National Library of Energy BETA

Sample records for mail managers exchange

  1. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  2. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  3. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  4. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  5. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  6. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  7. Information Exchange management site

    Energy Science and Technology Software Center (OSTI)

    2012-08-01

    Django site used to manage the approved information exchanges (content models) after creation and public comment at https://github.com/usgin-models.

  8. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  9. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  10. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  11. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  12. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  13. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  14. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  15. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  16. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  17. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  18. Staff exchange with Chemical Waste Management. Final project report

    SciTech Connect (OSTI)

    Harrer, B.J.; Barak, D.W.

    1993-12-01

    Original objective was transfer of PNL technology and expertise in computational chemistry and waste flow/treatment modeling to CWM. Identification and characterization of a broader portfolio of PNL`s environmental remediation technologies with high potential for rapid application became the focus of the exchange, which included E-mail exchanges. Of the 14 technologies discussed, the following were identified as being of high interest to CWM: six phase soil heating (in-situ heating), high energy electrical corona, RAAS/ReOpt{trademark} (remedial, expert system), TEES{trademark} (catalytic production of methane from biological wastes), PST (process for treating petroleum sludge). CWM`s reorganization and downsizing reduced the potential benefits to industry, but a proposal for transfer and application of PST to Wheelabrator was made.

  19. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  20. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  1. Aging management guideline for commercial nuclear power plants - heat exchangers

    SciTech Connect (OSTI)

    Booker, S.; Lehnert, D.; Daavettila, N.; Palop, E.

    1994-06-01

    This Aging Management Guideline (AMG) describes recommended methods for effective detection and mitigation of age-related degradation mechanisms in commercial nuclear power plant heat exchangers important to license renewal. The intent of this AMG is to assist plant maintenance and operations personnel in maximizing the safe, useful life of these components. It also supports the documentation of effective aging management programs required under the License Renewal Rule 10 CFR 54. This AMG is presented in a manner that allows personnel responsible for performance analysis and maintenance to compare their plant-specific aging mechanisms (expected or already experienced) and aging management program activities to the more generic results and recommendations presented herein.

  2. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  3. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  6. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  7. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  8. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  9. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  10. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  11. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  12. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  13. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  14. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  15. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  16. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  17. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  18. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  19. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  20. Using Process Knowledge to Manage Disposal Classification of Ion-Exchange Resin - 13566

    SciTech Connect (OSTI)

    Bohnsack, Jonathan N.; James, David W.

    2013-07-01

    It has been previously shown by EPRI [1] that Class B and C resins represent a small portion by volume of the overall generation of radioactively contaminated resins. In fact, if all of the resins were taken together the overall classification would meet Class A disposal requirements. Lowering the classification of the ion exchange resins as they are presented for disposal provides a path for minimizing the amount of waste stored. Currently there are commercial options for blending wastes from various generators for Class A disposal in development. The NRC may have by this time introduced changes and clarifications to the Branch Technical Position (BTP) on Concentration Averaging and Encapsulation [2] that may ultimately add more flexibility to what can be done at the plant level. The BTP has always maintained that mixtures of resins that are combined for ALARA purposes or operational efficiency can be classified on the basis of the mixture. This is a point often misinterpreted and misapplied. This paper will address options that can be exercised by the generator that can limit B and C waste generation by more rigorous tracking of generation and taking advantage of the normal mix of wastes. This can be achieved through the monitoring of reactor coolant chemistry data and coupled with our knowledge of radionuclide production mechanisms. This knowledge can be used to determine the overall accumulation of activity in ion-exchange resins and provides a 'real-time' waste classification determination of the resin and thereby provide a mechanism to reduce the production of waste that exceeds class A limits. It should be noted that this alternative approach, although rarely used in a nuclear power plant setting, is acknowledged in the original BTP on classification [3] as a viable option for determining radionuclide inventories for classification of waste. Also included is a discussion of an examination performed at the Byron plant to estimate radionuclide content in the final waste stream from upstream sampling of reactor coolant and fuel pool water. (authors)

  1. Information Exchange development forums

    Energy Science and Technology Software Center (OSTI)

    2012-08-01

    GitHub repositories for creating and managing information exchanges (content models) for use in the NGDS and larger USGIN systems.

  2. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  3. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  4. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  5. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  6. Kitchen Appliance Upgrades Improve Water Efficiency at DOD Exchange Facilities: Best Management Practice Case Study #11: Commercial Kitchen Equipment (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2011-09-01

    The Exchange, formerly the Army and Air Force Exchange Service (AAFES), is a joint military activity and the U.S. Department of Defense?s (DOD) oldest and largest retailer. The Exchange is taking a leadership role in water efficiency improvements in their commercial kitchens by integrating water efficiency concepts into the organization?s overall sustainability plan and objectives.

  7. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  8. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  9. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  10. Energy Exchange | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Exchange Energy Exchange Energy Exchange Training and Trade Show: Providence, Rhode Island, August 9-11, 2016 Photo of the Providence, Rhode Island skyline. Building on the tradition of GovEnergy, the Energy Exchange is an educational and networking forum for those seeking to expand their knowledge of building operations, energy management, and sustainability in the federal sector. The Energy Exchange will be held at the Rhode Island Convention Center in Providence, Rhode Island. Training

  11. Kitchen Appliance Upgrades Improve Water Efficiency at DOD Exchange Facilities: Best Management Practice Case Study #11: Commercial Kitchen Equipment (Brochure), Federal Energy Management Program (FEMP)

    Energy Savers [EERE]

    kitchens are often forgotten when people begin to think about performing water audits. Kitchens can be out of sight, out of mind; a commercial kitchen, however, can consume large amounts of water and energy if inefficient appliances are installed. The Exchange, formerly the Army and Air Force Exchange Service (AAFES), is taking a leadership role in water efficiency improvements in their commercial kitchens by integrating water efficiency concepts into the organization's overall sustainability

  12. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  13. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  14. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  15. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  16. 2016 Energy Exchange (Providence, RI)

    Broader source: Energy.gov [DOE]

    The 2016 Energy Exchange in Providence, Rhode Island, will provide training to energy managers and sustainability professionals who are working to improve facility performance, advance the use of renewable energy, and reduce greenhouse gas emissions at federal sites.

  17. Worldwide 'Power exchanges' | OpenEI Community

    Open Energy Info (EERE)

    Breakdown Structure Draft MHK LCOE Reporting Guidance Draft Worldwide 'Power exchanges' Hi Vanessa-I connected wit... 2013 projects and funding more Group members (24) Managers:...

  18. HEAT EXCHANGER

    DOE Patents [OSTI]

    Fox, T.H. III; Richey, T. Jr.; Winders, G.R.

    1962-10-23

    A heat exchanger is designed for use in the transfer of heat between a radioactive fiuid and a non-radioactive fiuid. The exchanger employs a removable section containing the non-hazardous fluid extending into the section designed to contain the radioactive fluid. The removable section is provided with a construction to cancel out thermal stresses. The stationary section is pressurized to prevent leakage of the radioactive fiuid and to maintain a safe, desirable level for this fiuid. (AEC)

  19. International fuel cycle and waste management technology exchange activities sponsored by the United States Department of Energy: FY 1982 evaluation report

    SciTech Connect (OSTI)

    Lakey, L.T.; Harmon, K.M.

    1983-02-01

    In FY 1982, DOE and DOE contractor personnel attended 40 international symposia and conferences on fuel reprocessing and waste management subjects. The treatment of high-level waste was the topic most often covered in the visits, with geologic disposal and general waste management also being covered in numerous visits. Topics discussed less frequently inlcude TRU/LLW treatment, airborne waste treatment, D and D, spent fuel handling, and transportation. The benefits accuring to the US from technology exchange activities with other countries are both tangible, e.g., design of equipment, and intangible, e.g., improved foreign relations. New concepts initiated in other countries, particularly those with sizable nuclear programs, are beginning to appear in US efforts in growing numbers. The spent fuel dry storage concept originating in the FRG is being considered at numerous sites. Similarly, the German handling and draining concepts for the joule-heated ceramic melter used to vitrify wastes are being incorporated in US designs. Other foreigh technologies applicable in the US include the slagging incinerator (Belgium), the SYNROC waste form (Australia), the decontamination experience gained in decommissioning the Eurochemic reprocessing plant (Belgium), the engineered surface storage of low- and intermediate-level waste (Belgium, FRG, France), the air-cooled storage of vitrified high-level waste (France, UK), waste packaging (Canada, FRG, Sweden), disposal in salt (FRG), disposal in granite (Canada, Sweden), and sea dumping (UK, Belgium, The Netherlands, Switzerland). These technologies did not necessarily originated or have been tried in the US but for various reasons are now being applied and extended in other countries. This growing nuclear technological base in other countires reduces the number of technology avenues the US need follow to develop a solid nuclear power program.

  20. NREL Meeting to Discuss Camp George West Land Exchange

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meeting to Discuss Camp George West Land Exchange For more information contact: Kerry Masson (303) 275-4083 e:mail: kerry_masson@nrel.gov Golden, Colo., Sept. 1, 1998 — The U.S. Department of Energy (DOE) and the National Renewable Energy Laboratory (NREL) will host a meeting Sept. 16 to inform the community surrounding NREL about a land exchange involving DOE, Jefferson County and the state of Colorado. The property to be exchanged involves the Camp George West site which borders NREL's main

  1. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  2. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  3. Heat exchanger

    DOE Patents [OSTI]

    Wolowodiuk, Walter

    1976-01-06

    A heat exchanger of the straight tube type in which different rates of thermal expansion between the straight tubes and the supply pipes furnishing fluid to those tubes do not result in tube failures. The supply pipes each contain a section which is of helical configuration.

  4. Registration Now Open for Energy Exchange 2016 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Registration Now Open for Energy Exchange 2016 Registration Now Open for Energy Exchange 2016 March 17, 2016 - 5:12pm Addthis Federal Energy Management Program Director Dr. Timothy Unruh presents to attendees at the 2015 Energy Exchange in Phoenix, Arizona. Federal Energy Management Program Director Dr. Timothy Unruh presents to attendees at the 2015 Energy Exchange in Phoenix, Arizona. Registration is now open for the Energy Exchange, which is scheduled for August 9-11, 2016, at the Rhode

  5. Low-Cost Microchannel Heat Exchanger

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALTEX TECHNOLOGIES CORPORATION Low-Cost Microchannel Heat Exchanger DOE Grant DE-EE0004541 2013-2014 Dr. John T. Kelly Altex Technologies Corporation 244 Sobrante Way Sunnyvale, CA 94086 Phone: 408-328-8302 E-mail: john@altextech.com U.S. DOE Advanced Manufacturing Office PEER Review Meeting Washington, D.C. May 6-7, 2014 This presentation does not contain any proprietary, confidential, or otherwise restricted information. ALTEX TECHNOLOGIES CORPORATION Project Objectives  Define and test low

  6. CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records Maria Levesque, Director Enterprise Records Management Division (IM-23) Email: Maria.Levesque@hq.doe.gov Troy Manigault, Departmental Records Officer Deidre Wilkerson, Management Analyst Tonya Meadows, Management Analyst Gale Mitchell, Management Analyst Markus Robinson - Contractor Greg Holland - Contractor Andrea Heimbrock - Contractor Records Management Program E-mail:

  7. DOE - Office of Legacy Management -- Directions

    Office of Legacy Management (LM)

    Mailing: U.S. Department of Energy 10995 Hamilton-Cleves Hwy. Harrison, OH 45030 U.S. Department of Energy Office of Legacy Management Contractor Navarro Research and Engineering, ...

  8. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  9. Heat exchanger

    DOE Patents [OSTI]

    Brackenbury, P.J.

    1983-12-08

    A heat exchanger comparising a shell attached at its open end to one side of a tube sheet and a detachable head connected to the other side of said tube sheet. The head is divided into a first and second chamber in fluid communication with a nozzle inlet and nozzle outlet, respectively, formed in said tube sheet. A tube bundle is mounted within said shell and is provided with inlets and outlets formed in said tube sheet in communication with said first and second chambers, respectively.

  10. Heat exchanger

    DOE Patents [OSTI]

    Brackenbury, Phillip J.

    1986-01-01

    A heat exchanger comparising a shell attached at its open end to one side of a tube sheet and a detachable head connected to the other side of said tube sheet. The head is divided into a first and second chamber in fluid communication with a nozzle inlet and nozzle outlet, respectively, formed in said tube sheet. A tube bundle is mounted within said shell and is provided with inlets and outlets formed in said tube sheet in communication with said first and second chambers, respectively.

  11. The allowance exchange - ALEX

    SciTech Connect (OSTI)

    Mangis, J.K.; Miller, C.; Nicholas, J.

    1997-12-31

    The success of market approaches to pollution control in reducing the cost of compliance with environmental regulation, has insured the inclusion of emissions trading programs in current and future regulatory programs. As these environmental trading programs multiply, (SO{sub 2}, NO{sub x}, Ozone Precursors, Wetlands, CO{sub 2} and others), utility companies will need a central location to buy, sell, and trade these allowances to meet regulatory needs. In response, SAIC has designed and prototyped an electronic trading system that can provide a common forum for the location and exchange of environmental allowances, marketable permits, and other market based instruments for environmental management. SAIC intends to open and operate the Allowance Exchange (ALEX) for the trading of all environmental allowances, associated with the operation of electric utilities, as a service to the nation, the industry, and the environmental community.

  12. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  13. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  14. Segmented heat exchanger

    DOE Patents [OSTI]

    Baldwin, Darryl Dean; Willi, Martin Leo; Fiveland, Scott Byron; Timmons, Kristine Ann

    2010-12-14

    A segmented heat exchanger system for transferring heat energy from an exhaust fluid to a working fluid. The heat exchanger system may include a first heat exchanger for receiving incoming working fluid and the exhaust fluid. The working fluid and exhaust fluid may travel through at least a portion of the first heat exchanger in a parallel flow configuration. In addition, the heat exchanger system may include a second heat exchanger for receiving working fluid from the first heat exchanger and exhaust fluid from a third heat exchanger. The working fluid and exhaust fluid may travel through at least a portion of the second heat exchanger in a counter flow configuration. Furthermore, the heat exchanger system may include a third heat exchanger for receiving working fluid from the second heat exchanger and exhaust fluid from the first heat exchanger. The working fluid and exhaust fluid may travel through at least a portion of the third heat exchanger in a parallel flow configuration.

  15. Energy Exchange 2015 Overview Presentation

    Broader source: Energy.gov [DOE]

    Webinar presentation slides delivered by Federal Energy Management Program Director Timothy Unruh offer an overview of the Energy Exchange 2015, a federal training event that took place from August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  16. management

    National Nuclear Security Administration (NNSA)

    5%2A en Management and Budget http:www.nnsa.energy.govaboutusouroperationsmanagementandbudget

  17. Corrosive resistant heat exchanger

    DOE Patents [OSTI]

    Richlen, Scott L.

    1989-01-01

    A corrosive and errosive resistant heat exchanger which recovers heat from a contaminated heat stream. The heat exchanger utilizes a boundary layer of innocuous gas, which is continuously replenished, to protect the heat exchanger surface from the hot contaminated gas. The innocuous gas is conveyed through ducts or perforations in the heat exchanger wall. Heat from the heat stream is transferred by radiation to the heat exchanger wall. Heat is removed from the outer heat exchanger wall by a heat recovery medium.

  18. management

    National Nuclear Security Administration (NNSA)

    5%2A en Management and Budget http:nnsa.energy.govaboutusouroperationsmanagementandbudget

    P...

  19. Waste Heat Management Options: Industrial Process Heating Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Management Options Industrial Process Heating Systems By Dr. Arvind C. Thekdi E-mail: athekdi@e3minc.com E3M, Inc. August 20, 2009 2 Source of Waste Heat in Industries * Steam ...

  20. Woven heat exchanger

    DOE Patents [OSTI]

    Piscitella, Roger R.

    1987-01-01

    In a woven ceramic heat exchanger using the basic tube-in-shell design, each heat exchanger consisting of tube sheets and tube, is woven separately. Individual heat exchangers are assembled in cross-flow configuration. Each heat exchanger is woven from high temperature ceramic fiber, the warp is continuous from tube to tube sheet providing a smooth transition and unitized construction.

  1. Woven heat exchanger

    DOE Patents [OSTI]

    Piscitella, R.R.

