]

    Beer, Neil Reginald


    A system for monodispersed microdroplet generation and trapping including providing a flow channel in a microchip; producing microdroplets in the flow channel, the microdroplets movable in the flow channel; providing carrier fluid in the flow channel using a pump or pressure source; controlling movement of the microdroplets in the flow channel and trapping the microdroplets in a desired location in the flow channel. The system includes a microchip; a flow channel in the microchip; a droplet maker that generates microdroplets, the droplet maker connected to the flow channel; a carrier fluid in the flow channel, the carrier fluid introduced to the flow channel by a source of carrier fluid, the source of carrier fluid including a pump or pressure source; a valve connected to the carrier fluid that controls flow of the carrier fluid and enables trapping of the microdroplets.

  14. Monodisperse microdroplet generation and stopping without coalescence

    DOE Patents [OSTI]

    Beer, Neil Reginald


    A system for monodispersed microdroplet generation and trapping including providing a flow channel in a microchip; producing microdroplets in the flow channel, the microdroplets movable in the flow channel; providing carrier fluid in the flow channel using a pump or pressure source; controlling movement of the microdroplets in the flow channel and trapping the microdroplets in a desired location in the flow channel. The system includes a microchip; a flow channel in the microchip; a droplet maker that generates microdroplets, the droplet maker connected to the flow channel; a carrier fluid in the flow channel, the carrier fluid introduced to the flow channel by a source of carrier fluid, the source of carrier fluid including a pump or pressure source; a valve connected to the carrier fluid that controls flow of the carrier fluid and enables trapping of the microdroplets.

  15. Stopping Illicit Procurement: Lessons from Global Finance

    SciTech Connect (OSTI)

    Hund, Gretchen; Kurzrok, Andrew J.


    Government regulators and the financial sector cooperate to combat money laundering and terrorist financing. This information-sharing relationship is built upon a strong legislative foundation and effective operational procedures. As with money-laundering and terrorist financing, halting the illicit procurement of dual-use commodities requires close coordination between government and industry. However, many of the legal and operational features present in financial threat cooperation do not exist in the export control realm. This article analyzes the applicability of financial industry cooperative measures to nonproliferation.

  16. Solar Newsletters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletters Solar Newsletters The SunShot Initiative offers e-newsletters to provide up-to-date information about our latest activities and upcoming funding opportunities. The SunShot newsletter provides weekly e-mail updates on solar office activities, events, funding opportunities, and publications. The SunShot concentrating solar power newsletter provides quarterly e-mail updates specific to the CSP industry. Update your subscriptions, modify your password or e-mail address, or stop

  17. Subscribe Today to E-mail Alerts from GTO

    Broader source: [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  18. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  19. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  20. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  1. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  2. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  3. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  4. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  5. Excellent performances of energy harvester using cantilever driving double-clamped 0.7Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-0.3PbTiO{sub 3} plates and symmetric middle-stops

    SciTech Connect (OSTI)

    Zeng, Zhou; Xu, Qing; Ren, Bo; Lin, Di; Di, Wenning; Luo, Haosu Wang, Dong


    We present a high performance nonlinear piezoelectric energy harvester constituted by a cantilever with symmetrically middle-stops and double-clamped piezoelectric plates based on piezoelectric single crystal 0.7Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-0.3PbTiO{sub 3}. Electrical properties of the device under different excitation frequencies, accelerations, and load resistances are studied systematically. Under a low acceleration of 3 m/s{sup 2} (0.3 g), a peak voltage of 26.2 V and a maximum normalized power of 25.6 mW/g{sup 2} were obtained across a matching impedance of 600 kΩ with favorable bandwidths. The low excitation acceleration and excellent performances indicate that the device can be a promising candidate for energy harvesting in low-power electronics and wireless sensors.

  6. Contact the Building Technologies Office | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    About » Contact the Building Technologies Office Contact the Building Technologies Office The Building Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email. Address U.S. Department of Energy Building Technologies Office (BTO) Mail Stop EE-2J 1000 Independence Ave, SW Washington, DC 20585 Phone Number 202.586.9127 Media Inquiries For media inquiries, please email the EERE communications team at Web Requests If you have a

  7. Contact Information | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information Head of Office of Technology Transfer: Laurie Bagley Princeton Plasma Physics Laboratory P.O. Box 451 Princeton, NJ 08543 Telephone: 609-243-2425 E-mail: PPPL Ombudsman: John C. Lacenere Princeton Plasma Physics Laboratory Mail Stop 08 P.O. Box 451 Princeton, NJ 08543 Telephone: 609-243-3308 E-mail: Fax: (609) 243-3030 Questions or comments? Please contact Laurie Bagley at . Associated Files: PDF icon Patent Awareness

  8. AVTA: 2010 Smart Fortwo Start-Stop Testing Results

    Broader source: [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. Baseline data, which provides a point of comparison for the other test results, was collected at two different research laboratories. Baseline and other data collected at Idaho National Laboratory is in the attached documents. Baseline and battery testing data collected at Argonne National Laboratory is available in summary and CSV form on the Argonne Downloadable Dynometer Database site ( Taken together, these reports give an overall view of how this vehicle functions under extensive testing.

  9. Mean excitation energies for stopping power as derived fromoscillator...

    Office of Scientific and Technical Information (OSTI)

    Numerical results are summarized. Authors: Inokuti, M ; Turner, J E Publication Date: 1978-01-01 OSTI Identifier: 6733705 Report Number(s): CONF-780534-2 TRN: 78-015326 DOE ...

  10. Capitol Christmas tree stops in Amarillo | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    April 2016 (12) March 2016 (28) February 2016 (21) January 2016 (21) December 2015 (18) November 2015 (11) October 2015 (15) September 2015 (9) August 2015 (10) July 2015 (8) June ...

  11. Which is Greener: Idle, or Stop and Restart? | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National Idling Reduction Network News - December 2012 Cold-Start Performance and Emissions Behavior of Alcohol Fuels in an SIDI Engine Using Transient Hardware-In-Loop Test Meth ...

  12. Conventional Start-Stop Vehicles | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Facilities Publications News Research Advanced Combustion Advanced Materials and Manufacturing Advanced Vehicle Technologies Buildings and Climate-Environment Education...

  13. Boosted di-boson from a mixed heavy stop

    SciTech Connect (OSTI)

    Ghosh, Diptimoy


    The lighter mass eigenstate ($\\widetilde{t}_1$) of the two top squarks, the scalar superpartners of the top quark, is extremely difficult to discover if it is almost degenerate with the lightest neutralino ($\\widetilde{\\chi}_1^0$), the lightest and stable supersymmetric particle in the R-parity conserving supersymmetry. The current experimental bound on $\\widetilde{t}_1$ mass in this scenario stands only around 200 GeV. For such a light $\\widetilde{t}_1$, the heavier top squark ($\\widetilde{t}_2$) can also be around the TeV scale. Moreover, the high value of the higgs ($h$) mass prefers the left and right handed top squarks to be highly mixed allowing the possibility of a considerable branching ratio for $\\widetilde{t}_2 \\to \\widetilde{t}_1 h$ and $\\widetilde{t}_2 \\to \\widetilde{t}_1 Z$. In this paper, we explore the above possibility together with the pair production of $\\widetilde{t}_2$ $\\widetilde{t}_2^*$ giving rise to the spectacular di-boson + missing transverse energy final state. For an approximately 1 TeV $\\widetilde{t}_2$ and a few hundred GeV $\\widetilde{t}_1$ the final state particles can be moderately boosted which encourages us to propose a novel search strategy employing the jet substructure technique to tag the boosted $h$ and $Z$. The reconstruction of the $h$ and $Z$ momenta also allows us to construct the stransverse mass $M_{T2}$ providing an additional efficient handle to fight the backgrounds. We show that a 4--5$\\sigma$ signal can be observed at the 14 TeV LHC for $\\sim$ 1 TeV $\\widetilde{t}_2$ with 100 fb$^{-1}$ integrated luminosity.

  14. From: Kathy Mikels To: Congestion Study Comments Subject: STOP...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The compensation cannot begin to cover the all of the losses, tangible and intangible that ... Third, the eastern states should develop the utility scale wind resources conveniently ...

  15. Design and Analysis of Muon Beam Stop Support Structures

    SciTech Connect (OSTI)

    Okafor, Udenna


    The primary objective of this thesis is to design and analyze support structures to be used in the installation, test and final positioning of the MBS throughout the life of the Mu2e experiment. There several requirements for the MBS imposed by both the scope of the experiment and, other components within the DS bore. The functions of the MBS are: 1. To limit the induced rates in the Tracker, the Calorimeter and the Cosmic Ray Veto due to backsplash-and-secondary interactions, and 2. To reduce radiation levels external to the Detector solenoid. The structures used in supporting the MBS will also adhere to requirements imposed by its functions. These requirements are critical to the support structures and affect design decisions. Other requirements critical to the design are imposed by the weight, positional tolerance and assembly procedure of the MBS, and also, the magnetic field and vacuum dose rate of the DS bore. A detailed breakdown of how each requirement affects the structural design can be found in chapter 2. Chapter 3 describes the design of each support structure and its attachment to the MBS while chapter 4 describes the results from structural analysis of the support structures. Chapter 5 describes evaluation for the design through testing and calculations while the conclusion in chapter 6 reports the current status at the time of this thesis submission with a plan for future work to be completed until final design and installation.

  16. Obama Administration's Rural Tour Stops in Western Alaska | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Zanesville, OH, to discuss green jobs and a new energy economy, with a focus on renewable energies. AUGUST 17TH Secretaries Arne Duncan and Tom Vilsack will travel to Hamlet,...

  17. Los Alamos Using Neutrons to Stop Nuclear Smugglers

    ScienceCinema (OSTI)

    Favalli, Andrea; Swinhoe, Martyn


    Los Alamos National Laboratory researchers have successfully demonstrated for the first time that laser-generated neutrons can be enlisted as a useful tool in the War on Terror. The international research team used the short-pulse laser at Los Alamos's TRIDENT facility to generate a neutron beam with novel characteristics that interrogated a closed container to confirm the presence and quantity of nuclear material inside. The successful experiment paves the way for creation of a table-top-sized or truck-mounted neutron generator that could be installed at strategic locations worldwide to thwart smugglers trafficking in nuclear materials.

  18. QP-5.3 Stop Work Rev0.pdf

    Office of Environmental Management (EM)

  19. Energy Efficiency Tricks to Stop Your Energy Bill from Haunting...

    Broader source: (indexed) [DOE]

    used is given off as heat. By replacing 15 inefficient incandescent bulbs with energy-saving lights, you can save about 50 per year -- all while repelling vampires. Learn more...

  20. NNSA-developed simulation seeks to understand and stop terrorist...

    National Nuclear Security Administration (NNSA)

    As NNSA verifies and maintains the U.S. nuclear deterrent without underground explosive nuclear testing, computer simulation has become a key capability and a vital part of the ...

  1. Conventional Start-Stop Vehicles | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    16,386.9 16,501.2 16,078.7 16,214.3 15,690.9 16,219.3 1994-2016 East Coast (PADD 1) W W W W W W 1994-2016 New England (PADD 1A) - - - - - - 1994-2016 Connecticut - - - - - - 1994-2016 Maine - - - - - - 1994-2016 Massachusetts - - - - - - 1994-2016 New Hampshire - - - - - - 1994-2016 Rhode Island - - - - - - 1994-2016 Vermont - - - - - - 1994-2016 Central Atlantic (PADD 1B) W W W W W W 1994-2016 Delaware - - - - - - 1994-2016 District of Columbia - - - - - - 1994-2016 Maryland - - - - - -

  2. NNSA lab stops bad guys from weaseling into critical infrastructure...

    National Nuclear Security Administration (NNSA)

    Monitoring system changes in real-time gives operators a jump on illicit activity in time for them to react, he said. Learn more about WeaselBoard technology in a Sandia article ...

  3. Stop and Restart Effects on Modern Vehicle Starting System Components

    SciTech Connect (OSTI)

    Windover, Paul R.; Owens, Russell J.; Levinson, Terry M.; Laughlin, Michael; Gaines, Linda


    Many drivers of personal and commercial vehicles believe that turning the vehicle off and on frequently instead of idling will cause premature wear of the starter system (starter motor and starter battery). As a result, they are concerned that the replacement cost of the starter motor and/or battery due to increased manual engine cycling would be more than the cumulative cost of the fuel saved by not idling unnecessarily. A number of variables play a role in addressing this complex concern, including the number of starting cycles per day, the time between starting cycles, the intended design life of the starting system, the amount of fuel used to restart an engine, and the cumulative cost of the saved fuel. Qualitative and quantitative information from a variety of sources was used to develop a life-cycle economic model to evaluate the cost and quantify the realistic factors that are related to the permissible frequency of starter motor cycles for the average vehicle to economically minimize engine idle time. Annual cost savings can be calculated depending on shutdown duration and the number of shutdown cycles per day. Analysis shows that cost savings are realized by eliminating idling exceeding one minute by shutting down the engine and restarting it. For a typical motorist, the damage to starting system components resulting from additional daily start cycles will be negligible. Overall, it was found that starter life is mostly dependent on the total number of start cycles, while battery life is more dependent on ensuring a full charge between start events.

  4. Mean excitation energies for stopping power of atoms and molecules...

    Office of Scientific and Technical Information (OSTI)

    find that most of the present I values are consistent with those given in the literature. ... Country of Publication: United States Language: ENGLISH Subject: 73 NUCLEAR PHYSICS AND ...

  5. Obama Administration's Rural Tour Stops in Western Alaska | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... On August 3, 2006, a fire destroyed thirty-five structures including twelve homes, an elementary school and high school, a teacher housing complex, stores, offices and storage ...

  6. Thomas Davis

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thomas Davis Thomas Davis tdavis.jpg Thomas (Tom) A. Davis Environmental Systems, CSE Phone: (510) 486-4524 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:34:5

  7. Tony Quan

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tony Quan Tony Quan tquan.jpg Wing Sum (Tony) Quan HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2012-10-23 12:44:05

  8. State and Local Solution Center Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    You are here Home » State and Local Solution Center Contacts State and Local Solution Center Contacts Please contact us by email or via postal delivery at: U.S. Department of Energy Energy Efficiency and Renewable Energy 1000 Independence Ave, SW, Mail Stop EE-2K U.S. Department of Energy Washington, DC 20585

  9. Del Black

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Del Black Del Black dblack.jpg Del C. Black HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:34:4

  10. Woo-Sun Yang

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Woo-Sun Yang Woo-Sun Yang Woo-Sun-Yang.jpg Woo-Sun Yang , Ph.D. HPC Consultant Phone: (510) 486-5735 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley,...

  11. Robert Neylan

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robert Neylan Robert Neylan Robert-Neyland.jpg Robert J. Neylan HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:35:2

  12. Aaron Garrett

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Garrett Aaron Garrett owetwoiethw.jpg Aaron G. Garrett Workstation Support Phone: (510) 495-2299 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Last edited: 2016-04-29 11:35:12

  13. Andrew Weaver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Andrew Weaver Andrew Weaver WeaverA.jpg Andrew R. Weaver HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Last edited: 2013-04-22 13:00:24

  14. Wilma Snider

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wilma Snider Wilma Snider Wilma Snider Student Assistant Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2014-09-24 14:34:11

  15. David Paul

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David Paul David Paul David-Paul.jpg David Paul Computational Systems Group Phone: (510) 495-2883 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2013-01-30 16:46:21

  16. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex: Email from either site may also be in this form: * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  17. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex:  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  18. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...


    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  20. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)


    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  1. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  2. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)


    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  3. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA) Sandia Site Office Dave Ferguson Savannah River Site Office Carol Elliot Y-12 Site Office Jill ...

  4. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  5. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  6. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)


    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  7. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones


    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  8. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  9. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  10. Contact Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contact Us Contact Us Contact the IG Hotline BY INTERNET Web Form BY E-MAIL CORRESPONDENCE U.S. Department of Energy Office of Inspector General ATTN: IG Hotline 1000 Independence Avenue, SW Mail Stop 5D-031 Washington, DC 20585 BY PHONE D.C. Metro Area: (202) 586-4073 Toll free: (800) 541-1625 FAX: (202) 586-4902 Contact Us Office of Inspector General 
1000 Independence Avenue, SW 
Washington, DC 20585 Phone: 202-586-1818 Fax: 202-586-7851 Media Inquiries: 202-253-2162

  11. SLAC Dosimeter / ID Request Form A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Feb 2009 (updated 13 May 2010) SLAC-I-760-0A07J-006-R010 1 of 2 SLAC Dosimeter / ID Request Form A (For applicants who have completed SLAC Environment, Safety, and Health Training) Sections 1-5 completed by applicant. Section 1: Contact Information Last name: First name: MI: Male Female Birth year (yyyy): Job title: Contact information/mailing address: City: State: Zip code: Country: Dept/Group: Phone number: Mail stop: Users or non-SLAC employees only: List employer, company, or university :

  12. m-45.p65

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NUREG66410 I EVALUATION OF MODAL COMBINATION METHODS FOR SEISMIC RESPONSE SPECTRUM ANALYSIS >aper ID K4-A4-US Morante, Richard* Brookhaven National Laboratory Building 130,32 Lewis Road . Uptonj New Yorlcj 11973-5000 USA " Wang, Yung Brookhaven National Laboratory Building 130,32 Lewis Road Upton,New York 11973-5000 USA Chokshi, Nilesh United States Nuclear Regulatory Commission Mail Stop T-10 L1 Washingto% DC 20555 USA Kenneally, Roger United States Nuclear Regulatory Commission Mail

  13. Concentrating Solar Power Newsletter | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletter Concentrating Solar Power Newsletter The SunShot concentrating solar power (CSP) newsletter highlights the progress made by the SunShot CSP program and its partners over the past quarter. Update your subscriptions, modify your password or e-mail address, or stop subscriptions at any time on your subscriber preferences page. You will need to use your e-mail address to log in. Stay Updated Sign up for our e-newsletter. Submit your email address below. Subscribe SunShot Home About the


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OFFSITE USE FORM Fill form out in triplicate, send original to Property Control, m/s 85A, give a copy to the Gate Guard and keep a copy for your files. This form needs to be updated once a year. Stanford Linear Accelerator Center Authorization Record Form: Stanford University Removal of Government Property from SLAC PO Box 4349 premises for Official Use Elsewhere (*) Date: To: Property Control, m/s 85A From: Name E Mail Address Group and Mail Stop SLAC Extension This is to notify you that I have

  15. Submitting Organization Sandia National Laboratories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hongyou Fan Advanced Materials Laboratory 1001 University Boulevard SE Albuquerque, NM 87106 Country: USA Phone: 505-272-7128 Fax: 505-272-7336 Contact Person Glenn D. Kubiak, Director Sandia National Laboratories PO Box 969 Mail Stop 9405 Livermore, CA 94551-0969 USA Phone: 925-294-3375 Fax: 925- 294-3403 Joint Entry Lockheed Martin Aeronautics Mail Zone 2893, PO Box 748 City: Fort Worth, Texas 76101 USA Earl Stromberg Phone: (817) 763-7376 Fax: (817) 762-6911

  16. Office of Energy Efficiency and Renewable Energy Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Office of Energy Efficiency and Renewable Energy Contacts Office of Energy Efficiency and Renewable Energy Contacts Contact information for the Office of Energy Efficiency and Renewable Energy (EERE) and the EERE technology areas and offices is listed below. Office of Energy Efficiency and Renewable Energy Office of the Assistant Secretary Energy Efficiency and Renewable Energy Mail Stop EE-1 Department of Energy Washington, DC 20585 Department of Energy Phonebook Website Contact

  17. Tina Butler

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Butler Tina Butler Tina-Butler.jpg Tina L. P. Butler Computational Systems Group Phone: (510) 495-2379 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Tina Butler is responsible for evaluating and recommending the direction and implementation of technology at NERSC, as well as performing ongoing system administration and support for the center's systems. Over the last 20 years, she held a variety of systems and applications

  18. Weatherization and Intergovernmental Program Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy You are here Home » About the Office » Weatherization and Intergovernmental Program Contacts Weatherization and Intergovernmental Program Contacts For information about how the Weatherization and Intergovernmental Programs Office is organized, see the organization chart. You can contact the office by email or via postal delivery at: U.S. Department of Energy Energy Efficiency and Renewable Energy 1000 Independence Ave, SW, Mail Stop EE-2K U.S. Department of Energy Washington, DC

  19. Valley Forge Corporate Center

    Energy Savers [EERE]

    April 29, 2013 Ms. Brenda Edwards US Department of Energy Buildings Technologies Program Mail Stop EE-2J 1000 Independence Ave, SW Washington, DC 20585-0121 Re: Energy Conservation Program: Notice of Proposed Rulemaking for Energy Conservation Standards for Residential Water Heaters, Docket Number: EERE-2012-BT- STD-0022, RIN Number: 1904-AC78 Dear Ms. Edwards: PJM provides these supplemental comments to underscore, from the perspective of the independent grid operator, the need for the

  20. Douglas Doerfler

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Douglas Doerfler Douglas Doerfler Doerfler3 Douglas Doerfler Computer Systems Engineer Advanced Technologies Group National Energy Research Scientific Computing Center Lawrence Berkeley National Laboratory 1 Cyclotron Road, Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Doug is a member of the Advanced Technologies Group (ATG) and specializes in high-performance computing architectures, benchmarking and performance analysis. Prior to joining Lawrence Berkeley