    1984-07-16

    This invention relates to a heat exchanger for waste heat recovery from high temperature industrial exhaust streams. In a woven ceramic heat exchanger using the basic tube-in-shell design, each heat exchanger consisting of tube sheets and tube, is woven separately. Individual heat exchangers are assembled in cross-flow configuration. Each heat exchanger is woven from high temperature ceramic fiber, the warp is continuous from tube to tube sheet providing a smooth transition and unitized construction.

  2. Scientific Exchange Program | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Exchange Program Scientific Exchange Program Applications due February

  3. Energy Exchange News

    Broader source: Energy.gov [DOE]

    Please join FEMP Director Tim Unruh and Julia Kelley with Oak Ridge National Laboratory (ORNL) for a presentation on the Energy Exchange. The Energy Exchange is a new 2 1/2 day training opportunity...

  4. Anion exchange polymer electrolytes

    DOE Patents [OSTI]

    Kim, Yu Seung; Kim, Dae Sik

    2013-09-10

    Solid anion exchange polymer electrolytes include chemical compounds comprising a polymer backbone with side chains that include guanidinium cations.

  5. Charge exchange system

    DOE Patents [OSTI]

    Anderson, Oscar A.

    1978-01-01

    An improved charge exchange system for substantially reducing pumping requirements of excess gas in a controlled thermonuclear reactor high energy neutral beam injector. The charge exchange system utilizes a jet-type blanket which acts simultaneously as the charge exchange medium and as a shield for reflecting excess gas.

  6. Skew chicane based betatron eigenmode exchange module

    DOE Patents [OSTI]

    Douglas, David

    2010-12-28

    A skewed chicane eigenmode exchange module (SCEEM) that combines in a single beamline segment the separate functionalities of a skew quad eigenmode exchange module and a magnetic chicane. This module allows the exchange of independent betatron eigenmodes, alters electron beam orbit geometry, and provides longitudinal parameter control with dispersion management in a single beamline segment with stable betatron behavior. It thus reduces the spatial requirements for multiple beam dynamic functions, reduces required component counts and thus reduces costs, and allows the use of more compact accelerator configurations than prior art design methods.

  7. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  8. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  9. UNCLASSIFIED UNCLASSIFIED Nuclear Materials Management & Safeguards System

    National Nuclear Security Administration (NNSA)

    UNCLASSIFIED Nuclear Materials Management & Safeguards System CONTACT INFORMATION UPDATE REPORTING IDENTIFICATION SYMBOL (RIS) RIS: Address: Facility Name: CONTACTS Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Return Via Mail To: U.S Department Of Energy ATTN: NMMSS Staff NA-73, GTN 1000 Independence Avenue, SW Washington, DC 20585-1290 Return Via Fax To: 301-903-1998 Return Via E-Mail To: NMMSS@nnsa.doe.gov

  10. Energy Exchange Presentations

    Broader source: Energy.gov [DOE]

    Presentations from Energy Exchange, a two-and-a-half day training scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  11. Residential Exchange Program Settlement

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contract No. 09PB-12132: deleting in their entirety and replacing with new language Sections 7, 11, and 12; and adding new Section 22, CALCULATION OF EXCHANGE PERIOD...

  12. Nercenergy Microsoft Exchange Servers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pillars of Web Application Monitoring http:www.nercenergy.comthe-four-pillars-of-microsoft-exchange-server-monitoring http:www.nercenergy.comthe-four-pillars-of-microsoft-...

  13. Energy Exchange Speaker Biographies

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Speaker Biographies U.S. Department of Energy Energy Exchange, August 2015 Chris Abbuehl (Constellation Energy) Christopher Abbuehl is responsible for leading the development of...

  14. More Than 200 DOE Safety and Health Trainers Gather for Exchange |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 200 DOE Safety and Health Trainers Gather for Exchange More Than 200 DOE Safety and Health Trainers Gather for Exchange April 29, 2015 - 12:00pm Addthis HAMMER Program Manager Thom Hogg discusses radiological monitoring during a National Training Center event and NIEHS Worker Trainer’s Exchange near the Hanford Site. HAMMER Program Manager Thom Hogg discusses radiological monitoring during a National Training Center event and NIEHS Worker Trainer's Exchange near the

  15. Direct fired heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C. (Lafayette, NY); Root, Richard A. (Spokane, WA)

    1986-01-01

    A gas-to-liquid heat exchanger system which transfers heat from a gas, generally the combustion gas of a direct-fired generator of an absorption machine, to a liquid, generally an absorbent solution. The heat exchanger system is in a counterflow fluid arrangement which creates a more efficient heat transfer.

  16. Alternative Fuels Data Center: Strategies for Fleet Managers to Conserve

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fuel Strategies for Fleet Managers to Conserve Fuel to someone by E-mail Share Alternative Fuels Data Center: Strategies for Fleet Managers to Conserve Fuel on Facebook Tweet about Alternative Fuels Data Center: Strategies for Fleet Managers to Conserve Fuel on Twitter Bookmark Alternative Fuels Data Center: Strategies for Fleet Managers to Conserve Fuel on Google Bookmark Alternative Fuels Data Center: Strategies for Fleet Managers to Conserve Fuel on Delicious Rank Alternative Fuels Data

  17. Save the Date for the 2016 Energy Exchange

    Broader source: Energy.gov [DOE]

    The 2016 Energy Exchange in Providence, Rhode Island, will provide training to energy managers and sustainability professionals who are working to improve facility performance, advance the use of renewable energy, and reduce greenhouse gas emissions at federal sites.

  18. Quality Assurance Exchange April 2009, Volume 5 Issue 1

    Broader source: Energy.gov [DOE]

    Quality Assurance ExchangeA pril 2009, Volume 5 Issue 1 U.S. Department of Energy Office of Quality Assurance Policy and Assistance IN THE SPOTLIGHT: GEORGE DETSIS, PROGRAM MANAGER Analytical Services Program Office of Corporate Safety Programs

  19. Wound tube heat exchanger

    DOE Patents [OSTI]

    Ecker, Amir L.

    1983-01-01

    What is disclosed is a wound tube heat exchanger in which a plurality of tubes having flattened areas are held contiguous adjacent flattened areas of tubes by a plurality of windings to give a double walled heat exchanger. The plurality of windings serve as a plurality of effective force vectors holding the conduits contiguous heat conducting walls of another conduit and result in highly efficient heat transfer. The resulting heat exchange bundle is economical and can be coiled into the desired shape. Also disclosed are specific embodiments such as the one in which the tubes are expanded against their windings after being coiled to insure highly efficient heat transfer.

  20. Heat and mass exchanger

    DOE Patents [OSTI]

    Lowenstein, Andrew (Princeton, NJ); Sibilia, Marc J. (Princeton, NJ); Miller, Jeffrey A. (Hopewell, NJ); Tonon, Thomas (Princeton, NJ)

    2007-09-18

    A mass and heat exchanger includes at least one first substrate with a surface for supporting a continuous flow of a liquid thereon that either absorbs, desorbs, evaporates or condenses one or more gaseous species from or to a surrounding gas; and at least one second substrate operatively associated with the first substrate. The second substrate includes a surface for supporting the continuous flow of the liquid thereon and is adapted to carry a heat exchange fluid therethrough, wherein heat transfer occurs between the liquid and the heat exchange fluid.

  1. Heat and mass exchanger

    DOE Patents [OSTI]

    Lowenstein, Andrew; Sibilia, Marc J.; Miller, Jeffrey A.; Tonon, Thomas

    2011-06-28

    A mass and heat exchanger includes at least one first substrate with a surface for supporting a continuous flow of a liquid thereon that either absorbs, desorbs, evaporates or condenses one or more gaseous species from or to a surrounding gas; and at least one second substrate operatively associated with the first substrate. The second substrate includes a surface for supporting the continuous flow of the liquid thereon and is adapted to carry a heat exchange fluid therethrough, wherein heat transfer occurs between the liquid and the heat exchange fluid.

  2. Anion exchange membrane

    DOE Patents [OSTI]

    Verkade, John G; Wadhwa, Kuldeep; Kong, Xueqian; Schmidt-Rohr, Klaus

    2013-05-07

    An anion exchange membrane and fuel cell incorporating the anion exchange membrane are detailed in which proazaphosphatrane and azaphosphatrane cations are covalently bonded to a sulfonated fluoropolymer support along with anionic counterions. A positive charge is dispersed in the aforementioned cations which are buried in the support to reduce the cation-anion interactions and increase the mobility of hydroxide ions, for example, across the membrane. The anion exchange membrane has the ability to operate at high temperatures and in highly alkaline environments with high conductivity and low resistance.

  3. U.S-, Japan Exchange Best Practices on Nuclear Emergency Response...

    National Nuclear Security Administration (NNSA)

    S-, Japan Exchange Best Practices on Nuclear Emergency Response | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile...

  4. Anion exchange polymer electrolytes

    DOE Patents [OSTI]

    Kim, Yu Seung; Kim, Dae Sik

    2015-06-02

    Anion exchange polymer electrolytes that include guanidinium functionalized polymers may be used as membranes and binders for electrocatalysts in preparation of anodes for electrochemical cells such as solid alkaline fuel cells.

  5. Active microchannel heat exchanger

    DOE Patents [OSTI]

    Tonkovich, Anna Lee Y. [Pasco, WA; Roberts, Gary L. [West Richland, WA; Call, Charles J. [Pasco, WA; Wegeng, Robert S. [Richland, WA; Wang, Yong [Richland, WA

    2001-01-01

    The present invention is an active microchannel heat exchanger with an active heat source and with microchannel architecture. The microchannel heat exchanger has (a) an exothermic reaction chamber; (b) an exhaust chamber; and (c) a heat exchanger chamber in thermal contact with the exhaust chamber, wherein (d) heat from the exothermic reaction chamber is convected by an exothermic reaction exhaust through the exhaust chamber and by conduction through a containment wall to the working fluid in the heat exchanger chamber thereby raising a temperature of the working fluid. The invention is particularly useful as a liquid fuel vaporizer and/or a steam generator for fuel cell power systems, and as a heat source for sustaining endothermic chemical reactions and initiating exothermic reactions.

  6. Energy Exchange Schedule

    Broader source: Energy.gov [DOE]

    The schedule for Energy Exchange is now available. Attendees will have the option of attending a variety of training sessions offered within 10 tracks during the times listed below. Session details...

  7. Microsoft Exchange Servers Archives - Nercenergy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Exchange Servers What Certificates Should My Microsoft Exchange Server Have? Much like any other network application, in order to secure the functionality and safety of Microsoft...

  8. Green Exchange | Open Energy Information

    Open Energy Info (EERE)

    Exchange Jump to: navigation, search Name: Green Exchange Place: New York, New York Zip: NY 10282 Product: String representation "The Green Excha ... es marketplace." is too long....

  9. Radial flow heat exchanger

    DOE Patents [OSTI]

    Valenzuela, Javier

    2001-01-01

    A radial flow heat exchanger (20) having a plurality of first passages (24) for transporting a first fluid (25) and a plurality of second passages (26) for transporting a second fluid (27). The first and second passages are arranged in stacked, alternating relationship, are separated from one another by relatively thin plates (30) and (32), and surround a central axis (22). The thickness of the first and second passages are selected so that the first and second fluids, respectively, are transported with laminar flow through the passages. To enhance thermal energy transfer between first and second passages, the latter are arranged so each first passage is in thermal communication with an associated second passage along substantially its entire length, and vice versa with respect to the second passages. The heat exchangers may be stacked to achieve a modular heat exchange assembly (300). Certain heat exchangers in the assembly may be designed slightly differently than other heat exchangers to address changes in fluid properties during transport through the heat exchanger, so as to enhance overall thermal effectiveness of the assembly.

  10. Office of Management

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2006-10-27

    Designates the Director, Office of Management as the DOE official responsible to perform the duties set forth in 22 CFR , sections 62.11 and 41.63 pertaining to the DOE Exchange Visitor Program,

  11. Heat exchanger restart evaluation

    SciTech Connect (OSTI)

    Morrison, J.M.; Hirst, C.W.; Lentz, T.F.

    1992-02-28

    On December 24, 1991, the K-Reactor was in the shutdown mode with full AC process water flow and full cooling water flow. Safety rod testing was being performed as part of the power ascension testing program. The results of cooling water samples indicated tritium concentrations higher than allowable. Further sampling and testing confirmed a Process Water System to Cooling Water System leak in heat exchanger 4A (HX 4A). The heat exchanger was isolated and the plant shutdown. Heat exchanger 4kA was removed from the plant and moved to C-Area prior to performing examinations and diagnostic testing. This included locating and identifying the leaking tube or tubes, eddy current examination of the leaking tube and a number of adjacent tubes, visually inspecting the leaking tube from both the inside as well as the area surrounding the failure mechanism. In addition ten other tubes that either exhibited eddy current indications or would represent a baseline condition were removed from heat exchanger 4A for metallurgical examination. Additional analysis and review of heat exchanger leakage history was performed to determine if there are any patterns which can be used for predictive purposes. Compensatory actions have been taken to improve the sensitivity and response time to any future events of this type. The results of these actions are summarized herein.

  12. Heat exchanger restart evaluation

    SciTech Connect (OSTI)

    Morrison, J.M.; Hirst, C.W.; Lentz, T.F.

    1992-03-18

    On December 24, 1991, the K-Reactor was in the shutdown mode with full AC process water flow and full cooling water flow. Safety rod testing was being performed as part of the power ascension testing program. The results of cooling water samples indicated tritium concentrations higher than allowable. Further sampling and testing confirmed a Process Water System to Cooling Water System leak in heat exchanger 4A (HX 4A). The heat exchanger was isolated and the plant shutdown. Heat exchanger 4A was removed from the plant and moved to C-Area prior to performing examinations and diagnostic testing. This included locating and identifying the leaking tube or tubes, eddy current examination of the leaking tube and a number of adjacent tubes, visually inspecting the leaking tube from both the inside as well as the area surrounding the identified tube. The leaking tube was removed and examined metallurgically to determine the failure mechanism. In addition ten other tubes that either exhibited eddy current indications or would represent a baseline condition were removed from heat exchanger 4A for metallurgical examination. Additional analysis and review of heat exchanger leakage history was performed to determine if there are any patterns which can be used for predictive purposes. Compensatory actions have been taken to improve the sensitivity and response time to any future events of this type. The results of these actions are summary herein.

  13. Heat exchanger restart evaluation

    SciTech Connect (OSTI)

    Morrison, J.M.; Hirst, C.W.; Lentz, T.F.

    1992-03-18

    On December 24, 1991, the K-Reactor was in the shutdown mode with full AC process water flow and full cooling water flow. Safety rod testing was being performed as part of the power ascension testing program. The results of cooling water samples indicated tritium concentrations higher than allowable. Further sampling and testing confirmed a Process Water System to Cooling Water System leak in heat exchanger 4A (HX 4A). The heat exchanger was isolated and the plant shutdown. Heat exchanger 4A was removed from the plant and moved to C-Area prior to performing examinations and diagnostic testing. This included locating and identifying the leaking tube or tubes, eddy current examination of the leaking tube and a number of adjacent tubes, visually inspecting the leaking tube from both the inside as well as the area surrounding the identified tube. The leaking tube was removed and examined metallurgically to determine the failure mechanism. In addition ten other tubes that either exhibited eddy current indications or would represent a baseline condition were removed from heat exchanger 4A for metallurgical examination. Additional analysis and review of heat exchanger leakage history was performed to determine if there are any patterns which can be used for predictive purposes. Compensatory actions have been taken to improve the sensitivity and response time to any future events of this type. The results of these actions are summarized.

  14. Modular heat exchanger

    DOE Patents [OSTI]

    Culver, Donald W.

    1978-01-01

    A heat exchanger for use in nuclear reactors includes a heat exchange tube bundle formed from similar modules each having a hexagonal shroud containing a large number of thermally conductive tubes which are connected with inlet and outlet headers at opposite ends of each module, the respective headers being adapted for interconnection with suitable inlet and outlet manifold means. In order to adapt the heat exchanger for operation in a high temperature and high pressure environment and to provide access to all tube ports at opposite ends of the tube bundle, a spherical tube sheet is arranged in sealed relation across the chamber with an elongated duct extending outwardly therefrom to provide manifold means for interconnection with the opposite end of the tube bundle.

  15. Scientific Exchange Program deadline | Photosynthetic Antenna...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Exchange Program deadline Scientific Exchange Program deadline Applications due February...

  16. PROJECT MANAGEMENT PLAN

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROJECT MANAGEMENT PLAN Energy and Water in the Western and Texas Interconnects October 15, 2010 WORK PERFORMED UNDER AGREEMENT RC-BM-2010 SUBMITTED BY Sandia National Laboratories PO Box 5800; MS1377 Albuquerque, New Mexico 87185-1377 PRINCIPAL INVESTIGATOR Vincent Tidwell Phone: (505)844-6025 Fax: (505)844-8558 E-mail: vctidwe@sandia.gov SUBMITTED TO U.S. Department of Energy National Energy Technology Laboratory Ray Lopez Raymond.Lopez@NETL.DOE.GOV Sandia National Laboratories is a

  17. FEMP First Thursday Update Provides Details about the 2016 Energy Exchange

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Training and Trade Show | Department of Energy FEMP First Thursday Update Provides Details about the 2016 Energy Exchange Training and Trade Show FEMP First Thursday Update Provides Details about the 2016 Energy Exchange Training and Trade Show April 6, 2016 - 3:38pm Addthis FEMP First Thursday Update Provides Details about the 2016 Energy Exchange Training and Trade Show The U.S. Department of Energy Federal Energy Management Program (FEMP) will host 2016 Energy Exchange Update, a First

  18. Technology Performance Exchange

    SciTech Connect (OSTI)

    2015-09-01

    To address the need for accessible, high-quality data, the Department of Energy has developed the Technology Performance Exchange (TPEx). TPEx enables technology suppliers, third-party testing laboratories, and other entities to share product performance data. These data are automatically transformed into a format that technology evaluators can easily use in their energy modeling assessments to inform procurement decisions.

  19. A corrosive resistant heat exchanger

    DOE Patents [OSTI]

    Richlen, S.L.

    1987-08-10

    A corrosive and erosive resistant heat exchanger which recovers heat from a contaminated heat stream. The heat exchanger utilizes a boundary layer of innocuous gas, which is continuously replenished, to protect the heat exchanger surface from the hot contaminated gas. The innocuous gas is pumped through ducts or perforations in the heat exchanger wall. Heat from the heat stream is transferred by radiation to the heat exchanger wall. Heat is removed from the outer heat exchanger wall by a heat recovery medium. 3 figs., 3 tabs.

  20. Phosphonic acid based exchange resins

    DOE Patents [OSTI]

    Horwitz, E. Philip; Alexandratos, Spiro D.; Gatrone, Ralph C.; Chiarizia, Ronato

    1995-01-01

    An ion exchange resin for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene diphosphonic acid with styrene, acrylonitrile and divinylbenzene.

  1. Phosphonic acid based exchange resins

    DOE Patents [OSTI]

    Horwitz, E.P.; Alexandratos, S.D.; Gatrone, R.C.; Chiarizia, R.

    1995-09-12

    An ion exchange resin is described for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene diphosphonic acid with styrene, acrylonitrile and divinylbenzene. 10 figs.

  2. Heat-Exchanger Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management ...

  3. Thermoelectric heat exchange element

    DOE Patents [OSTI]

    Callas, James J. (Peoria, IL); Taher, Mahmoud A. (Peoria, IL)

    2007-08-14

    A thermoelectric heat exchange module includes a first substrate including a heat receptive side and a heat donative side and a series of undulatory pleats. The module may also include a thermoelectric material layer having a ZT value of 1.0 or more disposed on at least one of the heat receptive side and the heat donative side, and an electrical contact may be in electrical communication with the thermoelectric material layer.

  4. Heat exchanger tube mounts

    DOE Patents [OSTI]

    Wolowodiuk, W.; Anelli, J.; Dawson, B.E.

    1974-01-01

    A heat exchanger in which tubes are secured to a tube sheet by internal bore welding is described. The tubes may be moved into place in preparation for welding with comparatively little trouble. A number of segmented tube support plates are provided which allow a considerable portion of each of the tubes to be moved laterally after the end thereof has been positioned in preparation for internal bore welding to the tube sheet. (auth)

  5. Heat exchange apparatus

    DOE Patents [OSTI]

    Degtiarenko, Pavel V.

    2003-08-12

    A heat exchange apparatus comprising a coolant conduit or heat sink having attached to its surface a first radial array of spaced-apart parallel plate fins or needles and a second radial array of spaced-apart parallel plate fins or needles thermally coupled to a body to be cooled and meshed with, but not contacting the first radial array of spaced-apart parallel plate fins or needles.

  6. Defining a new information exchange

    Energy Science and Technology Software Center (OSTI)

    2013-08-01

    This wiki page provides the public with all specifications needed to create a new information exchange (content model package).

  7. 1993 Department of Energy Records Management Conference

    SciTech Connect (OSTI)

    1993-12-31

    This document consists of viewgraphs from the presentations at the conference. Topics included are: DOE records management overview, NIRMA and ARMA resources, NARA records management training, potential quality assurance records, filing systems, organizing and indexing technical records, DOE-HQ initiatives, IRM reviews, status of epidemiologic inventory, disposition of records and personal papers, inactive records storage, establishing administrative records, managing records at Hanford, electronic mail -- legal and records issues, NARA-GAO reports status, consultive selling, automated indexing, decentralized approach to scheduling at a DOE office, developing specific records management programs, storage and retrieval at Savannah River Plant, an optical disk case study, and special interest group reports.

  8. MRI, Battelle and Bechtel to Manage National Renewable Energy Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Battelle and Bechtel to Manage National Renewable Energy Lab For more information contact: e:mail: Public Affairs Golden, Colo., Nov. 19, 1998 — Officials from the U.S. Department of Energy (DOE) today signed a contract for managing and operating the National Renewable Energy Laboratory (NREL) with Midwest Research Institute (MRI), Battelle Memorial Institute and Bechtel Corp. "We believe this new management team combines the expertise needed for NREL to help lead the way to a more

  9. DOE Technology Performance Exchange

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Studer, Daniel.Studer@nrel.gov National Renewable Energy Laboratory NREL - DOE Technology Performance Exchange 2015 Building Technologies Office Peer Review 2 Project Summary Timeline: Start date: January 27, 2012 Planned end date: November 20, 2015 Key Milestones 1. Calibrated Energy Model; 5/22/15 2. BPA Sector Simulation; 10/16/15 Budget: BTO $ to date: $769,000 FEMP $ to date: $565,000 Other $ to date: $323,759 Total future DOE $: TBD Key Partners: Project Goal: Provides a pipeline for

  10. Microsoft Exchange Archives - Nercenergy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this may seem like a "no-brainer" for most IT managers, you'd be surprised how many enterprises encounter errors simply because they did not allow ample mailbox quotas. It's...

  11. Better Buildings Neighborhood Program Workforce Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Neighborhood Program Workforce Peer Exchange Call: Contractor Pricing Better Buildings Neighborhood Program Workforce Peer Exchange Call: Contractor Pricing Better Buildings ...

  12. Heat exchanger-accumulator

    DOE Patents [OSTI]

    Ecker, Amir L.

    1980-01-01

    What is disclosed is a heat exchanger-accumulator for vaporizing a refrigerant or the like, characterized by an upright pressure vessel having a top, bottom and side walls; an inlet conduit eccentrically and sealingly penetrating through the top; a tubular overflow chamber disposed within the vessel and sealingly connected with the bottom so as to define an annular outer volumetric chamber for receiving refrigerant; a heat transfer coil disposed in the outer volumetric chamber for vaporizing the liquid refrigerant that accumulates there; the heat transfer coil defining a passageway for circulating an externally supplied heat exchange fluid; transferring heat efficiently from the fluid; and freely allowing vaporized refrigerant to escape upwardly from the liquid refrigerant; and a refrigerant discharge conduit penetrating sealingly through the top and traversing substantially the length of the pressurized vessel downwardly and upwardly such that its inlet is near the top of the pressurized vessel so as to provide a means for transporting refrigerant vapor from the vessel. The refrigerant discharge conduit has metering orifices, or passageways, penetrating laterally through its walls near the bottom, communicating respectively interiorly and exteriorly of the overflow chamber for controllably carrying small amounts of liquid refrigerant and oil to the effluent stream of refrigerant gas.

  13. LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN

    Office of Scientific and Technical Information (OSTI)

    CONSTRAINTS, AND LAND EXCHANGES: CROSS-JURISDICTIONAL MANAGEMENT AND IMPACTS ON UNCONVENTIONAL FUEL DEVELOPMENT IN UTAH'S UINTA BASIN (Technical Report) | SciTech Connect LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN CONSTRAINTS, AND LAND EXCHANGES: CROSS-JURISDICTIONAL MANAGEMENT AND IMPACTS ON UNCONVENTIONAL FUEL DEVELOPMENT IN UTAH'S UINTA BASIN Citation Details In-Document Search Title: LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN CONSTRAINTS, AND

  14. LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN

    Office of Scientific and Technical Information (OSTI)

    CONSTRAINTS, AND LAND EXCHANGES: CROSS-JURISDICTIONAL MANAGEMENT AND IMPACTS ON UNCONVENTIONAL FUEL DEVELOPMENT IN UTAH'S UINTA BASIN (Technical Report) | SciTech Connect LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN CONSTRAINTS, AND LAND EXCHANGES: CROSS-JURISDICTIONAL MANAGEMENT AND IMPACTS ON UNCONVENTIONAL FUEL DEVELOPMENT IN UTAH'S UINTA BASIN Citation Details In-Document Search Title: LANDS WITH WILDERNESS CHARACTERISTICS, RESOURCE MANAGEMENT PLAN CONSTRAINTS, AND

  15. Heat exchanger bypass test report

    SciTech Connect (OSTI)

    De Vries, M.L.

    1995-01-26

    This test report documents the results that were obtained while conducting the test procedure which bypassed the heat exchangers in the HC-21C sludge stabilization process. The test was performed on November 15, 1994 using WHC-SD-CP-TC-031, ``Heat Exchanger Bypass Test Procedure.`` The primary objective of the test procedure was to determine if the heat exchangers were contributing to condensation of moisture in the off-gas line. This condensation was observed in the rotameters. Also, a secondary objective was to determine if temperatures at the rotameters would be too high and damage them or make them inaccurate without the heat exchangers in place.

  16. Energy Exchange 2015: Phoenix, Arizona

    Broader source: Energy.gov [DOE]

    Presentations from Energy Exchange, a two-and-a-half day training scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  17. Microsoft Word - 2015 Tech Exchange Biosketches R1

    Office of Environmental Management (EM)

    Interagency Performance & Risk Assessment Community of Practice 2015 Annual Technical Exchange Meeting Presenters Biographical Sketches Jane Hedges Jane A. Hedges is the Program Manager for the Washington State Department of Ecology's (Ecology) Nuclear Waste Program. In her role with Ecology, Ms Hedges is responsible for managing a program of 70 staff that oversees the cleanup of the Hanford Nuclear Facility in Eastern Washington, regulates other facilities which store, handle or dispose of

  18. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  19. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  20. Technology Performance Exchange (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-10-01

    This fact sheet, 'The Technology Performance Exchange' will be presented at the ET Summit, held at the Pasadena Convention Center on October 15-17, 2012. The Technology Performance Exchange will be a centralized, Web-based portal for finding and sharing energy performance data for commercial building technologies.

  1. High Temperature Heat Exchanger Project

    SciTech Connect (OSTI)

    Anthony E. Hechanova, Ph.D.

    2008-09-30

    The UNLV Research Foundation assembled a research consortium for high temperature heat exchanger design and materials compatibility and performance comprised of university and private industry partners under the auspices of the US DOE-NE Nuclear Hydrogen Initiative in October 2003. The objectives of the consortium were to conduct investigations of candidate materials for high temperature heat exchanger componets in hydrogen production processes and design and perform prototypical testing of heat exchangers. The initial research of the consortium focused on the intermediate heat exchanger (located between the nuclear reactor and hydrogen production plan) and the components for the hydrogen iodine decomposition process and sulfuric acid decomposition process. These heat exchanger components were deemed the most challenging from a materials performance and compatibility perspective

  2. Energy-Exchange Project

    SciTech Connect (OSTI)

    Not Available

    1982-04-01

    The purpose of the study was to determine what energy savings can be achieved by coordinating the resources and requirements of two facilities, the 26th Ward Water Pollution Control Plant (WPCP) and a housing development named Starrett City with its own total energy system. It was determined that three energy exchange options were economically and technically feasible. These include: the transfer of digester gas produced at the 26th Ward to the boilers at the Starrett City's total energy plant (TEP); the transfer of hot water heated at the TEP to the 26th Ward for space and process heating; and the transfer of coal effluent waste water from the 26th Ward to the condenser cooling systems at the TEP. Technical information is presented to support the findings. The report addresses those tasks of the statement of work dedicated to data acquisition, analysis, and energy conservation strategies internal to the Starrett City TEP and the community it supplies as well as to the 26th Ward WPCP. (MCW)

  3. Modular heat exchanger

    DOE Patents [OSTI]

    Giardina, Angelo R. [Marple Township, Delaware County, PA

    1981-03-03

    A shell and tube heat exchanger having a plurality of individually removable tube bundle modules. A lattice of structural steel forming rectangular openings therein is placed at each end of a cylindrical shell. Longitudinal structural members are placed in the shell between corners of the rectangular openings situated on opposite ends of the shell. Intermediate support members interconnect the longitudinal supports so as to increase the longitudinal supports rigidity. Rectangular parallelpiped tube bundle moldules occupy the space defined by the longitudinal supports and end supports and each include a rectangular tube sheet situated on each end of a plurality of tubes extending therethrough, a plurality of rectangular tube supports located between the tube sheets, and a tube bundle module stiffening structure disposed about the bundle's periphery and being attached to the tube sheets and tube supports. The corners of each tube bundle module have longitudinal framework members which are mateable with and supported by the longitudinal support members. Intermediate support members constitute several lattice, each of which is situate d in a plane between the end support members. The intermediate support members constituting the several lattice extend horizontally and vertically between longitudinal supports of adjacent tube module voids. An alternative embodiment for intermediate support members constitute a series of structural plates situated at the corners of the module voids and having recesses therein for receiving the respective longitudinal support members adjacent thereto, protrusions separating the recesses, and a plurality of struts situated between protrusions of adjacent structural plates.

  4. Modular heat exchanger

    DOE Patents [OSTI]

    Giardina, A.R.

    1981-03-03

    A shell and tube heat exchanger is described having a plurality of individually removable tube bundle modules. A lattice of structural steel forming rectangular openings therein is placed at each end of a cylindrical shell. Longitudinal structural members are placed in the shell between corners of the rectangular openings situated on opposite ends of the shell. Intermediate support members interconnect the longitudinal supports so as to increase the longitudinal supports rigidity. Rectangular parallelepiped tube bundle modules occupy the space defined by the longitudinal supports and end supports and each include a rectangular tube sheet situated on each end of a plurality of tubes extending there through, a plurality of rectangular tube supports located between the tube sheets, and a tube bundle module stiffening structure disposed about the bundle's periphery and being attached to the tube sheets and tube supports. The corners of each tube bundle module have longitudinal framework members which are mateable with and supported by the longitudinal support members. Intermediate support members constitute several lattices, each of which is situated in a plane between the end support members. The intermediate support members constituting the several lattices extend horizontally and vertically between longitudinal supports of adjacent tube module voids. An alternative embodiment for intermediate support members constitute a series of structural plates situated at the corners of the module voids and having recesses therein for receiving the respective longitudinal support members adjacent thereto, protrusions separating the recesses, and a plurality of struts situated between protrusions of adjacent structural plates. 12 figs.

  5. Methods of forming thermal management systems and thermal management methods

    DOE Patents [OSTI]

    Gering, Kevin L.; Haefner, Daryl R.

    2012-06-05

    A thermal management system for a vehicle includes a heat exchanger having a thermal energy storage material provided therein, a first coolant loop thermally coupled to an electrochemical storage device located within the first coolant loop and to the heat exchanger, and a second coolant loop thermally coupled to the heat exchanger. The first and second coolant loops are configured to carry distinct thermal energy transfer media. The thermal management system also includes an interface configured to facilitate transfer of heat generated by an internal combustion engine to the heat exchanger via the second coolant loop in order to selectively deliver the heat to the electrochemical storage device. Thermal management methods are also provided.

  6. Heat exchange assembly

    DOE Patents [OSTI]

    Lowenstein, Andrew; Sibilia, Marc; Miller, Jeffrey; Tonon, Thomas S.