  1. Elizabeth Bautista

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth Bautista Elizabeth Bautista ejb-headshot.jpg Elizabeth J. Bautista Group Lead Operations Technology Group Phone: (510) 486-7454 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 Biographical Sketch Elizabeth Bautista is Group Lead for the Operations Technology Group, the team that ensures the accessibility, reliability, security and connectivity of NERSC and ESnet (ESnet by providing a central location for problem

  2. Greg Butler

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Butler Greg Butler Greg-Butler_2.jpg Gregory (Greg) F. Butler Storage Systems Group National Energy Research Scientific Computing Center Phone: (510) 486-8691 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Greg Butler has over 35 years experience in the computing field, with over 25 years experience in high performance scientific computing at DOE, DOD, and US EPA installations. His

  3. Continuous mutual improvement of macromolecular structure models in the PDB and of X-ray crystallographic software: the dual role of deposited experimental data

    Office of Scientific and Technical Information (OSTI)

    j^CrossMark diffraction data deposition Acta Crystallographies Section D Biological Crystallography ISSN 1399-0047 Continuous mutual improvement of macromolecular structure models in the PDB and of X-ray crystallographic software: the dual role of deposited experimental data Thomas C. Terwilligera* and Gerard Bricogneb* aBioscience Division, Los Alamos National Laboratory, Mail Stop M888, Los Alamos, NM 87507, USA, and bGlobal Phasing Ltd, Sheraton House, Castle Park, Cambridge CB3 0AX, England

  4. Prabhat

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prabhat Prabhat prabhat.jpg Prabhat Group Leader Data & Analytics Services Phone: (510) 486-7752 1 Cyclotron Road Mail Stop 50F1650 Berkeley, CA 94720 US Biographical Sketch Prabhat leads the Data and Analytics Services team at NERSC. His current research interests include scientific data management, parallel I/O, high performance computing and scientific visualization. He is also interested in applied statistics, machine learning, computer graphics and computer vision.

  5. Burlen Loring

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Burlen Loring Burlen Loring bloring-closer.jpg Burlen Loring Computational Systems Group Phone: (510) 486-7238 1 Cyclotron Road Mail Stop 50F1650 Berkeley, CA 94720 Biographical Sketch Burlen Loring is a computer systems engineer at Lawrence Berkeley National Laboratory. He joined the lab in January of 2011 and is a member of the NERSC Analytics team. Burlen has extensive experience with highperformance scientific computing and data visualization and holds a masters degree in


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RADIATION DOSE ESTIMATES TO ADULTS AND CHILDREN FROM VARIOUS RADIOPHARMACEUTICALS Latest Revision Date: 4/30/96 Radiation Internal Dose Information Center Oak Ridge Institute for Science and Education P.O. Box 117 Mail Stop 51 Oak Ridge, TN 37831 The radiopharmaceuticals and nuclear medicine studies considered in this report are listed in the Table of Contents on page 2. The radiation dose estimates given in the dose tables are based on the assumptions and models given in Chapter 17, Radiation

  7. Jeff Broughton

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeff Broughton Jeff Broughton Portrait Jeff Broughton Deputy for Operations and Systems Department Head Phone: (510) 486-5972 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Jeff Broughton is the NERSC Deputy for Operations and Systems Department Head, and has responsibility for acquiring, installing and operating all computational, networking and storage equipment for NERSC and the Joint Genome Institute. Current projects

  8. Joaquin Correa

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joaquin Correa Joaquin Correa Joaquin-Correa.jpg Joaquin Correa Computer Systems Engineer Data & Analytics Services Phone: (510) 463-4572 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 Biographical Sketch Joaquin Correa is a Solutions Architect, High Performance Computing Engineer and Pythonista in the Data Science Engagement team at NERSC. Currently, he is responsible for the development and integration of HPC solutions for Advanced Light Source (ALS), Linac

  9. Katie Antypas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Katie Antypas Katie Antypas setheight-Antypas.jpg Katie Antypas Scientific Computing and Data Services Department Head Phone: (510) 486-5575 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch As the department head of Scientific Computing and Data Services at the National Energy Research Scientific Computing (NERSC) Center, Katie has oversight of the Data Science Engagement, Data and Analytics Services, Storage Systems, and

  10. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Tools Printable Version Share this resource Send a link to Alternative Fuels Data Center to someone by E-mail Share Alternative Fuels Data Center on Facebook Tweet about Alternative Fuels Data Center on Twitter Bookmark Alternative Fuels Data Center on Google Bookmark Alternative Fuels Data Center on Delicious Rank Alternative Fuels Data Center on Digg Find More places to share Alternative Fuels Data Center on Truckstop Electrification Truck Stop Electrification Locator Locate

  11. Ankit Bhagatwala

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ankit Bhagatwala Ankit Bhagatwala 134c83d2 Ankit Bhagatwala , Ph.D. HPC Consultant Application Performance Specialist User Services Phone: 510-486-4385 1 Cyclotron Rd Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Prior to joining NERSC, Ankit was a postdoc at Sandia National Laboratories working on large scale direct numerical simulations of turbulent combustion. He received his Ph.D. in Aeronautics and Astronautics from Stanford University where he developed a

  12. Annette Greiner

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Annette Greiner Annette Greiner Annette-Greiner-2 Annette M. Greiner Web Application Developer Data & Analytics Services Phone: (510) 495-2935 Fax: (510) 486-4316 Web: 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Annette Greiner is a user interface designer and web developer with particular interest in interaction design and visualization. She earned a Master's in Information Management and Systems from UC Berkeley's

  13. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: UPA Response to DOE RFI; Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide input regarding the Department's management of the federal excess uranium inventory. Uranerz is a publicly

  14. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    January 21, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: UPA Response to DOE RFI; Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries Dear Mr. Henderson: On behalf of the Uranium Producers of America (UPA) and our member companies, we appreciate the opportunity to provide input regarding the Department's management of

  15. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    6, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries; Notice of Issues for Public Comment, Federal Register 80 14107 Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide comments on Federal Register notice FR 80 14107. Uranerz is a

  16. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    April 6, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries; Notice of Issues for Public Comment, Federal Register 80 14107 Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide comments on Federal Register notice FR 80 14107.

  17. Division Student Liaisons

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Student Liaisons 2015 OFFICE Division Student Liaison Work # Email MailStop DIRECTOR'S OFFICE Principal Associate Directors PADSTE, PADWP, PADGS, PADOPS, PADCAP Associate Directors ADCLES, ADE, ADEPS, ADTSC --- PADSTE ADPSM, ADW, ADX --- PADWP ADTIR ---PADGS ADBI, ADESH, ADNHHO, ADSS --- PADOPS ADEP, ADPM --- PADCAP Audits & Ethics (EA-DO) Tonie V. Baros 665-3104 A249 Chief Prime Contracts (PCM-DO) None Comm. & Public. Affairs (CGA-DO) CPA-CAS: Comm. Arts & Services

  18. Ms. Brenda Edwards U.S. Department of Energy, Buildings Technology Program

    Energy Savers [EERE]

    8, 2013 Ms. Brenda Edwards U.S. Department of Energy, Buildings Technology Program Mail Stop EE-2J 1000 Independence Ave. SW Washington DC 20585-0121 RE: Revisions to Energy Efficiency Enforcement Regulations EERE-2011-BT-TD- 0005 Dear Ms. Edwards: The National Marine Manufacturers Association (NMMA) appreciates the opportunity to respond to the Department of Energy (DOE), Office of Energy Efficiency and Renewable Energy's request for information published in the Federal Register (78 Fed. Reg.

  19. Scott Campbell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Operations Technology Storage Systems User Engagement Application Performance NESAP Postdocs Org Chart NERSC History NERSC Stakeholders Usage and User Demographics Careers Visitor Info Web Policies Home » About » Staff » Networking & Security » Scott Campbell Scott Campbell scampbell.jpg Scott Campbell Security Team Networking, Servers and Security Group Phone: (510) 486-6986 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical

  20. Steve Leak

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Steve Leak Steve Leak XBD201602 00029 Stephen (Steve) Leak HPC Consultant User Engagement Group 1 Cyclotron Rd Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Steve Leak joined the NERSC User Engagement team in 2016 with interests in application performance and in user experience of the HPC systems, including support, documentation and the batch system. His history includes batch system and user support for HPC at New York University, scientific application debugging

  1. Taylor Barnes

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Taylor Barnes Taylor Barnes TB Taylor Barnes Rear Admiral Grace Murray Hopper Postdoctoral Fellow 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Taylor received his Ph.D. in Chemistry from The California Institute of Technology in 2015. His research focused on the development of embedding methods for the efficient and accurate simulation of molecular systems. As part of the NESAP program, he is currently preparing Quantum Espresso, an electronic-structure code for

  2. Christopher Daley

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Christopher Daley Christopher Daley ChrisDaleyPic2014 Christopher Steven Daley HPC Performance Engineer Advanced Technology Group Phone: +1 510 486 4504 Fax: +1 510 486 4316 National Energy Research Scientific Computing Center 1 Cyclotron Rd Mail Stop 59R4010A (office 59-3072B) Berkeley, California 94720 US Biographical Sketch Chris Daley is a member of the Advanced Technology Group (ATG). Before joining ATG, Chris was a Scientific Programmer at the Flash Center for Computational

  3. Subfreezing Start/Stop Protocol for an Advanced Metallic Open-Flowfield Fuel Cell Stack

    Broader source: [DOE]

    This presentation, which focuses on fuel cell stacks, was given by C. Cross of Nuvera Fuel Cells at a DOE fuel cell meeting in February 2007.

  4. How I Learned to Stop Worrying and Love Professional Energy Assessment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Extension Energy Program Several years ago my family moved into a beautiful townhouse. ... In short, it was perfect for our young and growing family. My oldest daughter, Emily, was ...

  5. Synergy of inelastic and elastic energy loss. Temperature effects and electronic stopping power dependence

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zarkadoula, Eva; Xue, Haizhou; Zhang, Yanwen; Weber, William J.


    A combination of an inelastic thermal spike model suitable for insulators and molecular dynamics simulations is used to study the effects of temperature and electronic energy loss on ion track formation, size and morphology in SrTiO3 systems with pre-existing disorder. We find temperature dependence of the ion track size. In addition, we find a threshold in the electronic energy loss for a given pre-existing defect concentration, which indicates a threshold in the synergy between the inelastic and elastic energy loss.

  6. The ExoClean Filter System for Stop and Go Vehicles | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Fuel-Borne Catalyst Assisted DPF regeneration on a ... system architectures and Ceria-based fuel-borne catalysts for improvement and ...