    2004-06-08

    A heat exchange assembly comprises a plurality of plates disposed in a spaced-apart arrangement, each of the plurality of plates includes a plurality of passages extending internally from a first end to a second end for directing flow of a heat transfer fluid in a first plane, a plurality of first end-piece members equaling the number of plates and a plurality of second end-piece members also equaling the number of plates, each of the first and second end-piece members including a recessed region adapted to fluidly connect and couple with the first and second ends of the plate, respectively, and further adapted to be affixed to respective adjacent first and second end-piece members in a stacked formation, and each of the first and second end-piece members further including at least one cavity for enabling entry of the heat transfer fluid into the plate, exit of the heat transfer fluid from the plate, or 180.degree. turning of the fluid within the plate to create a serpentine-like fluid flow path between points of entry and exit of the fluid, and at least two fluid conduits extending through the stacked plurality of first and second end-piece members for providing first fluid connections between the parallel fluid entry points of adjacent plates and a fluid supply inlet, and second fluid connections between the parallel fluid exit points of adjacent plates and a fluid discharge outlet so that the heat transfer fluid travels in parallel paths through each respective plate.

  7. Hear Exchange Assembly

    DOE Patents [OSTI]

    Lowenstein, Andrew; Sibilia, Marc; Miller, Jeffrey; Tonon, Thomas S.

    2003-05-27

    A heat exchange assembly comprises a plurality of plates disposed in a spaced-apart arrangement, each of the plurality of plates includes a plurality of passages extending internally from a first end to a second end for directing flow of a heat transfer fluid in a first plane, a plurality of first end-piece members equaling the number of plates and a plurality of second end-piece members also equaling the number of plates, each of the first and second end-piece members including a recessed region adapted to fluidly connect and couple with the first and second ends of the plate, respectively, and further adapted to be affixed to respective adjacent first and second end-piece members in a stacked formation, and each of the first and second end-piece members further including at least one cavity for enabling entry of the heat transfer fluid into the plate, exit of the heat transfer fluid from the plate, or 180.degree. turning of the fluid within the plate to create a serpentine-like fluid flow path between points of entry and exit of the fluid, and at least two fluid conduits extending through the stacked plurality of first and second end-piece members for providing first fluid connections between the parallel fluid entry points of adjacent plates and a fluid supply inlet, and second fluid connections between the parallel fluid exit points of adjacent plates and a fluid discharge outlet so that the heat transfer fluid travels in parallel paths through each respective plate.

  8. Charge exchange molecular ion source

    DOE Patents [OSTI]

    Vella, Michael C.

    2003-06-03

    Ions, particularly molecular ions with multiple dopant nucleons per ion, are produced by charge exchange. An ion source contains a minimum of two regions separated by a physical barrier and utilizes charge exchange to enhance production of a desired ion species. The essential elements are a plasma chamber for production of ions of a first species, a physical separator, and a charge transfer chamber where ions of the first species from the plasma chamber undergo charge exchange or transfer with the reactant atom or molecules to produce ions of a second species. Molecular ions may be produced which are useful for ion implantation.

  9. Heat exchanger using graphite foam

    DOE Patents [OSTI]

    Campagna, Michael Joseph; Callas, James John

    2012-09-25

    A heat exchanger is disclosed. The heat exchanger may have an inlet configured to receive a first fluid and an outlet configured to discharge the first fluid. The heat exchanger may further have at least one passageway configured to conduct the first fluid from the inlet to the outlet. The at least one passageway may be composed of a graphite foam and a layer of graphite material on the exterior of the graphite foam. The layer of graphite material may form at least a partial barrier between the first fluid and a second fluid external to the at least one passageway.

  10. Heat exchanger with ceramic elements

    DOE Patents [OSTI]

    Corey, John A.

    1986-01-01

    An annular heat exchanger assembly includes a plurality of low thermal growth ceramic heat exchange members with inlet and exit flow ports on distinct faces. A mounting member locates each ceramic member in a near-annular array and seals the flow ports on the distinct faces into the separate flow paths of the heat exchanger. The mounting member adjusts for the temperature gradient in the assembly and the different coefficients of thermal expansion of the members of the assembly during all operating temperatures.

  11. Thermal management systems and methods

    DOE Patents [OSTI]

    Gering, Kevin L.; Haefner, Daryl R.

    2006-12-12

    A thermal management system for a vehicle includes a heat exchanger having a thermal energy storage material provided therein, a first coolant loop thermally coupled to an electrochemical storage device located within the first coolant loop and to the heat exchanger, and a second coolant loop thermally coupled to the heat exchanger. The first and second coolant loops are configured to carry distinct thermal energy transfer media. The thermal management system also includes an interface configured to facilitate transfer of heat generated by an internal combustion engine to the heat exchanger via the second coolant loop in order to selectively deliver the heat to the electrochemical storage device. Thermal management methods are also provided.

  12. Nonlocal exchange correlation in screened-exchange densityfunctional methods

    SciTech Connect (OSTI)

    Lee, Byounghak; Wang, Lin-Wang; Spataru, Catalin D.; Louie,Steven G.

    2007-04-22

    We present a systematic study on the exchange-correlationeffects in screened-exchange local density functional method. Toinvestigate the effects of the screened-exchange potential in the bandgap correction, we have compared the exchange-correlation potential termin the sX-LDA formalism with the self-energy term in the GWapproximation. It is found that the band gap correction of the sX-LDAmethod primarily comes from the downshift of valence band states,resulting from the enhancement of bonding and the increase of ionizationenergy. The band gap correction in the GW method, on the contrary, comesin large part from the increase of theconduction band energies. We alsostudied the effects of the screened-exchange potential in the totalenergy by investigating the exchange-correlation hole in comparison withquantum Monte Carlo calculations. When the Thomas-Fermi screening isused, the sX-LDA method overestimates (underestimates) theexchange-correlation hole in short (long) range. From theexchange-correlation energy analysis we found that the LDA method yieldsbetter absolute total energy than sX-LDA method.

  13. Anion exchange polymer electrolytes

    DOE Patents [OSTI]

    Kim, Yu Seung; Kim, Dae Sik; Lee, Kwan-Soo

    2013-07-23

    Solid anion exchange polymer electrolytes and compositions comprising chemical compounds comprising a polymeric core, a spacer A, and a guanidine base, wherein said chemical compound is uniformly dispersed in a suitable solvent and has the structure: ##STR00001## wherein: i) A is a spacer having the structure O, S, SO.sub.2, --NH--, --N(CH.sub.2).sub.n, wherein n=1-10, --(CH.sub.2).sub.n--CH.sub.3--, wherein n=1-10, SO.sub.2-Ph, CO-Ph, ##STR00002## wherein R.sub.5, R.sub.6, R.sub.7 and R.sub.8 each are independently --H, --NH.sub.2, F, Cl, Br, CN, or a C.sub.1-C.sub.6 alkyl group, or any combination of thereof; ii) R.sub.9, R.sub.10, R.sub.11, R.sub.12, or R.sub.13 each independently are --H, --CH.sub.3, --NH.sub.2, --NO, --CH.sub.nCH.sub.3 where n=1-6, HC.dbd.O--, NH.sub.2C.dbd.O--, --CH.sub.nCOOH where n=1-6, --(CH.sub.2).sub.n--C(NH.sub.2)--COOH where n=1-6, --CH--(COOH)--CH.sub.2--COOH, --CH.sub.2--CH(O--CH.sub.2CH.sub.3).sub.2, --(C.dbd.S)--NH.sub.2, --(C.dbd.NH)--N--(CH.sub.2).sub.nCH.sub.3, where n=0-6, --NH--(C.dbd.S)--SH, --CH.sub.2--(C.dbd.O)--O--C(CH.sub.3).sub.3, --O--(CH.sub.2).sub.n--CH--(NH.sub.2)--COOH, where n=1-6, --(CH.sub.2).sub.n--CH.dbd.CH wherein n=1-6, --(CH.sub.2).sub.n--CH--CN wherein n=1-6, an aromatic group such as a phenyl, benzyl, phenoxy, methylbenzyl, nitrogen-substituted benzyl or phenyl groups, a halide, or halide-substituted methyl groups; and iii) wherein the composition is suitable for use in a membrane electrode assembly.

  14. Pu Anion Exchange Process Intensification

    SciTech Connect (OSTI)

    Taylor-Pashow, K.

    2015-10-08

    This project seeks to improve the efficiency of the plutonium anion-exchange process for purifying Pu through the development of alternate ion-exchange media. The objective of the project in FY15 was to develop and test a porous foam monolith material that could serve as a replacement for the current anion-exchange resin, Reillex® HPQ, used at the Savannah River Site (SRS) for purifying Pu. The new material provides advantages in efficiency over the current resin by the elimination of diffusive mass transport through large granular resin beads. By replacing the large resin beads with a porous foam there is much more efficient contact between the Pu solution and the anion-exchange sites present on the material. Several samples of a polystyrene based foam grafted with poly(4-vinylpyridine) were prepared and the Pu sorption was tested in batch contact tests.

  15. Energy Exchange 2015 Attendee Guide

    Broader source: Energy.gov [DOE]

    Attendee guide offers an overview of the Energy Exchange 2015, a two-and-a-half day training event that took place from August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  16. Energy Exchange 2015 Speaker Biographies

    Broader source: Energy.gov [DOE]

    Document offers an overview of each person speaking at the Energy Exchange, a two-and-a-half day training scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  17. Heat pipe array heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C.

    1987-08-25

    A heat pipe arrangement for exchanging heat between two different temperature fluids. The heat pipe arrangement is in a ounterflow relationship to increase the efficiency of the coupling of the heat from a heat source to a heat sink.

  18. Environmental Banc Exchange | Open Energy Information

    Open Energy Info (EERE)

    Banc Exchange Jump to: navigation, search Name: Environmental Banc & Exchange Place: Owings Mills, Maryland Zip: 21117 4860 Product: Invests in environmentally friendly businesses....

  19. Energy Exchange Speaker Biographies | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Speaker Biographies Energy Exchange Speaker Biographies Document offers an overview of each person speaking at the Energy Exchange, a two-and-a-half day training scheduled for ...

  20. Tianjin Climate Exchange TCX | Open Energy Information

    Open Energy Info (EERE)

    (TCX) Place: Tianjin Municipality, China Product: Exchange platform for emission and energy conservation trading products. References: Tianjin Climate Exchange (TCX)1 This...

  1. printed-circuit heat exchanger PCHE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    printed-circuit heat exchanger PCHE - Sandia Energy Energy Search Icon Sandia Home ... SunShot Grand Challenge: Regional Test Centers printed-circuit heat exchanger PCHE Home...

  2. Building-Integrated Heat & Moisture Exchange

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building-Integrated Heat & Moisture Exchange 2014 Building Technologies Office Peer Review ... scales the energy benefits of large-scale, wall- integrated heat & moisture exchangers. ...

  3. Sabdia's Radial Flow Air Bearing Heat Exchanger

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sandia's Radial Flow ir Bearing Heat Exchanger 2014 Building Technologies Office Peer Review Sandia's TRL 5 Air Bearing Heat exchanger technology (a. k. a. The Sandia Cooler) ...

  4. Vitrification of ion exchange resins

    DOE Patents [OSTI]

    Cicero-Herman, Connie A.; Workman, Rhonda Jackson

    2001-01-01

    The present invention relates to vitrification of ion exchange resins that have become loaded with hazardous or radioactive wastes, in a way that produces a homogenous and durable waste form and reduces the disposal volume of the resin. The methods of the present invention involve directly adding borosilicate glass formers and an oxidizer to the ion exchange resin and heating the mixture at sufficient temperature to produce homogeneous glass.

  5. Better Buildings Residential Network Data & Evaluation Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Analysis 9 Custom database tools * Forecast vs. actual-YTD and weekly * Direct mail ... * Workforce Data * Neighborhood and geographic data * Conversion rates 1 0 Forecast vs. ...

  6. Lessons Learned: Peer Exchange Calls-- No. 5

    Broader source: Energy.gov [DOE]

    Better Buildings Residential Network Peer Exchange Call Series: Guide for Benchmarking Residential Program Progress with Examples.

  7. Electrically Switched Cesium Ion Exchange

    SciTech Connect (OSTI)

    JPH Sukamto; ML Lilga; RK Orth

    1998-10-23

    This report discusses the results of work to develop Electrically Switched Ion Exchange (ESIX) for separations of ions from waste streams relevant to DOE site clean-up. ESIX combines ion exchange and electrochemistry to provide a selective, reversible method for radionuclide separation that lowers costs and minimizes secondary waste generation typically associated with conventional ion exchange. In the ESIX process, an electroactive ion exchange film is deposited onto. a high surface area electrode, and ion uptake and elution are controlled directly by modulating the potential of the film. As a result, the production of secondary waste is minimized, since the large volumes of solution associated with elution, wash, and regeneration cycles typical of standard ion exchange are not needed for the ESIX process. The document is presented in two parts: Part I, the Summary Report, discusses the objectives of the project, describes the ESIX concept and the approach taken, and summarizes the major results; Part II, the Technology Description, provides a technical description of the experimental procedures and in-depth discussions on modeling, case studies, and cost comparisons between ESIX and currently used technologies.

  8. Grafted methylenediphosphonate ion exchange resins

    DOE Patents [OSTI]

    Trochimcznk, Andrzej W.; Gatrone, Ralph C.; Alexandratos, Spiro; Horwitz, E. Philip

    1998-01-27

    An ion exchange resin is disclosed that is comprised of an insoluble copolymer onto which are grafted pendent groups that provide 1.0 to about 10 mmol/g dry weight phosphorous. The pendent groups have the formula ##STR1## wherein R is hydrogen, a cation or mixtures thereof; and R.sup.1 is hydrogen or an C.sub.1 -C.sub.2 alkyl group. The resin also contains zero to about 5 mmol/g dry weight of pendent aromatic sulfonate groups. Processes for making and using an ion exchange-resin are also disclosed.

  9. Grafted methylenediphosphonate ion exchange resins

    DOE Patents [OSTI]

    Trochimcznk, Andrzej W.; Gatrone, Ralph C.; Alexandratos, Spiro; Horwitz, E. Philip

    1997-01-01

    An ion exchange resin is disclosed that is comprised of an insoluble copolymer onto which are grafted pendent groups that provide 1.0 to about 10 mmol/g dry weight phosphorous. The pendent groups have the formula ##STR1## wherein R is hydrogen, a cation or mixtures thereof; and R.sup.1 is hydrogen or an C.sub.1 -C.sub.2 alkyl group. The resin also contains zero to about 5 mmol/g dry weight of pendent aromatic sulfonate groups. Processes for making and using an ion exchange resin are also disclosed.

  10. Grafted methylenediphosphonate ion exchange resins

    DOE Patents [OSTI]

    Trochimcznk, A.W.; Gatrone, R.C.; Alexandratos, S.; Horwitz, E.P.

    1997-04-08

    An ion exchange resin is disclosed that is comprised of an insoluble copolymer onto which are grafted pendent groups that provide 1.0 to about 10 mmol/g dry weight phosphorus. The pendent groups have the formula as shown in the patent wherein R is hydrogen, a cation or mixtures thereof; and R{sup 1} is hydrogen or an C{sub 1}-C{sub 2} alkyl group. The resin also contains zero to about 5 mmol/g dry weight of pendent aromatic sulfonate groups. Processes for making and using an ion exchange resin are also disclosed.

  11. 2011 PERFORMANCE ASSESSMENT COMMUNITY OF PRACTICE TECHNICAL EXCHANGE - SUMMARY

    SciTech Connect (OSTI)

    Seitz, R.