  7. Dark matter searches for monoenergetic neutrinos arising from stopped meson decay in the Sun

    SciTech Connect (OSTI)

    Rott, Carsten; In, Seongjin; Kumar, Jason; Yaylali, David


    Dark matter can be gravitationally captured by the Sun after scattering off solar nuclei. Annihilations of the dark matter trapped and accumulated in the centre of the Sun could result in one of the most detectable and recognizable signals for dark matter. Searches for high-energy neutrinos produced in the decay of annihilation products have yielded extremely competitive constraints on the spin-dependent scattering cross sections of dark matter with nuclei. Recently, the low energy neutrino signal arising from dark-matter annihilation to quarks which then hadronize and shower has been suggested as a competitive and complementary search strategy. These high-multiplicity hadronic showers give rise to a large amount of pions which will come to rest in the Sun and decay, leading to a unique sub-GeV neutrino signal. We here improve on previous works by considering the monoenergetic neutrino signal arising from both pion and kaon decay. We consider searches at liquid scintillation, liquid argon, and water Cherenkov detectors and find very competitive sensitivities for few-GeV dark matter masses.

  8. How I Learned to Stop Worrying and Love Professional Energy Assessments

    Broader source: [DOE]

    It's worth a small investment of time and money now to assure yourself that your home is operating the way it should be.

  9. Synergy of inelastic and elastic energy loss. Temperature effects and electronic stopping power dependence

    SciTech Connect (OSTI)

    Zarkadoula, Eva; Xue, Haizhou; Zhang, Yanwen; Weber, William J.


    A combination of an inelastic thermal spike model suitable for insulators and molecular dynamics simulations is used to study the effects of temperature and electronic energy loss on ion track formation, size and morphology in SrTiO3 systems with pre-existing disorder. We find temperature dependence of the ion track size. In addition, we find a threshold in the electronic energy loss for a given pre-existing defect concentration, which indicates a threshold in the synergy between the inelastic and elastic energy loss.

  10. Can we stop the spread of influenza in schools with face masks?

    SciTech Connect (OSTI)

    Del Valle, Sara Y; Tellier, Raymond; Settles, Gary; Tang, Julian


    In the absence of a strain-specific vaccine and the potential resistance to antiviral medication, nonpharmaceutical interventions can be used to reduce the spread of an infectious disease such as influenza. The most common non-pharmaceutical interventions include school closures, travel restrictions, social distancing, enforced or volunteer home isolation and quarantine, improved hand hygiene, and the appropriate wearing of face masks. However, for some of these interventions, there are some unavoidable economic costs to both employees and employers, as well as possible additional detriment to society as a whole. For example, it has been shown that school-age children are most likely to be infected and act as sources of infection for others, due to their greater societal interaction and increased susceptibility. Therefore, preventing or at least reducing infections in children is a logical first-line of defense. For this reason, school closures have been widely investigated and recommended as part of pandemic influenza preparedness, and some studies support this conclusion. Yet, school closures would result in lost work days if at least one parent must be absent from work to care for children who would otherwise be at school. In addition, the delay in-academic progress may be detrimental due to mass school absenteeism. In particular, the pandemic influenza guidance by the U.S. Department of Health and Human Services recommends school closures for less than four weeks for Category 2 and 3 pandemics (i.e., similar to the milder 1957 and 1968 pandemics) and one to three months for Category 4 and 5 pandemics (i .e., similar to the 1918 pandemic ). Yet, given the above, it is clear that closing schools for up to three months is unlikely to be a practical mitigation strategy for many families and society. Thus modelers and policy makers need to weigh all factors before recommending such drastic measures, particularly if the agent under consideration typically has low mortality and causes a mild disease. Therefore, we contend that face masks are an effective, practical, non-pharmaceutical intervention that would reduce the spread of disease among school-children, while keeping schools open. Influenza spreads through person-to-person contact, via transmission by large droplets or aerosols (droplet nuclei) produced by breathing, talking, coughing or sneezing, as well as by direct (though most people touch very few others in their daily lives) or indirect (i.e., via fomites) contact. Face masks act as a physical barrier to reduce the amount of potentially infectious inhaled and exhaled particles, although they would not reliably protect the wearer against aerosols; a recent study also demonstrated that they can redirect and decelerate exhaled airflows (when worn by an infected individual) to prevent them from entering the breathing zones of others. Thus, if a whole classroom were to don face masks, disease transmission would be expected to be greatly diminished. Another recent study on face masks and hand hygiene show a 10-50% transmission reduction for influenza-like illnesses. Furthermore, face masks can act as an effective physical reminder and barrier to transmission by preventing the wearer from touching any potentially infectious secretions from their mucous membranes (i.e., from the nose and mouth), which is another mechanism for direct and indirect contact transmission for influenza. A recent systematic review has suggested that wearing masks can be highly effective in limiting the transmission of respiratory infections, such as influenza. Yet, admittedly, the effectiveness of this intervention strategy is highly dependent on compliance (i.e., the willingness to wear the mask in all appropriate situations), which in tum depends on comfort, convenience, fitness, and hygiene. Importantly, masks themselves must not become a source of infection (or reinfection); as such they should be replaced or sanitized daily (where possible) to maximize effectiveness. One solution could be for masks to be touted as fashion accessories, which may be particularly effective in influencing trend-conscious children. With support from the fashion industry and a child-targeted public health campaign, it may be possible to encourage such a trend and make the mask an acceptable fashion item, as well as an important means of infectious disease control.

  11. Stopping a water crossflow in a sour-gas producing well

    SciTech Connect (OSTI)

    Hello, Y. Le; Woodruff, J.


    Lacq is a sour-gas field in southwest France. After maximum production of 774 MMcf/D in the 1970`s, production is now 290 MMcf/D, with a reservoir pressure of 712 psi. Despite the loss of pressure, production is maintained by adapting the surface equipment and well architecture to reservoir conditions. The original 5-in. production tubing is being replaced with 7-in. tubing to sustain production rates. During openhole cleaning, the casing collapsed in Well LA141. The primary objective was to plug all possible hydraulic communication paths into the lower zones. The following options were available: (1) re-entering the well from the top and pulling the fish before setting cement plugs; (2) sidetracking the well; and (3) drilling a relief well to intercept Well LA141 above the reservoirs. The decision was made to start with the first option and switch to a sidetrack if this option failed.

  12. DOE Takes Action to Stop the Sales of Air-Con Air Conditioner...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Read the full Notice of Noncompliance Determination and Proposed Civil Penalty (pdf - 234kb). Follow the Department of Energy on Facebook, Twitter, Youtube and Flickr. Follow ...

  13. Energy Savers: A one-stop energy efficiency shop for multifamily building owners

    Broader source: [DOE]

    This is a document from Energy Impact Illinois posted on the website of U.S. Department of Energy's Better Buildings Neighborhood Program.

  14. Secretary Bodman Makes "Energizing America for Energy Security" Tour Stops to Launch New Solar Facility

    Broader source: [DOE]

    AUBURN HILLS, MICH - Secretary of Energy Samuel W. Bodman toured the world's largest amorphous silicon thin-fill solar manufacturing plant in Auburn Hills, Mich., today, and joined United Solar...

  15. The New York Times covers "National Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NPR: Particles From The Edge Of Space Shine A Light On Fukushima NPR: Particles From The Edge Of Space Shine A Light On Fukushima August, 30 2015 - It's one of the greatest, and ...

  16. Tina Declerck

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Declerck Tina Declerck Tina-DeClerk.jpg Tina M. Declerck Computational Systems Group Phone: (510) 486-7662 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Tina Declerck recently returned to the NERSC's Computational Systems Group after working there from 1997 through 2001. In her previous tenure at NERSC she managed the PDSF and Cray J90 SV1 clusters. During her hiatus, she worked at Sistina Software, the company that developed the

  17. Internal Revenue Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5-9651 06/01/2006 541990 ROSALIND TORRENCE 003 01/01/2014 LOS ALAMOS NATIONAL SECURITY, LLC LANS DEFINED BENEFIT PENSION PLAN 20-3104541 PO BOX 1663 MAIL STOP P280 LOS ALAMOS, NM 87545 10/09/2015 Filed with authorized/valid electronic signature. X Form 5500 (2014) Page 2 3a Plan administrator's name and address XSame as Plan Sponsor ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI c/o ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI ABCDEFGHI 123456789 ABCDEFGHI

  18. U.S. Department of Energy Office of Health, Safety, and Security Illness and Injury Surveillance Program Worker HeLth at a Glance, 2000-2009

    Energy Savers [EERE]

    U.S. Department of Energy Illness and Injury Surveillance Program Worker Health At A Glance, 2000-2009 Questions or comments about this report or the Department of Energy's (DOE) Illness and Injury Surveillance Program (IISP) within the offce of Health, Safety and Security may be directed to: Dr. Cliff Strader at or Dr. Bonnie Richter at Mail Stop HS-13 / GTN Building United States Department of Energy 1000 Independence Avenue, S.W. Washington,


    Energy Savers [EERE]

    URANIUM PRODUCERS OF AMERICA 141 EAST PALACE AVENUE, POST OFFICE Box 669, SANTA FE, NEW MEXICO 87504-0669 TELEPHONE(505) 982-4611; FAX (505) 988-2987; WWW.URANJUMPRODUCERSAMERJCA.COM David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 April 6, 2015 Re: UP A Response to DOE Notice of Issues for Public Comment on "Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining,

  20. Evan Racah

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evan Racah Evan Racah 1517546 Evan Racah Data Analytics Engineer Data & Analytics Group Phone: 510-486-6133 1 Cyclotron Road Mail Stop 943-0262 Berkeley, CA 94720 Evan joined NERSC as an intern in January 2015 and started as a Data Analytics Engineer in August 2015. He primarily works on implementing machine learning methods for various science problems and on exploring and managing data analytics and machine learning frameworks on Cori and Edison, like Spark and Caffe.

  1. Freedom of Information Act (FOIA) and Privacy Act Requests | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Freedom of Information Act (FOIA) and Privacy Act Requests Freedom of Information Act (FOIA) and Privacy Act Requests FOIA and Privacy Act Requests FOIA Requests FOIA Requester Service Center 1000 Independence Avenue, SW Mail Stop MA-90 Washington, DC 20585 Or by facsimile at (202) 586-0575. If you have any questions, please give us a call at (202) 586-5955. Privacy Act Requests Privacy Act requests can not be submitted electronically. They must be submitted in writing or in person

  2. Rebecca Hartman-Baker

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rebecca Hartman-Baker Rebecca Hartman-Baker head shot Rebecca J. Hartman-Baker Ph.D. Acting Group Leader Phone: (510) 486-4403 Fax: (510) 486-4316 User Engagement Group 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 US Biographical Sketch Rebecca Hartman-Baker is a computational scientist with expertise in the development of scalable parallel algorithms for the petascale and beyond. Her other research interests include inverse and ill-posed problems, numerical

  3. Rei Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rei Lee Rei Lee rlee.jpg Rei Chi Lee Storage Systems Group National Energy Research Scientific Computing Center Phone: (510) 495-2610 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Conference Papers Zhengji Zhao, Mike Davis, Katie Antypas, Yushu Yao, Rei Lee and Tina Butler, "Shared Library Performance on Hopper", A paper presented in the Cray User Group meeting, Apri 29-May-3, 2012, Stuttgart, German.,

  4. Richard Gerber

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gerber Richard Gerber GerberRichard Richard A. Gerber , Ph.D. Acting HPC Department Head, NERSC Senior Science Advisor Phone: (510) 486-6820 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Richard Gerber is NERSC's Senior Science Advisor and Acting Department Head of the HPC Department. The User Services group is NERSC's point of contact with its community of 6,000 users and 700 projects conducting research in basic and applied

  5. Brent Draney

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brent Draney Brent Draney bdraney.jpg Brent R. Draney Group Lead Networking, Servers and Security Group Phone: (510) 486-5791 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Before joining NERSC, Brent analyzed census data as an information specialist in Berkeley Lab's Work Force Diversity Office. Before coming to the Lab, he worked as a statistician at the National Council on Crime and Delinquency. He has completed a B.S. at the

  6. Brian Friesen

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brian Friesen Brian Friesen bfriesen Brian Friesen , Ph.D. Postdoctoral Fellow Phone: (510) 486-5654 Fax: (510) 486-6459 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 Biographical Sketch Brian received his Ph.D. in physics from the University of Oklahoma in 2015, supervised by Prof. Edward Baron. His research focused on astrophysics and cosmology, especially radiative transfer calculations in supernovae. At NERSC, he will be working with Ann Almgren and others in the

  7. Yiii%sz Rockwell

    Office of Legacy Management (LM)

    Yiii%sz Rockwell cmlo9a~-91304 International Tekphare: (213) 341-loo0 TWX: 910494-1237 E!x3cNPK Telex: 181017 ESGOWKA October 1, 1980 In reply refer to 80ESG9492 &=T27 c -.e d Dr. Ray Cooperstein U. S. Department of Energy Mail Stop E-201 Washington, DC 20545 Dear Dr. Cooperstein: Sujbect: Special Nuclear Material Transactions With Vitro Chemical Company This will summarize the information I gave you in our recent telephone conversation regarding shipments of special nuclear material between

  8. Isaac Ovadia

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Isaac Ovadia Isaac Ovadia Isaac-Ovadia.jpg Isaac Ovadia HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Isaac Ovadia joined LBNL in 2007 to provide Computer Operations and Network support to NERSC and ESNET. Isaac has a BS degree in Informations Systems Management from the University of San Francisco. In addition, he has a certification in Unix Systems Administration and

  9. Jack Deslippe

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jack Deslippe Jack Deslippe p8051795 2 Jack Deslippe , Ph.D. Acting Group Leader 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 US Biographical Sketch Jack Deslippe specializes in the support of material science applications and users at NERSC. He is engaged in evaluating and improving the suitability of these applications for potential N8 architectures. He additionally works on bringing dynamic web-content to users through MyNERSC, the MOTD system, Completed Jobs

  10. James Botts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    James Botts James Botts JamesBottsPic James Botts , Ph.D Phone: (510) 486-6149 Fax: (510) 486-4316 Computational Systems Group 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch James Botts earned his Ph.D in High Energy Theory from Stony Brook University. He subsequently worked at the University of Washington, Illinois Institute of Technology and DESY-IfH Zeuthen and has published papers on perturbative QCD. He was maintainer of the source code used to

  11. Jason Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lee Jason Lee jason 1992 Jason R Lee Deputy of Networking and Security NERSC Phone: (510) 486-7342 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Jason holds a MS in Computer Science from San Francisco State University. Jason is currently the Deputy of the Networking and Security Group, this involves handling the day-to-day operations and keeping the network flowing and security blocking. Jason has worked at Berkeley Lab since

  12. Jeff Porter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeff Porter Jeff Porter R Jefferson Porter Jefferson (Jeff) R. Porter Ph.D. Data & Analytics Group National Energy Research Scientific Computing Center Phone: (510) 502-7231 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Jeff Porter is a member of the Data and Analytics Services team, supporting grid and distributed computing services at NERSC. Jeff earned his PhD in Nuclear Physics from UC

  13. Alex Ubungen

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Ubungen Alex Ubungen Alex-Ubungen.jpg Alex B. Ubungen HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Alex Ubungen came from Pacific Gas and Electric Company, where he worked for 16 years. He has ten years of experience in the mainframe environment, and over four years experience in imaging technology, as a technical specialist in a document management system. He

  14. Yu Lok Lam

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yu Lok Lam Yu Lok Lam ylam.jpg Yu Lok Lam Team Lead, CSE Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Yu Lok Lam is the Team Lead and provides operations and network support to NERSC and ESnet control room staff. He earned a B.S. degree in Computer Information Systems at San Francisco State University and an M.S. degree in Information Technology from Golden Gate University. Last

  15. Slide 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The U.S. Department of Energy wants to keep you informed on the continued progress with the TC&WM EIS. As the Public Involvement and agency coordination work evolves, it is important to inform you about opportunities to get information on the TC&WM EIS. Mary Beth Burandt, Document Manager U.S. Department of Energy, Office of River Protection P.O. Box 450, Mail Stop H6-60 Richland, WA 99352 TC& Fax: 509-376-7701 - Phone: 888-829-6347 To view related documents on the EIS

  16. M

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    M od e - F ilt e r e d F ibe r A m p l if ie r  2007 R&D 100 Award Entry Form M od e - F ilt e r e d F ibe r A m p l if ie r  Submitting Organization Dahv A.V. Kliner Sandia National Laboratories P.O. Box 969, Mail Stop 9056 Livermore, CA 94551, USA 925-294-2821 (phone) 925-294-2595 (fax) AFFIRMATION: I affirm that all information submitted as a part of, or supplemental to, this entry is a fair and accurate represen- tation of this product.

  17. NEL-2013-02, LANS Enforcement Letter

    Energy Savers [EERE]

    2, 20 13 Dr. Charles F. McMillan Laboratory Director Los Alamos National Security, LLC Mail Stop A-1 00, Drop Point 03 14007 1 S Bikini Atoll Road, T A-3 Los Alamos, New Mexico 87545-1 663 NEL-2013 -02 Dear Dr. McMillan: The Office ofHealth, Safety and Security' s Office of Enforcement and Oversight conducted an evaluation of the deficiencies at the Los Alamos Neutron Science Center (LANSCE) described in the Los A lamos National Security, LLC (LANS) Noncomplia nce Tracking System (NTS) report

  18. DRAFT EM SSAB Chair's Meeting Waste Disposition Strategies Update

    Office of Environmental Management (EM)

    0, 2012 Roland Risser, Director Building Technologies Program U.S. Department of Energy Mail Stop EE-2J 1000 Independence Ave, SW Washington, DC 20585 Subject: Joint Hydraulic Institute/ASAP Letter of March 30 th - Clarification of Point #2 Dear Mr. Risser, We are looking forward to our meeting with you and your staff on May 1 st to present our progress regarding potential energy conservation standards for certain types of pumps. We would like to clarify point #2 in the referenced letter, which


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FOIARequestNovember 13, 2015 UNITED STEELWORKERS " ' " ' " USW Local 12-369 797 Stevens Drive Richland, Washington 99352 --P-hone-509-7-1-3-~J.180-or-FA-X:-509-71-3-1-783- - - * - - - UNRY AND $JIU!N$'!'H FQ.11; wc:HU<Elt5 November 13, 2015 USW-DLR-015-075 Dorothy Riehle, FOIA Officer Depa.rtment of Energy Richland Operations (RL) and (ORP) P.O. Box 550, Mail Stop A7-75 . Richland, WA 99352 SUBJECT: FREEDOM OF INFORMATION ACT AND/OR PRIVACY ACT REQUEST Dear Ms. Riehle: I am

  20. NEPA Lessons Learned Third Quarter FY 2006

    Office of Environmental Management (EM)

    2, 20 13 Dr. Charles F. McMillan Laboratory Director Los Alamos National Security, LLC Mail Stop A-1 00, Drop Point 03 14007 1 S Bikini Atoll Road, T A-3 Los Alamos, New Mexico 87545-1 663 NEL-2013 -02 Dear Dr. McMillan: The Office ofHealth, Safety and Security' s Office of Enforcement and Oversight conducted an evaluation of the deficiencies at the Los Alamos Neutron Science Center (LANSCE) described in the Los A lamos National Security, LLC (LANS) Noncomplia nce Tracking System (NTS) report

  1. ARQ.3.2002.dc/FINAL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    quarter 2002 Nuclear Materials Technology Division Mail Stop E500 Los Alamos, New Mexico 87545 LALP-02-061 Nonprofit organization US Postage Albuquerque, NM Permit No. 532 PAID Plutonium-based superconductor Los Alamos National Laboratory Researchers grow single crystals and discover unexpected superconductivity in a plutonium compound N u c l e a r M a t e r i a l s R e s e a r c h a n d T e c h n o l o g y Nuclear Materials Technology/Los Alamos National Laboratory Actinide Research Quarterly

  2. ARQ1.03final changes.pgm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1st/2nd quarter 2003 Nuclear Materials Technology Division Mail Stop E500 Los Alamos, New Mexico 87545 LALP-03-067 Nonprofit organization US Postage Albuquerque, NM Permit No. 532 PAID Los Alamos National Laboratory N u c l e a r M a t e r i a l s R e s e a r c h a n d T e c h n o l o g y Nuclear Fuels Nuclear Materials Technology/Los Alamos National Laboratory Actinide Research Quarterly NMT Division Director John Straw (acting) Scientific Advisors, Seaborg Institute David L. Clark Gordon D.