    2011-12-30

    The Performance Assessment Community of Practice (PA CoP) was developed in 2008 to improve consistency and quality in the preparation of performance assessments (PAs) and risk assessments across the Department of Energy (DOE) Complex. The term, PA, is used to represent all of these modeling applications in this report. The PA CoP goals are to foster the exchange of information among PA practitioners and to share lessons learned from PAs conducted for DOE, commercial disposal facilities, and international entities. Technical exchanges and workshops are a cornerstone of PA CoP activities. Previous technical exchanges have addressed Engineered Barriers (2009 - http://www.cresp.org/education/workshops/pacop/), the Advanced Simulation Capability for Environmental Management and the Cementitious Barriers Partnership (2010 - http://srnl.doe.gov/copexchange/links.htm). Each technical exchange also includes summary presentations regarding activities at DOE, the Nuclear Regulatory Commission (NRC) and other organizations (e.g., International Atomic Energy Agency (IAEA)) as well as a number of presentations from selected sites to provide insight and perspective from on-going modeling activities. Through the deployment of PA Assistance Teams, the PA CoP has also been engaged in the development of new PAs across the DOE Complex. As a way of improving consistency in the preparation of new PAs, the teams provide technical advice and share experiences, noteworthy practices, and lessons learned from previous Low-Level Waste Disposal Facility Federal Review Group (LFRG) reviews. Teams have provided support for PAs at Hanford, Idaho, Paducah and Portsmouth. The third annual PA CoP Technical Exchange was held on May 25-26, 2011 in Atlanta, GA. The PA CoP Steering Committee Meeting held its first meeting on May 24 prior to the Technical Exchange. Decision making using models and software quality assurance were the topical emphasis for the exchange. A new feature at the 2011 technical exchange was the use of panel discussions to solicit feedback from regulators and practitioners. This report summarizes discussions and recommendations from the steering committee meeting and presentations and feedback obtained at the technical exchange. Appendix I includes the steering committee meeting agenda and Appendix II includes the agenda for the technical exchange and a screenshot of the presentations and video files that are available online.

  12. Refrigerant charge management in a heat pump water heater

    DOE Patents [OSTI]

    Chen, Jie; Hampton, Justin W.

    2014-06-24

    Heat pumps that heat or cool a space and that also heat water, refrigerant management systems for such heat pumps, methods of managing refrigerant charge, and methods for heating and cooling a space and heating water. Various embodiments deliver refrigerant gas to a heat exchanger that is not needed for transferring heat, drive liquid refrigerant out of that heat exchanger, isolate that heat exchanger against additional refrigerant flowing into it, and operate the heat pump while the heat exchanger is isolated. The heat exchanger can be isolated by closing an electronic expansion valve, actuating a refrigerant management valve, or both. Refrigerant charge can be controlled or adjusted by controlling how much liquid refrigerant is driven from the heat exchanger, by letting refrigerant back into the heat exchanger, or both. Heat pumps can be operated in different modes of operation, and segments of refrigerant conduit can be interconnected with various components.

  13. Building International Emergency Management Systems | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Building International Emergency Management Systems NNSA helps nations develop the core elements of an emergency response program. Based on preliminary discussions with counterparts, NNSA develops emergency management programs with partner nations to exchange views and enhance development of effective emergency management systems. Generally, NNSA will assist foreign governments and international organizations with integration of emergency-program core elements,

  14. Primer on nuclear exchange models

    SciTech Connect (OSTI)

    Hafemeister, David

    2014-05-09

    Basic physics is applied to nuclear force exchange models between two nations. Ultimately, this scenario approach can be used to try and answer the age old question of 'how much is enough?' This work is based on Chapter 2 of Physics of Societal Issues: Calculations on National Security, Environment and Energy (Springer, 2007 and 2014)

  15. Safety Walkthrough Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Walkthrough Management

  16. Disposal of bead ion exchange resin wastes

    SciTech Connect (OSTI)

    Gay, R.L.; Granthan, L.F.

    1985-12-17

    Bead ion exchange resin wastes are disposed of by a process which involves spray-drying a bead ion exchange resin waste in order to remove substantially all of the water present in such waste, including the water on the surface of the ion exchange resin beads and the water inside the ion exchange resin beads. The resulting dried ion exchange resin beads can then be solidified in a suitable solid matrix-forming material, such as a polymer, which solidifies to contain the dried ion exchange resin beads in a solid monolith suitable for disposal by burial or other conventional means.

  17. Phosphonic acid based ion exchange resins

    DOE Patents [OSTI]

    Horwitz, E.P.; Alexandratos, S.D.; Gatrone, R.C.; Chiarizia, R.

    1994-01-25

    An ion exchange resin is described for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene diphosphonic acid with styrene, acrylonitrile and divinylbenzene. 9 figures.

  18. Phosphonic acid based ion exchange resins

    DOE Patents [OSTI]

    Horwitz, E. Philip; Alexandratos, Spiro D.; Gatrone, Ralph C.; Chiarizia, Ronato

    1996-01-01

    An ion exchange resin for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene diphosphonic acid with styrene, acrylonitrile and divinylbenzene.

  19. Phosphonic acid based ion exchange resins

    DOE Patents [OSTI]

    Horwitz, E. Philip; Alexandratos, Spiro D.; Gatrone, Ralph C.; Chiarizia, Ronato

    1994-01-01

    An ion exchange resin for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene disphosphonic acid with styrene, acrylonitrile and divinylbenzene.

  20. Phosphonic acid based ion exchange resins

    DOE Patents [OSTI]

    Horwitz, E.P.; Alexandratos, S.D.; Gatrone, R.C.; Chiarizia, R.

    1996-07-23

    An ion exchange resin is described for extracting metal ions from a liquid waste stream. An ion exchange resin is prepared by copolymerizing a vinylidene diphosphonic acid with styrene, acrylonitrile and divinylbenzene. 10 figs.

  1. Chicago Climate Exchange CCX | Open Energy Information

    Open Energy Info (EERE)

    Illinois Zip: 60604 Product: Chicago Climate Exchange (CCX) is aiming at reduction of CO2 emission. References: Chicago Climate Exchange (CCX)1 This article is a stub. You can...

  2. Helically coiled tube heat exchanger

    SciTech Connect (OSTI)

    Harris, A.M.

    1981-08-18

    In a heat exchanger such as a steam generator for a nuclear reactor, two or more bundles of helically coiled tubes are arranged in series with the tubes in each bundle integrally continuing through the tube bundles arranged in series therewith. Pitch values for the tubing in any pair of tube bundles, taken transverse to the path of the reactor coolant flow about the tubes, are selected as a ratio of two unequal integers to permit efficient operation of each tube bundle while maintaining the various tube bundles of the heat exchanger within a compact envelope. Preferably, the helix angle and tube pitch parallel to the path of coolant flow are constant for all tubes in a single bundle so that the tubes are of approximately the same length within each bundle.

  3. Heat exchanger and related methods

    SciTech Connect (OSTI)

    Turner, Terry D.; McKellar, Michael G.

    2015-12-22

    Heat exchangers include a housing having an inlet and an outlet and forming a portion of a transition chamber. A heating member may form another portion of the transition chamber. The heating member includes a first end having a first opening and a second end having a second opening larger than the first opening. Methods of conveying a fluid include supplying a first fluid into a transition chamber of a heat exchanger, supplying a second fluid into the transition chamber, and altering a state of a portion of the first fluid with the second fluid. Methods of sublimating solid particles include conveying a first fluid comprising a material in a solid state into a transition chamber, heating the material to a gaseous state by directing a second fluid through a heating member and mixing the first fluid and the second fluid.

  4. SODIUM-WATER HEAT EXCHANGER

    DOE Patents [OSTI]

    Simmons, W.R.; Koch, L.J.

    1962-04-17

    A heat exchanger comprising a tank for hot liquid and a plurality of concentric, double tubes for cool liquid extending vertically through the tank is described. These tubes are bonded throughout most of their length but have an unbonded portion at both ends. The inner tubes extend between headers located above and below the tanmk and the outer tubes are welded into tube sheets forming the top and bottom of the tank at locations in the unbonded portions of the tubes. (AEC)

  5. Better Buildings Neighborhood Program Sustainability Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Better Buildings Neighborhood Program Sustainability Peer Exchange Call: Revenue from ... on topics relating to program sustainability. * Call Logistics and Participants ...

  6. Scientific Exchange Program | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Exchange Program Scientific Exchange Program The Scientific Exchange Program was established as part of Washington University's Photosynthetic Antenna Research Center (PARC), an Energy Frontier Research Center (EFRC) funded by the Department of Energy in 2009. This program will permit individuals from PARC teams, with a strong emphasis on graduate students and postdocs, to make extended visits to other laboratories within PARC. In addition to exchanges of team members, funds are also

  7. Small Column Ion Exchange at Savannah River Site Technology Readiness Assessment Report

    Energy Savers [EERE]

    Small Column Ion Exchange Technology at Savannah River Site U.S. Department of Energy Office of Environmental Management Office of Technology Innovation and Development Technology Readiness Assessment Report November 2011 U.S. DOE-EM Office of Technology Innovation and Development November 11, 2011 Small Column Ion Exchange Program Technology Readiness Assessment Page 2 of 112 This page intentionally left blank November 11, 2011 U.S. DOE-EM Office of Technology Innovation and Development Small

  8. Energy Exchange Update | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Exchange Update Energy Exchange Update May 5, 2016 1:30PM to 2:30PM EDT Updates about the 2016 Energy Exchange, which will be held August 9-11 in Providence, Rhode Island. This update offers the latest information about registration, learning tracks, session topics, session speakers, plenary sessions, workshops, continuing education units, and logistics

  9. Finance Peer Exchange Kickoff Call | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Finance Peer Exchange Kickoff Call Finance Peer Exchange Kickoff Call BetterBuildings Financing Peer Exchange Kickoff Call, Call Slides and Discussion Summary, April 28, 2011. PDF ...

  10. Peer Exchange Call on Financing and Revenue: Bond Funding | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Peer Exchange Call on Financing and Revenue: Bond Funding Peer Exchange Call on Financing and Revenue: Bond Funding Better Buildings Neighborhood Program Peer Exchange Call on...

  11. Lessons Learned: Peer Exchange Calls -- No. 5 | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 Lessons Learned: Peer Exchange Calls -- No. 5 Better Buildings Residential Network Lessons Learned: Peer Exchange Calls, No. 5. PDF icon Lessons Learned: Peer Exchange Calls -- ...

  12. Better Buildings Working with Utilities Peer Exchange Call: Kick...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Working with Utilities Peer Exchange Call: Kick-off Better Buildings Working with Utilities Peer Exchange Call: Kick-off Better Buildings Working with Utilities Peer Exchange Call:...

  13. EA-179 California Power Exchange Corporation | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EA-179 California Power Exchange Corporation Order authorizing Power Exchange Corporation to export electric energy to Mexico. PDF icon EA-179 California Power Exchange Corporation ...

  14. European Energy Exchange AG EEX | Open Energy Information

    Open Energy Info (EERE)

    Energy Exchange AG EEX Jump to: navigation, search Name: European Energy Exchange AG (EEX) Place: Leipzig, Germany Zip: D-04109 Product: Germany's energy exchange, which aims to...

  15. Data Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Data Analytics Data Transfer Workflow Tools Science Gateways Data Visualization Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or

  16. Fluidized bed heat exchanger utilizing angularly extending heat exchange tubes

    DOE Patents [OSTI]

    Talmud, Fred M.; Garcia-Mallol, Juan-Antonio

    1980-01-01

    A fluidized bed heat exchanger in which air is passed through a bed of particulate material containing fuel disposed in a housing. A steam/water natural circulation system is provided and includes a steam drum disposed adjacent the fluidized bed and a series of tubes connected at one end to the steam drum. A portion of the tubes are connected to a water drum and in the path of the air and the gaseous products of combustion exiting from the bed. Another portion of the tubes pass through the bed and extend at an angle to the upper surface of the bed.

  17. Management Alert: IG-0872 | Department of Energy

    Energy Savers [EERE]

    Management Alert: IG-0872 Management Alert: IG-0872 October 16, 2012 The Department of Energy's Management of Foreign Travel The Department of Energy (Department) and its workforce of 116,000 Federal and contractor personnel have numerous international exchanges and interactions at different levels and for a variety of important programmatic and other purposes. According to the Department's centralized travel database, the Foreign Travel Management System (FTMS), Federal and contractor employees

  18. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  19. Ion exchange purification of scandium

    DOE Patents [OSTI]

    Herchenroeder, L.A.; Burkholder, H.R.

    1990-10-23

    An improvement in purification of scandium through ion exchange chromatography is disclosed in which the oxidation potential of the eluting solution is altered by the addition of potassium chlorate or ammonium chloride so that removal of contaminants is encouraged. The temperature, pH and concentration of the eluent HEDTA are controlled in order to maintain the scandium in the column while minimizing dilution of the scandium band. Recovery of scandium is improved by pumping dilute scandium over the column prior to stripping the scandium and precipitation. This eliminates the HEDTA ion and other monovalent cations contaminating the scandium band. This method maximizes recovery of scandium while maintaining purity. 2 figs.

  20. NREL - DOE Technology Performance Exchange

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NREL - DOE Technology Performance Exchange 2014 Building Technologies Office Peer Review William Livingood, William.Livingood@nrel.gov National Renewable Energy Laboratory Project Summary Timeline: Start date: January 27, 2012 Planned end date: September 30, 2014 Key Milestones 1. Launch TPEx with 15 technology product categories; 9/30/2014 2. Recruit three utilities to commit up to $100,000 and use TPEx data; 9/30/2014 Budget: BTO $ to date: $614,000 FEMP $ to date: $565,000 Other $ to date:

  1. Ion exchange purification of scandium

    DOE Patents [OSTI]

    Herchenroeder, Laurie A.; Burkholder, Harvey R.

    1990-10-23

    An improvement in purification of scandium through ion exchange chromatography is disclosed in which the oxidation potential of the eluting solution is altered by the addition of potassium chlorate or ammonium chloride so that removal of contaminants is encouraged. The temperature, pH and concentration of the eluent HEDTA are controlled in order to maintain the scandium in the column while minimizing dilution of the scandium band. Recovery of scandium is improved by pumping dilute scandium over the column prior to stripping the scandium and precipitation. This eliminates the HEDTA ion and other monovalent cations contaminating the scandium band. This method maximizes recovery of scandium while maintaining purity.

  2. Heat Exchangers for Solar Water Heating Systems | Department...

    Energy Savers [EERE]

    Heat Exchangers for Solar Water Heating Systems Heat Exchangers for Solar Water Heating Systems Image of a heat exchanger. | Photo from iStockphoto.com Image of a heat exchanger. |...

  3. PREDICTION OF TOTAL DISSOLVED GAS EXCHANGE AT HYDROPOWER DAMS

    SciTech Connect (OSTI)

    Hadjerioua, Boualem; Pasha, MD Fayzul K; Stewart, Kevin M; Bender, Merlynn; Schneider, Michael L.

    2012-07-01

    Total dissolved gas (TDG) supersaturation in waters released at hydropower dams can cause gas bubble trauma in fisheries resulting in physical injuries and eyeball protrusion that can lead to mortality. Elevated TDG pressures in hydropower releases are generally caused by the entrainment of air in spillway releases and the subsequent exchange of atmospheric gasses into solution during passage through the stilling basin. The network of dams throughout the Columbia River Basin (CRB) are managed for irrigation, hydropower production, flood control, navigation, and fish passage that frequently result in both voluntary and involuntary spillway releases. These dam operations are constrained by state and federal water quality standards for TDG saturation which balance the benefits of spillway operations designed for Endangered Species Act (ESA)-listed fisheries versus the degradation to water quality as defined by TDG saturation. In the 1970s, the United States Environmental Protection Agency (USEPA), under the federal Clean Water Act (Section 303(d)), established a criterion not to exceed the TDG saturation level of 110% in order to protect freshwater and marine aquatic life. The states of Washington and Oregon have adopted special water quality standards for TDG saturation in the tailrace and forebays of hydropower facilities on the Columbia and Snake Rivers where spillway operations support fish passage objectives. The physical processes that affect TDG exchange at hydropower facilities have been studied throughout the CRB in site-specific studies and routine water quality monitoring programs. These data have been used to quantify the relationship between project operations, structural properties, and TDG exchange. These data have also been used to develop predictive models of TDG exchange to support real-time TDG management decisions. These empirically based predictive models have been developed for specific projects and account for both the fate of spillway and powerhouse flows in the tailrace channel and resultant exchange in route to the next downstream dam. Currently, there exists a need to summarize the general finding from operational and structural TDG abatement programs conducted throughout the CRB and for the development of a generalized prediction model that pools data collected at multiple projects with similar structural attributes. A generalized TDG exchange model can be tuned to specific projects and coupled with water regulation models to allow the formulation of optimal daily water regulation schedules subject to water quality constraints for TDG supersaturation. A generalized TDG exchange model can also be applied to other hydropower dams that affect TDG pressures in tailraces and can be used to develop alternative operational and structural measures to minimize TDG generation. It is proposed to develop a methodology for predicting TDG levels downstream of hydropower facilities with similar structural properties as a function of a set of variables that affect TDG exchange; such as tailwater depth, spill discharge and pattern, project head, and entrainment of powerhouse releases. TDG data from hydropower facilities located throughout the northwest region of the United States will be used to identify relationships between TDG exchange and relevant dependent variables. Data analysis and regression techniques will be used to develop predictive TDG exchange expressions for various structural categories.