  3. Scott Burrow

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Burrow Scott Burrow staffportrait Scott Burrow Phone: (510) 486-4313 Fax: (510) 486-4316 Computational Systems Group 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Scott Burrow is a system administrator in the Computational Systems Group. Scott is currently the system lead for Carver's testbed and a backup for Carver. Prior to that Scott worked in commercial and high performance computing. Scott served as an IBM consultant on-site for NASA Ames from 2007-2009 and at

  4. Shane Canon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Shane Canon Shane Canon Shane-Cannon.jpg Shane Richard Canon Project Engineer Data & Analytics Services Group Phone: (510) 486-7024 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Shane Canon joined NERSC in 2000 to serve as a system administrator for the PDSF cluster. While working with PDSF he gained experience in cluster administration, batch systems, parallel file systems and the Linux kernel. In 2005, Shane left LBNL to

  5. Submitting Organization Sandia National Laboratories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd Bauer Sandia National Laboratories. P.O. Box 5800, MS 1077 Albuquerque, NM 87185-1077 USA Phone:: (505)-845-0086 Fax:: (505) 844-7833 Contact Person Glenn D. Kubiak, Director, Biological and Materials Sciences Center Sandia National Laboratories PO Box 969 Mail Stop 9405 Livermore, CA 94551-0969, USA Phone:: 925-294-3375 Fax:: 925-294-3403 Joint Entry: Front Edge Technology, Inc. 13455 Brooks Drive Baldwin Park, CA 91706 Submitter Simon Nieh Front Edge

  6. Clayton Bagwell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Clayton Bagwell Clayton Bagwell Clayton-Bagwell.jpg Clayton L. Bagwell Jr. Account & Allocation Support, NIM Development Team Member Phone: (510) 495-2264 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Clayton Bagwell provides Account & Allocation Support and is a primary member of the NIM (NERSC Information Management) system development team. He has a B.S. degree in Information Systems Management from the University of

  7. Craig Lant

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Craig Lant Craig Lant Craig-Lant.jpg Craig Lant Security Analyst Networking, Servers and Security Group Phone: (510) 423-3373 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Craig has more than 10 years of experience in a variety of computer security positions, with four years at Berkeley Lab and six years with UC Berkeley. His expertise includes firewalls, network intrusion detection systems, detecting compromised systems, and

  8. David Skinner

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David Skinner David Skinner David-Skinner.jpg David E. Skinner , Ph.D. Strategic Partnerships Lead Phone: 510-486-4748 Mobile: 510-847-2946 Web: 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch David Skinner earned his Ph.D. from UC Berkeley where his research focused on quantum and semi-classical approaches to chemical reaction dynamics and kinetics. At NERSC David leads strategic partnerships between NERSC and

  9. Environmental Protection Division (ENV)

    National Nuclear Security Administration (NNSA)

    e~Alamos NATIONAL LABORATORY - - l :il . l! IIJ - - Environmental Protection Division (ENV) Environmental Stewardship (ENV-ES) P.O. Box 1663, Mail Stop J978 Los Alamos, New Mexico 87545 (505) 665-8855/FAX: (505) 667-0731 Mr. George Rael Assistant Manager for Enviromnental Operations National Nuclear Security Administration Los Alamos Site Office, MS A316 Date : October 28, 2010 Refer To: ENV-ES: 10-211 SUBJECT: 2008 SITE-WIDE ENVIRONMENTAL IMP ACT STATEMENT MITIGATION ACTION PLAN ANNUAL REPORT


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AME:NDMENT OF SOLICITATION/MODIFICATION OF CONTRACT 1. CONTRACT 10 CODE PAGE 1 OF 224 PAGES 2. AMENDMENT/MODIFICATION NO. M202 3. EFFECTIVE DATE October 1, 2003 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.s. Department of Energy N.itional Nuclear Security Administration Sandia Site Office Mail Stop 0184 P.O. Box 5400 AlbuauerQue, NM 87185-5400 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, state, ZIP

  11. New Online Tool Creates One-Stop Shop for Federal Program Opportunities That Support Tribal Energy Development

    Broader source: [DOE]

    The White House Council on Native American Affairs Energy Subgroup launched a new online tool that provides a centralized repository of federal funding and technical assistance programs that can support energy project development for Tribes and Alaska Native villages and corporations.

  12. Synthetic Biology and Bioenergy: Helping the Good Guy and Stopping the Bad (2014 DOE JGI Genomics of Energy & Environment Meeting)

    SciTech Connect (OSTI)

    Mercedes-Roca, Maria [Zamorano Panamerican Agriculture School


    Maria Mercedes-Roca of the Zamorano Panamerican Agriculture School speaks at the 9th Annual Genomics of Energy & Environment Meeting on March 20, 2014 in Walnut Creek, Calif.

  13. Balancing particle absorption with structural support of the muon beam stop in muons-to-electrons experimental chamber

    SciTech Connect (OSTI)

    Majewski, Ryan


    The Mu2e experiment at Fermi National Accelerator Laboratory is seeking a full conversion from muon to electron. The design for Mu2e is based off MECO, another proposed experiment that sought a full conversion from muon to electron at Brookhaven National Laboratory in the 1990s. Mu2e will provide sensitivity that is four times the sensitivity of the previous experiment, SINDRUM II. Discovering muon to electron conversions could help explain physics beyond the standard model of the particle physics.

  14. Development of a one-stop beam verification system using electronic portal imaging devices for routine quality assurance

    SciTech Connect (OSTI)

    Lim, Sangwook; Ma, Sun Young; Jeung, Tae Sig; Yi, Byong Yong; Lee, Sang Hoon; Lee, Suk; Cho, Sam Ju; Choi, Jinho


    In this study, a computer-based system for routine quality assurance (QA) of a linear accelerator (linac) was developed by using the dosimetric properties of an amorphous silicon electronic portal imaging device (EPID). An acrylic template phantom was designed such that it could be placed on the EPID and be aligned with the light field of the collimator. After irradiation, portal images obtained from the EPID were transferred in DICOM format to a computer and analyzed using a program we developed. The symmetry, flatness, field size, and congruence of the light and radiation fields of the photon beams from the linac were verified simultaneously. To validate the QA system, the ion chamber and film (X-Omat V2; Kodak, New York, NY) measurements were compared with the EPID measurements obtained in this study. The EPID measurements agreed with the film measurements. Parameters for beams with energies of 6 MV and 15 MV were obtained daily for 1 month using this system. It was found that our QA tool using EPID could substitute for the film test, which is a time-consuming method for routine QA assessment.

  15. Vehicle Technologies Office Merit Review 2015: Development of Advanced High-Performance Batteries for 12V Start Stop Vehicle Applications

    Broader source: [DOE]

    Presentation given by Maxwell at 2015 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about development of advanced high...

  16. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)


    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.

  17. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Silverstein, Eva (1) Smith, Kendrick M., E-mail:, E-mail: ... Mirbabayi, Mehrdad ; Senatore, Leonardo ; Smith, Kendrick M., E-mail: ...

  18. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Enhancement in magnetic properties of magnesium substituted bismuth ferrite nanoparticles Xu, Jianlong ; Xie, Dan, E-mail:, E-mail: ...

  19. Hyekyung Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hyekyung Kim Hyekyung Kim Postdoctoral Appointee E-mail clarisse

  20. Osman Eryilmaz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Osman Eryilmaz Principal Materials Scientist E-mail eryilmaz

  1. Balendra Sutharshan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Balendra Sutharshan Chief Operations Officer - EGS E-mail bsutharshan

  2. Ryne T. Willig | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryne T. Willig Safety Associate - EGS E-mail rwillig

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI), E-mail:, E-mail:, ..., E-mail:, E-mail:, ...

  4. Better Buildings Neighborhood Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... * Contest held * Neighborhood meetings * Contest had participants * Social media * Direct mail * Social media applications * Direct mail resulted in applications * Telethon ...

  5. Desmond Toa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Desmond Toa Desmond Toa Desmond Toa Graduate Student E-mail: Website: Princeton University

  6. Undergraduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Undergraduate Students Undergraduate Students Ingrid Archibald Undergraduate Student E-mail: Divya Babbula Undergraduate Student E-mail: Stephanie Botkin E-mail: Kyle Cepeda Undergraduate Student E-mail: Andrew Ells Undergraduate Student E-mail: Ryan Farhat-Sabet Undergraduate Student E-mail: Caroline Focht Undergraduate Student E-mail:

  7. R A D I A T I O N D O S E E S T I M A T E S F O R R A D I O P H A R M A C E U T I C A L S

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    R A D I A T I O N D O S E E S T I M A T E S F O R R A D I O P H A R M A C E U T I C A L S April 30, 1996 RADIATION INTERNAL DOSE INFORMATION CENTER OAK RIDGE INSTITUTE FOR SCIENCE AND EDUCATION Mail Stop 51, P.O. Box 117, OAK RIDGE, TN 37831-0117 MICHAEL G. STABIN, Ph.D., CHP JAMES B. STUBBS, Ph.D. and RICHARD E. TOOHEY, Ph.D., CHP This document contains radiation dose estimates for a number of radiopharmaceuticals commonly used in nuclear medicine. Radiation dose estimates are listed for all

  8. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  9. Evaluation of the exothermicity of the chemi-ionization reaction...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cox, Richard M ; Kim, JungSoo ; Armentrout, P. B., E-mail:, E-mail:, E-mail: 1 ; Bartlett, Joshua ; ...

  10. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to Need to change OPMO contact (i.e., e-mail, name, telephone ...

  11. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)



    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  12. EERE Publication and Product Library

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Requests You have not requested any products. You can request that products and publications be mailed to you by clicking on the "Request by Mail" link in the publication...

  13. My Account | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    My Account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  14. User account | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User account User account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  15. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  16. Bryan Fry | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bryan Fry Bryan Fry Bryan Fry Graduate Student E-mail: Website: University of Pennsylvania Graduate...

  17. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Anzai, Jun, E-mail: Pharmacology Department, Central Research ... Asano, Taiji, E-mail: Pharmacology Department, Central Research ...

  18. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  19. Research and Technical Associates | Photosynthetic Antenna Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    placeholder image Amy LaFountain Research Affiliate Technical Assocaite E-mail: Graham Leggett Graham Leggett Professor E-mail:...

  20. Eric Rask | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rask Eric Rask Principal Research Engineer E-mail

  1. Eugene Stewart | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technician Sr. Eugene Stewart Telephone 630.252.4466 E-mail estewart

  2. Jared Ross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jared Ross Jared Ross Jared Ross Undergraduate Student E-mail: jbross

  3. Hussein S. Khalil | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hussein S. Khalil Nuclear Energy and Security Program Leader - EGS E-mail hkhalil

  4. Todd E. Combs | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd E. Combs Interim Associate Laboratory Director - EGS E-mail tcombs

  5. Peter Fuesz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Associate Peter Fuesz Telephone 630.252.7151 E-mail fuesz

  6. William Brocker | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    William Brocker ESH/QA Coordinator - EGS E-mail wbrocker

  7. Youngjin Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Youngjin Kim Postdoctoral Appointee E-mail Projects Distribution Automation

  8. Nicholaos Demas | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Nick Demas Nicholaos Demas Assistant Materials Scientist E-mail

  9. Edward J. Daniels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward J. Daniels Sr. Energy Systems Scientist Telephone (630) 252-5279 E-mail edaniels

  10. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  11. Ron Tollner | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ron Tollner Manager, Building & Systems Operations Telephone 630.252.4457 E-mail tollner

  12. Nathan Soulier | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nathan Soulier Nathan Soulier Nathan Soulier Graduate Student E-mail: nts116

  13. Susan R. Podoba | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Susan R. Podoba Executive Secretary to the Associate Laboratory Director - EGS E-mail spodoba

  14. A. Scott Dunlop | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Scott Dunlop National Security Facility Director - EGS E-mail adunlop

  15. Renee M. Nault | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Renee M. Nault Senior Manager, Business Development - EGS E-mail rmnault

  16. Mary A. McIntyre | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. McIntyre Business Strategist - EGS E-mail mmcintyre

  17. Mary Ellen Hennebry | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ellen Hennebry Assistant to the Associate Laboratory Director - EGS E-mail mehennebry

  18. Scott Goldsborough | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Goldsborough Principal Mechanical Engineer E-mail Projects Fuel Kinetics

  19. Sharon Nykolyshyn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sharon Nykolyshyn Executive Secretary - EGS Telephone 630-252-3739 E-mail snykolyshyn

  20. David Eckstein | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eckstein Principal Application Developer Telephone 630.252.7918 E-mail

  1. Denise M. Voss | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Denise M. Voss Executive Secretary to the Chief Operations Officer - EGS E-mail dvoss

  2. Aaron Greco | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Greco Principal Materials Scientist E-mail Website Argonne Experts

  3. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Martinson Telephone (630) 252-7520 E-mail martinson

  4. Graduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    People / Graduate Students Graduate Students Sam Barnett Graduate Student E-mail: Hui-Yuan Chen Graduate Student E-mail: Kaitlyn Faries Kaitlyn Faries Graduate Student E-mail: Phone: 314.935.6566 Kirsty Hacking Graduate Student E-mail: Ming-Yang Ho Graduate Student E-mail: Don Hood Graduate Student E-mail: Xia Huang Graduate Student E-mail:

  5. March 2016 APM newsletter | Department of Energy

    Energy Savers [EERE]

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  6. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah

  7. Scientific Advisory Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Advisory Committee Scientific Advisory Committee Gary Brudvig Scientific Advisory Committee Member E-mail: J. Clark Lagarias Scientific Advisory Committee Member E-mail: Thomas Moore Thomas Moore Scientific Advisory Committee Chair E-mail: Phone: 480.965.3308 Jennifer Ogilvie Scientific Advisory Committee Member E-mail: Marion Thurnauer Marion Thurnauer Scientific Advisory Committee Member E-mail:

  8. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... E-mail comments must be sent to If e- mail comments include an attachment, the attachment must be in either Adobe Acrobat (.pdf) or Microsoft Word (.doc) ...

  9. How is a Document Containing OUO Marked? | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with "Document(s) transmitted contain(s) OUO information". (DOE M 471.3-1, Admin Chg 1, Chapter I, 3f.) Marking e-mail: If the e-mail contains OUO information, the first line of ...

  10. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...

  11. Magnetohydrodynamics and deep mixing in evolved stars. I. Two...

    Office of Scientific and Technical Information (OSTI)

    Authors: Nucci, M. C. 1 ; Busso, M., E-mail:, E-mail: 2 + Show Author Affiliations Department of Mathematics and Informatics, ...

  12. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  13. Research Affiliates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engel Gregory Engel Research Affiliate E-mail: Phone: 773.834.0818 Harry Frank Harry Frank Research Affiliate E-mail: Phone: 860.486.2844...

  14. Microsoft Word - Document3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site;;; ... THE DESTRUCTION OF MUCH OF THE GULF OF MEXICO. DOE IS SCUM BUSHCHENEY COUNTRY AND HAS ...

  15. People | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Associate Professor, Schulich Faculty of Chemistry Research Affiliate E-mail: Phone: 972.4.829.2141 Dan Allen Dan Allen Multimedia Specialist E-mail: ...

  16. Operations Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manager, Research Administration and Operations E-mail: Phone: 314-935-3168 Dan Allen Dan Allen Multimedia Specialist E-mail: Phone: ...

  17. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Fornasini, Maria L., E-mail: cfmet@chimica.unige.i (1) Fornasini, Maria Luisa (1) Manfrinetti, Pietro (1) Manfrinetti, Pietro, E-mail: chimfis@chimica.unige.i (1) ...

  18. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Manfrinetti, P. (2) Fornasini, Maria L., E-mail: cfmet@chimica.unige.i ... Perrone 24, 16152 Genova ; Fornasini, Maria L., E-mail: cfmet@chimica.unige.i Phases ...

  19. Hopping conduction in p-type MoS{sub 2} near the critical regime...

    Office of Scientific and Technical Information (OSTI)

    ; Park, Joonsuk 4 ; Lin, Der-Yuh 5 ; Huang, Ying-Sheng 6 ; Choi, Heon-Jin 7 ; Chang, Joonyeon, E-mail:, E-mail: 1 ; Department of ...

  20. Novel short antibacterial and antifungal peptides with low cytotoxicit...

    Office of Scientific and Technical Information (OSTI)

    Ning Chen, Wei ; Ming Li, Chang ; Xu, Rong 1 ; Lamrani, Mouad 3 ; Mu, Yuguang, E-mail: 2 ; Leong, Susanna Su Jan 1 ; Wook Chang, Matthew, E-mail: ...

  1. ALS Beamlines Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0.05-1.2 eV This e-mail address is being protected from spambots. You need JavaScript enabled to view it (510) 495-2231 This e-mail address is being protected from...

  2. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read more... Contact: This e-mail address is being protected from spambots. You need JavaScript enabled to view it and This e-mail address is being protected from spambots. You...

  3. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Proposals: This e-mail address is being protected from spambots....

  4. Postdoctoral Associates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alastair Gardiner Research Associate E-mail: Phil Jackson Phil Jackson Postdoctoral Research Associate E-mail:

  5. Dr.James J.Spivey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doctoral Researcher Dr. Nitin Kumar E-mail: Ph.D, 2011, Louisiana State University, Baton Rouge Current Graduate Students Khietlethanh Mai E-mail:...

  6. Subscribe to Energy-Efficient Product Procurement Updates

    Broader source: [DOE]

    FEMP offers e-mail updates covering energy-efficient product procurement requirements, guidance, and assistance. Enter your e-mail address below to begin the registration process. After you...

  7. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... E-mail:, E-mail: The inflationary cosmology paradigm is very successful in explaining the CMB anisotropy to the percent level. ...

  8. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... HISTORY OF THE INTERGALACTIC MEDIUM Cen Renyue ; Chisari, Nora Elisa, E-mail:, E-mail: Using the state-of-the-art ...

  9. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  10. BPA-2011-01724-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the following: * An e-mail dated April 5, 2011 from Scott Bettin, BPA biologist, to Philip Key, BPA attorney. This e-mail is referred to in footnote 219 on page 77 of the...


    Office of Scientific and Technical Information (OSTI)

    solar neighborhood XXXV Distances to M dwarf systems within PC in the southern sky Winters Jennifer G Jao Wei Chun Dieterich Sergio B E mail winters astro gsu edu E mail jao astro...

  12. DOE - Fossil Energy:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEWSALERT - Keep Up to date with e-mail alerts from the Office of Fossil Energy Fossil Energy NEWSALERT is a free, e-mail notification service of the U.S. Department of Energy's ...

  13. BPA-2014-00787-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - D-1 Subject: FW: FOIA COE SL-003 BPA JOURNAL MAILING List Kalispell MOA 3-28-2014 Hi Christy and Kim, Pursuant to the FOIA, I request a copy of: 1) The BPA Journal Mailing...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Chen, Shyan-Shiou, E-mail: Department of Mathematics, National Taiwan Normal University, Taipei 11677, Taiwan (China) (2) Chen, Yi-Chiuan, E-mail: YCChen@math....


    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  16. Acknowledgements of Federal Support | U.S. DOE Office of Science...

    Office of Science (SC) Website

    Peer Reviewed Articles and Technical Papers News Releases, Public-Facing Web, Mailing, and ... Back to Top Back to Top News Releases, Public-Facing Web, Mailing, and Social Media For ...

  17. s-processing in AGB stars revisited. I. Does the main component...

    Office of Scientific and Technical Information (OSTI)

    Authors: Trippella, O. ; Busso, M. 1 ; Maiorca, E. 2 ; Kppeler, F. 3 ; Palmerini, S., E-mail:, E-mail: 4 + ...

  18. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and e-mails to EIA analysts. In fact, last year an e-mail was circulating around the Internet telling which oil companies imported the most crude oil from Persian Gulf countries...

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Flanagan, anna ., E-mail:, E-mail: (1) Save Results Save this search to My Library Excel (limit 2000) CSV (limit 5000) XML (limit 5000) Have ...

  20. Microsoft Word -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unless changed by holiday. Mail to: Dept. 3651, MS 0165 Fax to: 844-0645 Email: In your Word document, click on FileSend and click on "send."...

  1. GCPCC home

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prospective users can contact us via e-mail at hbellamyatlsudotedu or call Henry Bellamy at (225) 578- 9342. We continue to offer mail-in crystallography to both...

  2. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Lomaev, Mikhail I. (3) Shao, Tao, E-mail: (3) Tarasenko, Victor F. (3) ... bimolecular recombination in polymer solar cells Venkatesan, Swaminathan ; Chen, ...

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... All Solution-Processed Lead Halide Perovskite-BiVO 4 Tandem Assembly for Photolytic Solar ... ; Wei, Candong, E-mail: ; Jin, Qi, E-mail: ...

  4. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Mawr, Pennsylvania 19010-2899 ; Mallory, Frank B. ; Rheingold, Arnold L. ; Rotkina, Lolita ; Wang, Xianlong, E-mail:, E-mail: We ...

  5. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts

  6. C:\Forms\HQ F 1410.8.cdr

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Notification of Incoming Mail Receipt for Incoming Personal Mail Sender Name: Date Processed: Processed by: (Signature and Date of Person Picking up Mail) Employee Name: Routing Symbol: Room Number: Date Received: HQ F 1410.8 (8-84) HQ F 1410.8 (8-84) Date Contacted: MESSAGE To Sender: Mail must be picked up by: or item will be returned to sender. Part 1 Part 2

  7. Link Alpha G

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (EESA) Geophysics Department (EESA) GERT - General Employee Radiological Training (English) Gift Acceptance Information Glenn T. Seaborg Center Gmail (Google Mail)...

  8. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  9. Jag Kottapalli | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jag Kottapalli Jag Kottapalli Jag Kottapalli Undergraduate Student E-mail: Website: Washington University Undergraduate Students

  10. Ning Kang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ning Kang Eng Systems Modeling-Simulation-Analysis 2 E-mail Projects Distribution Automation

  11. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  12. Cvetelin Vasilev | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Postdoctoral Associate E-mail:

  13. Matthew Cuneo | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cuneo Matthew Cuneo Matthew Cuneo Instrument Scientist E-mail: Website: Oak Ridge National Lab...