  4. Fuel cell gas management system

    DOE Patents [OSTI]

    DuBose, Ronald Arthur

    2000-01-11

    A fuel cell gas management system including a cathode humidification system for transferring latent and sensible heat from an exhaust stream to the cathode inlet stream of the fuel cell; an anode humidity retention system for maintaining the total enthalpy of the anode stream exiting the fuel cell equal to the total enthalpy of the anode inlet stream; and a cooling water management system having segregated deionized water and cooling water loops interconnected by means of a brazed plate heat exchanger.

  5. Better Buildings Workforce Peer Exchange Quality Assurance Strategies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Quality Assurance Strategies Better Buildings Workforce Peer Exchange Quality Assurance Strategies Better Buildings Workforce Peer Exchange Quality Assurance Strategies, call ...

  6. Water Management in Mature Oil Fields using Advanced Particle Gels

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water Management in Mature Oil Fields using Advanced Particle Gels Final Report Contract no.: 11123-32 Jan. 15, 2016  Prime Contractor: The University of Texas at Austin  Participant: Missouri University of Science and Technology Contacts: - Mojdeh Delshad, 512-471-3219, delshad@mail.utexas.edu Baojun Bai, 573-341-4016, baib@mst.edu Research Partnership to Secure Energy for America (RPSEA) Project Manager: John R. Terneus Start Date: January 18, 2013 End Date: January 17, 2015 2 Table of

  7. Industrial energy management and utilization

    SciTech Connect (OSTI)

    Witte, L.C.; Schmidt, P.S.; Brown, D.R.

    1988-01-01

    This book presents a study of the technical, economic and management principles of effective energy use. The authors report on: energy consumption, conservation, and resources. They present an analysis of thermal-fluid systems. Energy conservation in combustion systems. Heat exchangers, heat recovery, energy conservation in industrial buildings, and industrial cogeneration are discussed.

  8. Lessons Learned: Peer Exchange Calls -- No. 4 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Lessons Learned: Peer Exchange Calls -- No. 4 Better Buildings Residential Network Lessons Learned: Peer Exchange Calls, No. 4. PDF icon Lessons Learned: Peer Exchange Calls -- No. 4 More Documents & Publications Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls Lessons Learned: Peer Exchange Calls -- No. 5 Lessons Learned: Peer Exchange Calls -- No. 3

  9. Technology Performance Exchange | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Buildings » Analysis Tools » Technology Performance Exchange Technology Performance Exchange The Technology Performance Exchange(tm) (TPEx(tm)) is a Web-based portal that allows technology manufacturers, evaluators, utilities, consumers, modelers, and researchers to share building-related product energy performance data. The TPEx uses documents termed data entry forms to preemptively define the minimum product-specific energy performance characteristics necessary to evaluate a

  10. Anion Exchange Membranes - Transport/Conductivity | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - TransportConductivity Anion Exchange Membranes - TransportConductivity Presentation at the AMFC Workshop, May 8-9, 2011, Arlington, VA PDF icon amfc110811aemstransport.pdf ...

  11. Heat transfer and heat exchangers reference handbook

    SciTech Connect (OSTI)

    Not Available

    1991-01-15

    The purpose of this handbook is to provide Rocky Flats personnel with an understanding of the basic concepts of heat transfer and the operation of heat exchangers.

  12. 2015 Annual Technical Exchange Meeting Presenters Biographical...

    Office of Environmental Management (EM)

    Sketches 2015 Annual Technical Exchange Meeting Presenters Biographical Sketches Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) 2015 Annual ...

  13. NETL's Energy Data eXchange

    ScienceCinema (OSTI)

    None

    2014-07-22

    A brief tour around NETL's Energy Data Exchange site, where researchers can upload data or look at data from another researcher.

  14. NETL's Energy Data eXchange

    SciTech Connect (OSTI)

    2014-07-16

    A brief tour around NETL's Energy Data Exchange site, where researchers can upload data or look at data from another researcher.

  15. "Heat Exchange Enhancing Insert" Inventors .--.. Andrei Khodak...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Exchange Enhancing Insert" Inventors .--.. Andrei Khodak, Michael A. Jaworski A new shape of the heat enhancing insert is proposed. This device creates an impinging jet ...

  16. Building Energy Data Exchange Specification Scoping Report

    Broader source: Energy.gov [DOE]

    Building Energy Data Exchange Specification Scoping Report. The Building Energy Data Exchange Specification (BEDES), developed by DOE, is a uniform format is intended to make it easier for external stakeholders to use DOE tools, streamline reporting for DOE programs, and help unlock the full utility of the data that the DOE collects.

  17. Management Alert: IG-0872 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 Management Alert: IG-0872 October 16, 2012 The Department of Energy's Management of Foreign Travel The Department of Energy (Department) and its workforce of 116,000 Federal and contractor personnel have numerous international exchanges and interactions at different levels and for a variety of important programmatic and other purposes. According to the Department's centralized travel database, the Foreign Travel Management System (FTMS), Federal and contractor employees made approximately

  18. 1994 Department of Energy Records Management Conference

    SciTech Connect (OSTI)

    Not Available

    1994-09-01

    The Department of Energy (DOE) Records Management Group (RMG) provides a forum for DOE and its contractor personnel to review and discuss subjects, issues, and concerns of common interest. This forum will include the exchange of information, and interpretation of requirements, and a dialog to aid in cost-effective management of the DOE Records Management program. This report contains the contributions from this forum.

  19. Hydrogen isotopic exchange over palladium metal

    SciTech Connect (OSTI)

    Carstens, D.H.W.; Encinias, P.D.

    1990-01-01

    We have recently developed the laser-Raman technique as a means of unambiguously measuring the partial pressures of all possible hydrogen isotopes in the gas phase. Using this technique we have investigated the hydrogen-deuterium exchange in a number of metals. This report presents detailed data for isotopic exchange in the palladium hydride system over the temperature range 26{degree}C to -100{degree}C at a pressure of 7 atm. First order kinetic rate constants and activation energies are summarized for the forward (hydride to deuteride) and reverse (deuteride to hydride) exchange processes. In addition, we have found that small amounts (100 ppm) of impurities in the exchange gases considerably slow the exchange kinetics with the effect increasing down the series CH{sub 4}, CO{sub 2}, H{sub 2}O, and CO. 9 refs., 4 figs., 1 tab.

  20. International Technology Exchange Division: 1993 Annual report

    SciTech Connect (OSTI)

    Not Available

    1993-12-31

    The Office of Technology Development (OTD) was established to ensure that reliable and acceptable technologies are available for implementation at DOE sites and that a technically trained work force is available to complete the EM mission by 2019. OTD established the International Technology Exchange Staff (ITES) to identify, evaluate, and acquire international technologies which can accelerate US DOE cleanup operations. ITES`s goal is to pursue international collaboration among government organizations, educational institutions, and private industry to identify world-wide needs and available technologies that will meet US environmental needs in general, and EM cleanup needs in particular; and establish mechanisms by which US government ER/WM technologies will be transferred to the US private sector for commercialization and export to international markets. ITES has developed the following strategic objectives to implement its international goals: develop and implement EM`s policy for international programs in accordance with DOE and US Government policies and regulations; establish efficient and predictable international technology transfer mechanisms; assist the US private sector in the commercialization and deployment of federally funded EM technologies and related knowledge in international markets; leverage US and non-US resources to accelerate international development and regulatory acceptance of EM technologies; contribute to the improvement of EM`s training of US students, scientists, and managers on international environmental issues. A summary and descriptions of program activities and accomplishments are given for 17 programs which comprise the four main areas of the ITES program: Activities with the Former Soviet Union, International Technology Transfer, International Cooperation, and Information Systems and Publications. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  1. 2013 Federal Energy and Water Management Award Winner Sandrine Schultz |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Sandrine Schultz 2013 Federal Energy and Water Management Award Winner Sandrine Schultz PDF icon fewm13_schultz_highres.pdf PDF icon fewm13_schultz.pdf More Documents & Publications Energy Exchange 2015 Speaker Biographies 2013 Federal Energy and Water Management Award Winner Commander Fleet Activities Yokosuka Federal Energy and Water Management Award Winners Christine Hull

  2. Novel Power Electronics Three-Dimensional Heat Exchanger: Preprint

    SciTech Connect (OSTI)

    Bennion, K.; Cousineau, J.; Lustbader, J.; Narumanchi, S.

    2014-08-01

    Electric drive systems for vehicle propulsion enable technologies critical to meeting challenges for energy, environmental, and economic security. Enabling cost-effective electric drive systems requires reductions in inverter power semiconductor area. As critical components of the electric drive system are made smaller, heat removal becomes an increasing challenge. In this paper, we demonstrate an integrated approach to the design of thermal management systems for power semiconductors that matches the passive thermal resistance of the packaging with the active convective cooling performance of the heat exchanger. The heat exchanger concept builds on existing semiconductor thermal management improvements described in literature and patents, which include improved bonded interface materials, direct cooling of the semiconductor packages, and double-sided cooling. The key difference in the described concept is the achievement of high heat transfer performance with less aggressive cooling techniques by optimizing the passive and active heat transfer paths. An extruded aluminum design was selected because of its lower tooling cost, higher performance, and scalability in comparison to cast aluminum. Results demonstrated a heat flux improvement of a factor of two, and a package heat density improvement over 30%, which achieved the thermal performance targets.

  3. Finance Peer Exchange Kickoff Call | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Finance Peer Exchange Kickoff Call Finance Peer Exchange Kickoff Call BetterBuildings Financing Peer Exchange Kickoff Call, Call Slides and Discussion Summary, April 28, 2011. PDF icon Call Slides and Discussion Summary More Documents & Publications Better Buildings Working with Utilities Peer Exchange Call: Kick-off Better Buildings Workforce Peer Exchange Call: Kick-off Stewards of Affordable Housing for the Future

  4. Lessons Learned: Peer Exchange Calls Fall 2014 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fall 2014 Lessons Learned: Peer Exchange Calls Fall 2014 Better Buildings Residential Network, Lessons Learned: Peer Exchange Calls Fall 2014. PDF icon Lessons Learned: Peer Exchange Calls More Documents & Publications Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls Lessons Learned: Peer Exchange Calls -- No. 3 Better Buildings Network View | October 2014

  5. How Would You Use a Smart Meter to Manage Your Energy Use? | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Smart Meter to Manage Your Energy Use? How Would You Use a Smart Meter to Manage Your Energy Use? May 19, 2011 - 7:30am Addthis On Monday, Andrea told you about smart meters and how they can help you monitor your home's energy usage. How would you use a smart meter to manage your energy use? Each Thursday, you have the chance to share your thoughts on a question about energy efficiency or renewable energy for consumers. Please e-mail your responses to the Energy Saver team at

  6. Federal Energy Management Program Issues 2016 AFFECT Funding Opportunity Announcement

    Broader source: Energy.gov [DOE]

    On May 26, 2016, the Federal Energy Management Program (FEMP) issued a funding opportunity announcement (FOA) on the EERE Exchange titled Assisting Federal Facilities with Energy Conservation Technologies (AFFECT) 2016.

  7. SPR - Historical Oil Sales and Exchanges | Department of Energy

    Energy Savers [EERE]

    - Historical Oil Sales and Exchanges SPR - Historical Oil Sales and Exchanges PDF icon SPR - Historical Oil Sales and Exchanges More Documents & Publications Historical SPR Annual Reports to Congress 2009 SPR Report to Congress SPR Acquisition Procedures - Final Rulemaking

  8. Building Integrated Heat and Moisture Exchange | Department of...

    Energy Savers [EERE]

    Integrated Heat and Moisture Exchange Building Integrated Heat and Moisture Exchange 1 of 2 Building-integrated heat and moisture exchanger, the AirFlow(tm) Panel, installed for ...

  9. Heat Exchangers for Solar Water Heating Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exchangers for Solar Water Heating Systems Heat Exchangers for Solar Water Heating Systems Image of a heat exchanger. | Photo from iStockphoto.com Image of a heat exchanger. | Photo from iStockphoto.com Solar water heating systems use heat exchangers to transfer solar energy absorbed in solar collectors to the liquid or air used to heat water or a space. Heat exchangers can be made of steel, copper, bronze, stainless steel, aluminum, or cast iron. Solar heating systems usually use copper,

  10. Offshore Energy Knowledge Exchange Workshop Report

    SciTech Connect (OSTI)

    none,

    2012-04-12

    A report detailing the presentations and topics discussed at the Offshore Energy Knowledge Exchange Workshop, an event designed to bring together offshore energy industry representatives to share information, best practices, and lessons learned.

  11. Energy Exchange 2015 Agenda at a Glance

    Broader source: Energy.gov [DOE]

    One page agenda at a glance for the Energy Exchange 2015, a two-and-a-half day training event that took place from August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona.

  12. EPA National Environmental Information Exchange Network Grant...

    Broader source: Energy.gov (indexed) [DOE]

    5 5:00PM EST U.S. Environmental Protection Agency The U.S. Environmental Protection Agency is accepting applications for the National Environmental Information Exchange Network...

  13. Energy Exchange Fact Sheet | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact sheet offers an overview of the Energy Exchange, a two-and-a-half day training scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona. PDF icon ...

  14. Energy Exchange Attendee Guide | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attendee guide offers an overview of the Energy Exchange, a two-and-a-half day training scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona. PDF ...

  15. Markets, distribution, and exchange after societal cataclysm

    SciTech Connect (OSTI)

    Cantor, R.A.; Henry, S.; Rayner, S.; Eastern Michigan Univ., Ypsilanti, MI . Dept. of Sociology; Oak Ridge National Lab., TN )

    1989-11-01

    The report identifies constraints and opportunities for the restoration of economic exchange following nuclear war. Four survival scenarios are postulated based on high or low levels of damage to (1) institutions that signal trading opportunities, reduce transaction costs, and regulate and enforce contracts, and (2) resources that are used to create and define wealth. The four scenarios are best case, worst case, resource abundance, and an institution intensive case. Three kinds of literature were reviewed, (1) the economics literature on formal markets, (2) the sociological literature on informal markets, and (3) the economic anthropology literature on pre-capitalist and pre-industrial exchange. From this corpus a set of non-market and market exchange structures are derived and rendered as rules vectors describing their operation. Each of the four survival scenarios is expounded as a subset of the possible exchange structures that is logically compatible with the constraints defining that scenario. 242 refs.

  16. Building Energy Data Exchange Specification Scoping Report |...

    Broader source: Energy.gov (indexed) [DOE]

    The Building Energy Data Exchange Specification (BEDES), developed by DOE, is a uniform ... for DOE programs, and help unlock the full utility of the data that the DOE collects. ...

  17. Energy Exchange Presentation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Overview of the Energy Exchange, a federal training event scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona. PDF icon eee 2015webinar.pdf More ...

  18. Heat Exchange, Additive Manufacturing, and Neutron Imaging

    SciTech Connect (OSTI)

    Geoghegan, Patrick

    2015-02-23

    Researchers at the Oak Ridge National Laboratory have captured undistorted snapshots of refrigerants flowing through small heat exchangers, helping them to better understand heat transfer in heating, cooling and ventilation systems.

  19. Proton Exchange Membrane Fuel Cells for Electrical Power Generation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Proton Exchange Membrane Fuel Cells for Electrical Power Generation On-Board Commercial Airplanes Proton Exchange Membrane Fuel Cells for Electrical Power Generation On-Board ...

  20. Emittance exchange results (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Conference: Emittance exchange results Citation Details In-Document Search Title: Emittance exchange results You are accessing a document from the Department of Energy's (DOE)...

  1. Non-aqueous liquid compositions comprising ion exchange polymers...

    Office of Scientific and Technical Information (OSTI)

    Non-aqueous liquid compositions comprising ion exchange polymers Title: Non-aqueous liquid compositions comprising ion exchange polymers Compositions, and methods of making ...

  2. Emittance and Phase Space Exchange (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Emittance and Phase Space Exchange Citation Details In-Document Search Title: Emittance and Phase Space Exchange You are accessing a document from the Department of Energy's ...

  3. Emittance and phase space exchange for advanced beam manipulation...

    Office of Scientific and Technical Information (OSTI)

    Emittance and phase space exchange for advanced beam manipulation and diagnostics Citation Details In-Document Search Title: Emittance and phase space exchange for advanced beam ...

  4. Emittance and Phase Space Exchange for Advanced Beam Manipulation...

    Office of Scientific and Technical Information (OSTI)

    Emittance and Phase Space Exchange for Advanced Beam Manipulation and Diagnostics Citation Details In-Document Search Title: Emittance and Phase Space Exchange for Advanced Beam ...

  5. Small Column Ion Exchange at Savannah River Site Technology Readiness...

    Broader source: Energy.gov (indexed) [DOE]

    Small Column Ion Exchange at Savannah River Site Technology Readiness Assessment Report More Documents & Publications Small Column Ion Exchange Technology at Savannah River Site ...

  6. External Technical Review Report for Small Column Ion Exchange...

    Energy Savers [EERE]

    Report for Small Column Ion Exchange Technology at Savannah River Site External Technical Review Report for Small Column Ion Exchange Technology at Savannah River Site Full ...

  7. Lessons Learned: Peer Exchange Calls -- No. 4 | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Lessons Learned: Peer Exchange Calls -- No. 4 Better Buildings Residential Network Lessons Learned, Lessons Learned: Peer Exchange Calls, No. 4. PDF icon Lessons Learned: Peer...

  8. Lessons Learned: Peer Exchange Calls Fall 2014 | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fall 2014 Lessons Learned: Peer Exchange Calls Fall 2014 Better Buildings Residential Network, Lessons Learned: Peer Exchange Calls Fall 2014. PDF icon Lessons Learned: Peer...

  9. Supercritical Carbon Dioxide Turbo-Expander and Heat Exchangers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Supercritical Carbon Dioxide Turbo-Expander and Heat Exchangers Supercritical Carbon Dioxide Turbo-Expander and Heat Exchangers This fact sheet describes a supercritical carbon ...

  10. Shanghai Environment and Energy Exchange | Open Energy Information

    Open Energy Info (EERE)

    Energy Exchange Jump to: navigation, search Name: Shanghai Environment and Energy Exchange Place: Shanghai Municipality, China Zip: 200083 Product: Trading platform for environment...

  11. Gate-tunable exchange coupling between cobalt clusters on graphene...

    Office of Scientific and Technical Information (OSTI)

    Gate-tunable exchange coupling between cobalt clusters on graphene Title: Gate-tunable exchange coupling between cobalt clusters on graphene Authors: Chen, Hua ; Niu, Qian ; Zhang, ...

  12. Circulating heat exchangers for oscillating wave engines and...

    Office of Scientific and Technical Information (OSTI)

    heat exchangers for oscillating wave engines and refrigerators Title: Circulating heat exchangers for oscillating wave engines and refrigerators An oscillating-wave engine or ...

  13. Better Buildings Residential Network: Lessons Learned: Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Network: Lessons Learned: Peer Exchange Calls Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls Better Buildings Residential Network: Lessons Learned: Peer...

  14. Program Sustainability Peer Exchange Call: Transitioning to a...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Sustainability Peer Exchange Call: Transitioning to a Utility Funded Program Environment: What Do I Need to Know? Program Sustainability Peer Exchange Call: Transitioning to ...

  15. Liquid Salt Heat Exchanger Technology for VHTR Based Applications...

    Office of Scientific and Technical Information (OSTI)

    Liquid Salt Heat Exchanger Technology for VHTR Based Applications Citation Details In-Document Search Title: Liquid Salt Heat Exchanger Technology for VHTR Based Applications The ...

  16. Comparison of Water-Hydrogen Catalytic Exchange Processes Versus...

    Office of Environmental Management (EM)

    Comparison of Water-Hydrogen Catalytic Exchange Processes Versus Water Distillation for Water Detritiation Comparison of Water-Hydrogen Catalytic Exchange Processes Versus Water ...

  17. EA-145-A British Columbia Power Exchange Corporation | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order authorizing British Columbia Power Exchange Corporation to export electric energy to Mexico. PDF icon EA-145-A British Columbia Power Exchange Corporation More Documents & ...

  18. December 15-16, 2015- Technical Exchange Meeting- Richland, Washington

    Broader source: Energy.gov [DOE]

    Technical Exchange Meeting, December 15-16, 2015 with optional Tour of the Hanford Site for registered participants of the Technical Exchange Meeting, December 17, 2015.

  19. Validation of Hydrogen Exchange Methodology on Molecular Sieves...

    Office of Environmental Management (EM)

    Validation of Hydrogen Exchange Methodology on Molecular Sieves for Tritium Removal from Contaminated Water Validation of Hydrogen Exchange Methodology on Molecular Sieves for...

  20. Electrical and Thermal Control of Magnetic Exchange Interactions...

    Office of Scientific and Technical Information (OSTI)

    Electrical and Thermal Control of Magnetic Exchange Interactions Citation Details In-Document Search Title: Electrical and Thermal Control of Magnetic Exchange Interactions ...

  1. Chemical Management

    Energy Savers [EERE]

    DOE-HDBK-11391-2006 May 2006 DOE HANDBOOK CHEMICAL MANAGEMENT (Volume 1 of 3) U.S. ... and contractor managers in assessing chemical hazard management and is approved for ...

  2. Heat exchanger for power generation equipment

    DOE Patents [OSTI]

    Nirmalan, Nirm Velumylm; Bowman, Michael John

    2005-06-14

    A heat exchanger for a turbine is provided wherein the heat exchanger comprises a heat transfer cell comprising a sheet of material having two opposed ends and two opposed sides. In addition, a plurality of concavities are disposed on a surface portion of the sheet of material so as to cause hydrodynamic interactions and affect a heat transfer rate of the turbine between a fluid and the concavities when the fluid is disposed over the concavities.

  3. Acidic Ion Exchange Membrane - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hydrogen and Fuel Cell Hydrogen and Fuel Cell Energy Storage Energy Storage Find More Like This Return to Search Acidic Ion Exchange Membrane Colorado School of Mines Contact CSM About This Technology Technology Marketing SummaryIn this invention we report the synthesis of a copolymer of vinyl phosphonic acid (VPA) and vinyl zirconium phosphorous (VZP) acid has been achieved for the production of ion exchange membranes. DescriptionCharacterization of the membrane has been accomplished using a

  4. Project Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Management Project Management MaRIE is the experimental facility needed to control the time-dependent properties of materials for national security science missions. It ...

  5. Deactivation Management

    Broader source: Energy.gov [DOE]

    The purpose here is to provide information for specific aspects of project management that apply to deactivation. Overall management of deactivation projects should use a traditional project...

  6. Conference Management

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1999-11-03

    To establish requirements and responsibilities with respect to managing conferences sponsored by the Department of Energy (DOE) or by DOE management and operating contractors and other contractors who perform work at DOE-owned or -leased facilities, including management and integration contractors and environmental restoration management contractors (when using funds that will be reimbursed by DOE). Cancels DOE N 110.3.

  7. Excitonic exchange splitting in bulk semiconductors

    SciTech Connect (OSTI)

    Fu, H.; Wang, L.; Zunger, A.

    1999-02-01

    We present an approach to calculate the excitonic fine-structure splittings due to electron-hole short-range exchange interactions using the local-density approximation pseudopotential method, and apply it to bulk semiconductors CdSe, InP, GaAs, and InAs. Comparing with previous theoretical results, the current calculated splittings agree well with experiments. Furthermore, we provide an approximate relationship between the short-range exchange splitting and the exciton Bohr radius, which can be used to estimate the exchange splitting for other materials. The current calculation indicates that a commonly used formula for exchange splitting in quantum dot is not valid. Finally, we find a very large pressure dependence of the exchange splitting: a factor of 4.5 increase as the lattice constant changes by 3.5{percent}. This increase is mainly due to the decrease of the Bohr radius via the change of electron effective mass. {copyright} {ital 1999} {ital The American Physical Society}

  8. Exchange bias mediated by interfacial nanoparticles (invited)

    SciTech Connect (OSTI)

    Berkowitz, A. E.; Sinha, S. K.; Fullerton, E. E.; Smith, D. J.

    2015-05-07

    The objective of this study on the iconic exchange-bias bilayer Permalloy/CoO has been to identify those elements of the interfacial microstructure and accompanying magnetic properties that are responsible for the exchange-bias and hysteretic properties of this bilayer. Both epitaxial and polycrystalline samples were examined. X-ray and neutron reflectometry established that there existed an interfacial region, of width ?1?nm, whose magnetic properties differed from those of Py or CoO. A model was developed for the interfacial microstructure that predicts all the relevant properties of this system; namely; the temperature and Permalloy thickness dependence of the exchange-bias, H{sub EX}, and coercivity, H{sub C}; the much smaller measured values of H{sub EX} from what was nominally expected; the different behavior of H{sub EX} and H{sub C} in epitaxial and polycrystalline bilayers. A surprising result is that the exchange-bias does not involve direct exchange-coupling between Permalloy and CoO, but rather is mediated by CoFe{sub 2}O{sub 4} nanoparticles in the interfacial region.

  9. Nanoheterostructure Cation Exchange: Anionic Framework Conservation

    SciTech Connect (OSTI)

    Jain, Prashant K.; Amirav, Lilac; Aloni, Shaul; Alivisatos, A. Paul

    2010-05-11

    In ionic nanocrystals the cationic sub-lattice can be replaced with a different metal ion via a fast, simple, and reversible place-exchange, allowing post-synthetic modification of the composition of the nanocrystal, while preserving its size and shape. Here, we demonstrate for the first time that during such an exchange, the anionic framework of the crystal is preserved. When applied to nanoheterostructures, this phenomenon ensures that compositional interfaces within the heterostructure are conserved throughout the transformation. For instance, a morphology composed of a CdSe nanocrystal embedded in a CdS rod (CdSe/CdS) was exchanged to a PbSe/PbS nanorod via a Cu2Se/Cu2S structure. During every exchange cycle, the seed size and position within the nanorod were preserved, as evident by excitonic features, Z-contrast imaging, and elemental line-scans. Anionic framework conservation extends the domain of cation exchange to the design of more complex and unique nanostructures.

  10. Heat exchanger restart evaluation. Revision 1

    SciTech Connect (OSTI)

    Morrison, J.M.; Hirst, C.W.; Lentz, T.F.

    1992-03-18

    On December 24, 1991, the K-Reactor was in the shutdown mode with full AC process water flow and full cooling water flow. Safety rod testing was being performed as part of the power ascension testing program. The results of cooling water samples indicated tritium concentrations higher than allowable. Further sampling and testing confirmed a Process Water System to Cooling Water System leak in heat exchanger 4A (HX 4A). The heat exchanger was isolated and the plant shutdown. Heat exchanger 4A was removed from the plant and moved to C-Area prior to performing examinations and diagnostic testing. This included locating and identifying the leaking tube or tubes, eddy current examination of the leaking tube and a number of adjacent tubes, visually inspecting the leaking tube from both the inside as well as the area surrounding the identified tube. The leaking tube was removed and examined metallurgically to determine the failure mechanism. In addition ten other tubes that either exhibited eddy current indications or would represent a baseline condition were removed from heat exchanger 4A for metallurgical examination. Additional analysis and review of heat exchanger leakage history was performed to determine if there are any patterns which can be used for predictive purposes. Compensatory actions have been taken to improve the sensitivity and response time to any future events of this type. The results of these actions are summary herein.

  11. Percolation in a Proton Exchange Membrane Fuel Cell Catalyst Layer

    SciTech Connect (OSTI)

    Stacy, Stephen; Allen, Jeffrey

    2012-07-01

    Water management in the catalyst layers of proton exchange membrane fuel cells (PEMFC) is confronted by two issues, flooding and dry out, both of which result in improper functioning of the fuel cell and lead to poor performance and degradation. At the present time, the data that has been reported about water percolation and wettability within a fuel cell catalyst layer is limited. A method and apparatus for measuring the percolation pressure in the catalyst layer has been developed based upon an experimental apparatus used to test water percolation in porous transport layers (PTL). The experimental setup uses a pseudo Hele-Shaw type testing where samples are compressed and a fluid is injected into the sample. Testing the samples gives percolation pressure plots which show trends in increasing percolation pressure with an increase in flow rate. A decrease in pressure was seen as percolation occurred in one sample, however the pressure only had a rising effect in the other sample.

  12. Effects of ionizing radiation on modern ion exchange materials

    SciTech Connect (OSTI)

    Marsh, S.F.; Pillay, K.K.S.

    1993-10-01

    We review published studies of the effects of ionizing radiation on ion exchange materials, emphasizing those published in recent years. A brief overview is followed by a more detailed examination of recent developments. Our review includes styrene/divinylbenzene copolymers with cation-exchange or anion-exchange functional groups, polyvinylpyridine anion exchangers, chelating resins, multifunctional resins, and inorganic exchangers. In general, strong-acid cation exchange resins are more resistant to radiation than are strong-base anion exchange resins, and polyvinylpyridine resins are more resistant than polystyrene resins. Cross-linkage, salt form, moisture content, and the surrounding medium all affect the radiation stability of a specific exchanger. Inorganic exchangers usually, but not always, exhibit high radiation resistance. Liquid ion exchangers, which have been used so extensively in nuclear processing applications, also are included.

  13. Miniaturized Air to Refrigerant Heat Exchangers

    Broader source: Energy.gov [DOE]

    This project is developing a miniaturized air-to-refrigerant heat exchanger that is more compact and more energy efficient than current market designs. The heat exchanger will feature at least 20% less volume, material volume, and approach temperature compared to current multiport flat tube designs, and it will be in production within five years. The heat exchanger, which acts as both an evaporator and a condenser, can be applied to commercial and residential air-conditioning or heat pump systems with various capacity scales. Prototype 1-kilowatt (kW) and 10 kW designs will be tested and then improved as necessary for final tests and demonstration in a 3-ton heat pump.

  14. Modeling of Crystalline Silicotitanate Ion Exchange Columns

    SciTech Connect (OSTI)

    Walker, D.D.

    1999-03-09

    Non-elutable ion exchange is being considered as a potential replacement for the In-Tank Precipitation process for removing cesium from Savannah River Site (SRS) radioactive waste. Crystalline silicotitanate (CST) particles are the reference ion exchange medium for the process. A major factor in the construction cost of this process is the size of the ion exchange column required to meet product specifications for decontaminated waste. To validate SRS column sizing calculations, SRS subcontracted two reknowned experts in this field to perform similar calculations: Professor R. G. Anthony, Department of Chemical Engineering, Texas A&038;M University, and Professor S. W. Wang, Department of Chemical Engineering, Purdue University. The appendices of this document contain reports from the two subcontractors. Definition of the design problem came through several meetings and conference calls between the participants and SRS personnel over the past few months. This document summarizes the problem definition and results from the two reports.

  15. Heat exchanger for coal gasification process

    DOE Patents [OSTI]

    Blasiole, George A.

    1984-06-19

    This invention provides a heat exchanger, particularly useful for systems requiring cooling of hot particulate solids, such as the separated fines from the product gas of a carbonaceous material gasification system. The invention allows effective cooling of a hot particulate in a particle stream (made up of hot particulate and a gas), using gravity as the motive source of the hot particulate. In a preferred form, the invention substitutes a tube structure for the single wall tube of a heat exchanger. The tube structure comprises a tube with a core disposed within, forming a cavity between the tube and the core, and vanes in the cavity which form a flow path through which the hot particulate falls. The outside of the tube is in contact with the cooling fluid of the heat exchanger.

  16. Modeling particle deposition on HVAC heat exchangers

    SciTech Connect (OSTI)

    Siegel, J.A.; Nazaroff, W.W.

    2002-01-01

    Fouling of fin-and-tube heat exchangers by particle deposition leads to diminished effectiveness in supplying ventilation and air conditioning. This paper explores mechanisms that cause particle deposition on heat exchanger surfaces. We present a model that accounts for impaction, diffusion, gravitational settling, and turbulence. Simulation results suggest that some submicron particles deposit in the heat exchanger core, but do not cause significant performance impacts. Particles between 1 and 10 {micro}m deposit with probabilities ranging from 1-20% with fin edge impaction representing the dominant mechanism. Particles larger than 10 {micro}m deposit by impaction on refrigerant tubes, gravitational settling on fin corrugations, and mechanisms associated with turbulent airflow. The model results agree reasonably well with experimental data, but the deposition of larger particles at high velocities is underpredicted. Geometric factors, such as discontinuities in the fins, are hypothesized to be responsible for the discrepancy.