  14. Jeremy King | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeremy King Jeremy King Jeremy King Graduate Student E-mail: Website: Washington University Graduate

  15. Joshua Auld | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Auld Joshua Auld Principal Computational Transportation Engineer E-mail Website Profile

  16. Joshua Mancini | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Mancini Joshua Mancini Joshua Mancini Graduate Student E-mail: Website: University of Pennsylvania

  17. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  18. Kent Bostick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Kent Bostick Kent Bostick Deputy Director of National and Global Security Programs - EGS E-mail kbostick

  19. Khem Acharya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Khem Acharya Khem Acharya Khem Acharya Alumnus E-mail: Website: Kansas State University

  20. H. Larry Collins | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    H. Larry Collins Director, Intelligence Analysis Division E-mail Projects Counterintelligence National Security Facility...

  1. Nestor J. Zaluzec | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nestor J. Zaluzec Senior Materials Scientist Telephone 630.252.4798 E-mail zaluzec@aaem.amc

  2. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  3. Christine Meyer | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meyer Christine Meyer Christine Meyer Undergraduate Student E-mail: Website: Washington University Undergraduate Students

  4. Daniel Oblinsky | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Oblinsky Daniel Oblinsky Daniel Oblinsky Graduate Student E-mail: Website: Princeton University Graduate Students...

  5. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  6. Ravindra Singh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ravindra Singh Eng Systems Modeling-Simulation-Analysis 3 E-mail Projects Distribution Automation

  7. Stuart Feinberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ES&H/QA Coordinator Stuart Feinberg Telephone 630.252.4673 E-mail

  8. Scott Massow | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Massow Assistant Facility Manager Telephone 630.252.4620 E-mail

  9. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  10. Daniel Weisz | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Weisz Daniel Weisz Daniel Weisz Graduate Student E-mail: Website: Washington University in St. Louis

  11. Webmaster

    Broader source: [DOE]

    The Bioenergy Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email.

  12. Gaozhong Shen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gaozhong Shen Gaozhong Shen Gaozhong Shen Senior Research Associate E-mail: Website: Pennsylvania State

  13. Guy Mayneord | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guy Mayneord Guy Mayneord Guy Mayneord Graduate Student E-mail: Website: University of Sheffield

  14. Vijaya Subramanian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vijaya Subramanian Vijaya Subramanian placeholder image Vijaya Subramanian Postdoctoral Associate E-mail: Postdoctoral Associates

  15. Audit Report: IG-0463 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    software, including electronic mail, word processing, spreadsheet, database management, application development, statistical analysis, presentation, security and virus protection. ...

  16. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  17. Microsoft Word - Current Contact Information2.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information: Name: Date: Z Number: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Mailing Address: Street or PO Box Apt...

  18. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  19. Amgad Elgowainy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amgad Elgowainy Team Leader/Principal Energy Systems Analyst E-mail Projects Models and Tools

  20. Amit Mandal | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amit Mandal Amit Mandal Amit Mandal Postdoctoral Research Associate E-mail: Website: Washington University Postdoctoral

  1. Andrew Ells | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ells Andrew Ells Andrew Ells Undergraduate Student E-mail: Website: Washington University

  2. Andrew Novick | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Novick Andrew Novick Andrew Novick Undergraduate Student E-mail: Website: Washington University in St. Louis

  3. Anthony Avarca | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anthony Avarca Systems Administrator Sr. Telephone 630.252.4940 E-mail

  4. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Study: Environmental Benefits of LEDs Greater Than CFLs Study: Environmental Benefits of LEDs Greater Than CFLs December 9, 2013 - 4:13pm Addthis A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic

  5. DOE HQ F 1410.8 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DOE HQ F 1410.8 Form used to notify mail recipients that they have mail to be picked up. PDF icon Notification of Incoming Mail More Documents & Publications DOE HQ F 1410.2 Headquarters Facilities Master Security Plan - Chapter 5, Classified Matter Protection and Control DOE F 1500.4

  6. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Che, Guang-Bo, E-mail: (1) Chern, I-Liang, E-mail: chern@math.ntu.e... Sciences ; Chern, I-Liang, E-mail: ; Department of Mathematics, ...

  7. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues

  8. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Postdoctoral Program Lead Kristene (Tina) Henne Phone: 630.252.2907 E-mail: Administrative Support Kathy Eggers Phone: 630.252.6034 E-mail: Mailing Address Argonne National Laboratory Postdoctoral Program Office Building 201, Room 151 9700 South Cass Avenue Argonne, Illinois 60439 U.S.A.

  9. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    with oil wells, effectively stopping crude oil production in certain offshore areas. Electricity outages at ports, refineries, along pipelines, or at terminals can stop the...

  10. System Break-Out Session

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...stop cycles * Ordinary air operation at ambient temperature (CO2 scrubber part of system) ...stop cycles * Ordinary air operation at ambient temperature (NO CO2 scrubber required) * ...

  11. Alumni | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alumni Alumni Khem Acharya Alumnus E-mail: Peter Adams Alumnus Christine Ajinjeru Alumna Srinivasa Rao Allu Alumnus Woo-Jin An Woo-Jin An Alumnus E-mail: Stephen Anthony Alumnus David Armstrong Alumnus Khuram Ashraf Khuram Ashraf Alumnus Angela Barragan Alumnus Hannah Behar Alumna Sasha Berger Alumna E-mail: David Bina David Bina Alumnus E-mail: Pratim Biswas Pratim Biswas Alumnus E-mail:

  12. 6/17/10 11:48 AM

    Office of Environmental Management (EM)

    8 AM mail 2552×3320 pixels Page 1 of 1 6/17/10 11:50 AM mail 2552×3340 pixels Page 1 of 1 6/17/10 11:50 AM mail 2548×3348 pixels Page 1 of 1

  13. Advanced Protein Characterization Facility | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    APCF Argonne's one-stop resource for genomic research, macromolecular crystallography, and synthetic biology More

  14. Unsubscribe | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Unsubscribe Unsubscribe here to stop receiving emails related to biomass analysis. Email (required) Unsubscribe Subscribe

  15. Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contacts Contacts U.S. Department of Energy SunShot Initiative Phone: 202-287-1862 Email: Mailing Address: 1000 Independence Avenue, SW Washington, DC, 20585 Additional information about visiting our offices. EPA Green Power Partnership Phone: 202-343-9859 Email: James Critchfield, GPP Program Manager Mailing address: U.S. Environmental Protection Agency 1200 Pennsylvania Ave., NW Mail Code 6202J Washington, DC 20460

  16. Health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  17. Experimental tests of paleoclassical transport

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Livermore National Laboratory, Livermore, CA 94551-0808, USA 11 Georgia Tech, Atlanta, GA 30332, USA 12 Johns Hopkins University, Baltimore, MD 21218, USA E-mail: ...

  18. Marianne Mintz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Marianne Mintz Marianne Mintz Team Leader - Energy Systems Analysis E-mail Projects Economic and Infrastructure Analysis Transportation Systems and Market Assessment...

  19. Search...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Agencies can also send job announcements via mass e- mails to students with disabilities ... or no usable vision, beyond light perception) 23- Inability to read ordinary size ...

  20. Henning Lohse-Busch | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Henning Lohse-Busch Section Manager - Vehicle Systems Research E-mail Projects Vehicle Thermal Management Vehicle and Component Benchmarking...

  1. Locations of Industrial Assessment Centers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers (IACs) Locations of Industrial Assessment Centers ... John Gardner Phone: (208) 426-5702 E-mail: Address: CAES Energy ...

  2. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Akai, Tomoko, E-mail: Advanced Glass Group, Research Institute for Ubiquitous Energy Devices, National Institute of Advanced Industrial Science and Technology ...

  3. CCEI REU Program Application | University of Delaware

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Street: City: State: Zip: Contact Information: Cell Phone: Email: Demographics Gender: Male Female Housing: Will you need campus housing? Yes No Citizenship:...

  4. Essam M. El-Hannouny | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Essam El-Hannouny Essam M. El-Hannouny Mechanical Engineer Telephone (630) 252-4976 E-mail

  5. Contact Us | Center for Energy Efficient Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Center for Energy Efficient Materials University of California Santa Barbara, CA 93106-9560 Location: Center for Energy Efficient Materials Phelps 2300 University ...

  6. EIA-Voluntary Reporting of Greenhouse Gases Program - Contact

    U.S. Energy Information Administration (EIA) Indexed Site

    Contact Voluntary Reporting of Greenhouse Gases Program Contact For more information on the Voluntary Reporting of Greenhouse Gases Program, contact us via e-mail, phone, fax, or ...

  7. Jaclyn Murton | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jaclyn Murton Jaclyn Murton Jaclyn Murton Technologist E-mail: Website: Sandia National Laboratories Research and Technical Associates

  8. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts Document Actions...

  9. Matthew Johnson | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Johnson Matthew Johnson Matthew Johnson Assistant Professor E-mail: Website: University of Sheffield Dr. Johnson is an Assistant Professor at the...

  10. Sam Barnett | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sam Barnett Sam Barnett Sam Barnett Graduate Student E-mail: Website: University of Sheffield Graduate Students

  11. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Interaction in Crystals for Emission of RADiation collaboration at Mainzer Mikrotron: Design, commissioning, and tests Lietti, D., E-mail: ; Backe, H. ;...

  12. Timothy Allison | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Timothy Allison Timothy Allison Energy & Environmental Policy Scientist Telephone 630-252-3209 E-mail

  13. Occupational Radiation Exposure | Department of Energy

    Broader source: (indexed) [DOE]

    Technical Support Contacts: REMS Project or any regulationspolicy issues: Nirmala Rao | (301) 903-2297 *E-mail Contact Preferred REMS System Support: Derek Hagemeyer | (865)...

  14. Solar Energy to Help Heat Major Commercial Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    For more information contact: e:mail: Public Affairs Golden, Colo., June 21, 1996 -- An innovative solar energy technology will have its first commercial application in Colorado at ...

  15. POLICY GUIDANCE MEMORANDUM #11A Approval Process for Dual Compensation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Ahtora Brooks Human Resource Specialists E-mail Ahtora.Brooks@Hq.Doe.Gov ... Phased Retirement Manager's Desk Reference on Human Capital Management Flexibilities

  16. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Health Division CERTIFIED MAIL- RETURN RECEIPT REQUESTED April30, 2014 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P. 0. Box 3090 Carlsbad,...

  17. Xia Huang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xia Huang Xia Huang Xia Huang Graduate Student E-mail: Website: University of Sheffield Graduate Students

  18. Xun Lu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xun Lu Xun Lu Xun Lu Postdoctoral Research Associate E-mail: Website: Oak Ridge National Laboratory Postdoctoral Associates

  19. Yan (Joann) Zhou | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joann Zhou Yan (Joann) Zhou Assistant Transportation Systems Analyst E-mail Projects Light Duty Electric Drive Vehicles Monthly Sales Updates The VISION Model

  20. Yaya Wang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yaya Wang Yaya Wang placeholder image Yaya Wang Research Affiliate Student E-mail: Research Affiliate Associates &