  17. Building Energy Data Exchange Specification (BEDES) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data Exchange Specification (BEDES) Building Energy Data Exchange Specification (BEDES) Building Energy Data Exchange Specification (BEDES) Overview The Building Energy Data Exchange Specification (BEDES, pronounced "beads" or /bi:ds/) is a dictionary of terms, definitions, and field formats which was created to help facilitate the exchange of information on building characteristics and energy use. It is intended to be used in tools and activities that help stakeholders make

  18. Sandia National Laboratories: Malware Technical Exchange Meeting (MTEM)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2014 2014 Malware Technical Exchange Meeting Facebook Twitter YouTube Flickr RSS Top 2014 Malware Technical Exchange Meeting Technical Program Committee Members Registration Hotels in Albuquerque Program Agenda 2014 Malware Technical Exchange Meeting Malware Technical Exchange Meeting (MTEM) 2014 Evolving Adversaries: Stories From the Field About the General Session The 2014 Malware Technical Exchange Meeting will take place July 22-24, 2014 on Kirtland Air Force Base in Albuquerque, NM. The

  19. High-Performance Refrigerator Using Novel Rotating Heat Exchanger |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy High-Performance Refrigerator Using Novel Rotating Heat Exchanger High-Performance Refrigerator Using Novel Rotating Heat Exchanger Rotating heat exchangers installed in appliances and heat pumps have the potentially to reduce energy costs and refrigerant charge in a compact space. Rotating heat exchangers installed in appliances and heat pumps have the potentially to reduce energy costs and refrigerant charge in a compact space. Sandia-developed rotating heat exchanger

  20. Energy Exchange 2015 Fact Sheet | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact Sheet Energy Exchange 2015 Fact Sheet Fact sheet offers an overview of the Energy Exchange 2015, a two-and-a-half day training that took place from August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona. PDF icon View the fact sheet. More Documents & Publications Energy Exchange 2015 Overview Presentation Energy Exchange 2015: Phoenix, Arizona Energy Exchange 2015 Attendee Guide

  1. Memorandum of Understanding between US Department of Energy and the Public Agency for Radioactive Waste Management of the Republic of Hungary

    Broader source: Energy.gov [DOE]

    Memorandum of Understanding between US Department of Energy and the Public Agency for Radioactive Waste Management of the Republic of Hungary for information exchange relating to operation of...

  2. Miniaturized Air-to-Refrigerant Heat Exchangers

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Miniaturized Air-to-Refrigerant Heat Exchangers 2014 Building Technologies Office Peer Review Prof. Reinhard Radermacher, raderm@umd.edu University of Maryland College Park Project Summary Timeline: Start date: 03/01/2013 Planned end date: 02/29/2016 Key Milestones 1. Heat exchanger designs/process: 6/30/14 2. Fabrication/testing of 1 kW: 9/30/14 3. Fabrication/testing of 10 kW: 9/30/2015 Budget: Total DOE $ to date: $561K Total future DOE $: $489K Target Market/Audience: Residential and

  3. ION EXCHANGE ADSORPTION PROCESS FOR PLUTONIUM SEPARATION

    DOE Patents [OSTI]

    Boyd, G.E.; Russell, E.R.; Taylor, M.D.

    1961-07-11

    Ion exchange processes for the separation of plutonium from fission products are described. In accordance with these processes an aqueous solution containing plutonium and fission products is contacted with a cation exchange resin under conditions favoring adsorption of plutonium and fission products on the resin. A portion of the fission product is then eluted with a solution containing 0.05 to 1% by weight of a carboxylic acid. Plutonium is next eluted with a solution containing 2 to 8 per cent by weight of the same carboxylic acid, and the remaining fission products on the resin are eluted with an aqueous solution containing over 10 per cent by weight of sodium bisulfate.

  4. Heat Exchanger With Internal Pin Elements

    DOE Patents [OSTI]

    Gerstmann, Joseph (Framingham, MA); Hannon, Charles L. (Arlington, MA)

    2004-01-13

    A heat exchanger/heater comprising a tubular member having a fluid inlet end, a fluid outlet end and plurality of pins secured to the interior wall of the tube. Various embodiments additionally comprise a blocking member disposed concentrically inside the pins, such as a core plug or a baffle array. Also disclosed is a vapor generator employing an internally pinned tube, and a fluid-heater/heat-exchanger utilizing an outer jacket tube and fluid-side baffle elements, as well as methods for heating a fluid using an internally pinned tube.

  5. Low exchange element for nuclear reactor

    DOE Patents [OSTI]

    Brogli, Rudolf H. (Aarau, CH); Shamasunder, Bangalore I. (Encinitas, CA); Seth, Shivaji S. (Encinitas, CA)

    1985-01-01

    A flow exchange element is presented which lowers temperature gradients in fuel elements and reduces maximum local temperature within high temperature gas-cooled reactors. The flow exchange element is inserted within a column of fuel elements where it serves to redirect coolant flow. Coolant which has been flowing in a hotter region of the column is redirected to a cooler region, and coolant which has been flowing in the cooler region of the column is redirected to the hotter region. The safety, efficiency, and longevity of the high temperature gas-cooled reactor is thereby enhanced.

  6. Better Buildings Neighborhood Program Workforce Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Organizations * Austin, TX * Boulder County, CO * California Center for Sustainable Energy * Charlottesville, VA * Chicago, IL * Energy Efficiency Management * ...

  7. Calorimetry exchange program. Annual report, 1988

    SciTech Connect (OSTI)

    Lyons, J.E.

    1988-12-31

    The goals of the Calorimetry Sample Program are: 1. Discuss measurement differences, 2. Review and improve analytical measurements and methods, 3. Discuss new measurement capabilities, 4. Provide data to DOE on measurement capabilities to evaluate shipper- receiver differences, 5. Provide characterized or standard materials as necessary for exchange participants, 6. Provide a measurement control program for plutonium analysis. A sample of PuO{sub 2} powder is available at each participating site for NDA measurement, including either or both calorimetry and high-resolution gamma-ray spectroscopy, the elements which are typically combined to provide a calorimetric assay of plutonium. The facilities measure the sample as frequently and to the level of precision which they desire, and then submit the data to the Exchange for analysis. Statistical tests are used to evaluate the data and to determine if there are significant differences from accepted values for the exchange or from data previously reported by that facility. Data included in this report is a compilation of all exchange data received in 1988. Since a large number of data points were recorded, a change was made to the analysis method to account for the uncertainty in the accepted values.

  8. Ion exchange polymers for anion separations

    DOE Patents [OSTI]

    Jarvinen, Gordon D.; Marsh, S. Fredric; Bartsch, Richard A.

    1997-01-01

    Anion exchange resins including at least two positively charged sites and a ell-defined spacing between the positive sites are provided together with a process of removing anions or anionic metal complexes from aqueous solutions by use of such resins. The resins can be substituted poly(vinylpyridine) and substituted polystyrene.

  9. Ion exchange polymers for anion separations

    DOE Patents [OSTI]

    Jarvinen, G.D.; Marsh, S.F.; Bartsch, R.A.

    1997-09-23

    Anion exchange resins including at least two positively charged sites and a well-defined spacing between the positive sites are provided together with a process of removing anions or anionic metal complexes from aqueous solutions by use of such resins. The resins can be substituted poly(vinylpyridine) and substituted polystyrene.

  10. Hydrous oxide ion-exchange compound catalysts

    DOE Patents [OSTI]

    Dosch, Robert G. (Albuquerque, NM); Stephens, Howard P. (Albuquerque, NM)

    1990-01-01

    A catalytic material of improved activity which comprises a hydrous, alkali metal or alkaline earth metal or quaternary ammonium titanate, zirconate, niobate, or tantalate, in which the metal or ammonium cations have been exchange with a catalytically effective quantity of a catalyst metal, and which has been subsequently treated with a solution of a Bronsted acid.

  11. Bifunctional anion-exchange resins with improved selectivity and exchange kinetics

    DOE Patents [OSTI]

    Alexandratos, Spiro D. (Knoxville, TN); Brown, Gilbert M. (Knoxville, TN); Bonnesen, Peter V. (Knoxville, TN); Moyer, Bruce A. (Oak Ridge, TN)

    2000-01-01

    Disclosed herein are a class of anion exchange resins containing two different exchange sites with improved selectivity and sorptive capability for chemical species in solution, such as heptavalent technetium (as pertechnetate anion, TcO.sub.4.sup.-). The resins are prepared by first reacting haloalkylated crosslinked copolymer beads with a large tertiary amine in a solvent in which the resin beads can swell, followed by reaction with a second, smaller, tertiary amine to more fully complete the functionalization of the resin. The resins have enhanced selectivity, capacity, and exchange kinetics.

  12. MANAGEMENT ALERT

    Broader source: Energy.gov (indexed) [DOE]

    COMMISSION FROM: Gregory H. Friedman Inspector General SUBJECT: INFORMATION: Management Alert: Review of Allegations of Improper Disclosure of Confidential, Nonpublic...

  13. DEACTIVATION MANAGEMENT

    Office of Environmental Management (EM)

    MANAGEMENT The purpose here is to provide information for specific aspects of project management that apply to deactivation. Overall management of deactivation projects should use a traditional project management approach, and as such is not addressed. The following specific topics are based on lessons learned during deactivation of DOE facilities.  The Deactivation Mission  The Stabilization/Deactivation "Customer"  Project Approach for a Complex Facility  Establishing the

  14. DOE G 242.1-1 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    G 242.1-1 DOE G 242.1-1 Forms Management Guide for use with DOE O 200.1 Information Management Program PDF icon DOE G 242 1 1.pdf More Documents & Publications DOE F 242.1 Forms Manager Designation Minutes from the Print and Mail Managers Exchange Forum Teleconferences DOE F 1322.4

  15. Heat exchanger with transpired, highly porous fins

    DOE Patents [OSTI]

    Kutscher, Charles F.; Gawlik, Keith

    2002-01-01

    The heat exchanger includes a fin and tube assembly with increased heat transfer surface area positioned within a hollow chamber of a housing to provide effective heat transfer between a gas flowing within the hollow chamber and a fluid flowing in the fin and tube assembly. A fan is included to force a gas, such as air, to flow through the hollow chamber and through the fin and tube assembly. The fin and tube assembly comprises fluid conduits to direct the fluid through the heat exchanger, to prevent mixing with the gas, and to provide a heat transfer surface or pathway between the fluid and the gas. A heat transfer element is provided in the fin and tube assembly to provide extended heat transfer surfaces for the fluid conduits. The heat transfer element is corrugated to form fins between alternating ridges and grooves that define flow channels for directing the gas flow. The fins are fabricated from a thin, heat conductive material containing numerous orifices or pores for transpiring the gas out of the flow channel. The grooves are closed or only partially open so that all or substantially all of the gas is transpired through the fins so that heat is exchanged on the front and back surfaces of the fins and also within the interior of the orifices, thereby significantly increasing the available the heat transfer surface of the heat exchanger. The transpired fins also increase heat transfer effectiveness of the heat exchanger by increasing the heat transfer coefficient by disrupting boundary layer development on the fins and by establishing other beneficial gas flow patterns, all at desirable pressure drops.

  16. Comparative analysis of compact heat exchangers for application as the intermediate heat exchanger for advanced nuclear reactors

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bartel, N.; Chen, M.; Utgikar, V. P.; Sun, X.; Kim, I. -H.; Christensen, R.; Sabharwall, P.

    2015-04-04

    A comparative evaluation of alternative compact heat exchanger designs for use as the intermediate heat exchanger in advanced nuclear reactor systems is presented in this article. Candidate heat exchangers investigated included the Printed circuit heat exchanger (PCHE) and offset strip-fin heat exchanger (OSFHE). Both these heat exchangers offer high surface area to volume ratio (a measure of compactness [m2/m3]), high thermal effectiveness, and overall low pressure drop. Helium–helium heat exchanger designs for different heat exchanger types were developed for a 600 MW thermal advanced nuclear reactor. The wavy channel PCHE with a 15° pitch angle was found to offer optimummore » combination of heat transfer coefficient, compactness and pressure drop as compared to other alternatives. The principles of the comparative analysis presented here will be useful for heat exchanger evaluations in other applications as well.« less

  17. Comparative analysis of compact heat exchangers for application as the intermediate heat exchanger for advanced nuclear reactors

    SciTech Connect (OSTI)

    Bartel, N.; Chen, M.; Utgikar, V. P.; Sun, X.; Kim, I. -H.; Christensen, R.; Sabharwall, P.

    2015-04-04

    A comparative evaluation of alternative compact heat exchanger designs for use as the intermediate heat exchanger in advanced nuclear reactor systems is presented in this article. Candidate heat exchangers investigated included the Printed circuit heat exchanger (PCHE) and offset strip-fin heat exchanger (OSFHE). Both these heat exchangers offer high surface area to volume ratio (a measure of compactness [m2/m3]), high thermal effectiveness, and overall low pressure drop. Helium–helium heat exchanger designs for different heat exchanger types were developed for a 600 MW thermal advanced nuclear reactor. The wavy channel PCHE with a 15° pitch angle was found to offer optimum combination of heat transfer coefficient, compactness and pressure drop as compared to other alternatives. The principles of the comparative analysis presented here will be useful for heat exchanger evaluations in other applications as well.

  18. Environmental Management Waste Management Facility (EMWMF) at...

    Office of Environmental Management (EM)

    Review of the Environmental Management Waste Management Facility (EMWMF) at Oak Ridge ... INTRODUCTION The Environmental Management Waste Management Facility (EMWMF) is a land ...

  19. Triple loop heat exchanger for an absorption refrigeration system

    DOE Patents [OSTI]

    Reimann, Robert C.

    1984-01-01

    A triple loop heat exchanger for an absorption refrigeration system is disclosed. The triple loop heat exchanger comprises portions of a strong solution line for conducting relatively hot, strong solution from a generator to a solution heat exchanger of the absorption refrigeration system, conduit means for conducting relatively cool, weak solution from the solution heat exchanger to the generator, and a bypass system for conducting strong solution from the generator around the strong solution line and around the solution heat exchanger to an absorber of the refrigeration system when strong solution builds up in the generator to an undesirable level. The strong solution line and the conduit means are in heat exchange relationship with each other in the triple loop heat exchanger so that, during normal operation of the refrigeration system, heat is exchanged between the relatively hot, strong solution flowing through the strong solution line and the relatively cool, weak solution flowing through the conduit means. Also, the strong solution line and the bypass system are in heat exchange relationship in the triple loop heat exchanger so that if the normal flow path of relatively hot, strong solution flowing from the generator to an absorber is blocked, then this relatively, hot strong solution which will then be flowing through the bypass system in the triple loop heat exchanger, is brought into heat exchange relationship with any strong solution which may have solidified in the strong solution line in the triple loop heat exchanger to thereby aid in desolidifying any such solidified strong solution.

  20. 1995 Department of Energy Records Management Conference

    SciTech Connect (OSTI)

    1995-07-01

    The Department of Energy (DOE) Records Management Group (RMG) provides a forum for DOE and its contractor personnel to review and discuss subjects, issues, and concerns of common interest. This forum will include the exchange of information, and interpretation of requirements, and a dialog to aid in cost-effective management of the DOE Records Management program. Issues addressed by the RMG may result in recommendations for DOE-wide initiatives. Proposed DOE-wide initiatives shall be, provided in writing by the RMG Steering Committee to the DOE Records Management Committee and to DOE`s Office of ERM Policy, Records, and Reports Management for appropriate action. The membership of the RMG is composed of personnel engaged in Records Management from DOE Headquarters, Field sites, contractors, and other organizations, as appropriate. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  1. Teaching Managers How to Manage

    SciTech Connect (OSTI)

    Hylko, J.M.

    2006-07-01

    Following graduation from a college or university with a technical degree, or through years of experience, an individual's training and career development activities typically focus on enhancing technical problem-solving skills. However, as these technical professionals, herein referred to as 'Techies', advance throughout their careers, they may be required to accept and adapt to the role of being a manager, and must undergo a transition to learn and rely on new problem-solving skills. However, unless a company has a specific manager-trainee class to address this subject and develop talent from within, an employee's management style is learned and developed 'on the job'. Both positive and negative styles are nurtured by those managers having similar qualities. Unfortunately, a negative style often contributes to the deterioration of employee morale and ultimate closing of a department or company. This paper provides the core elements of an effective management training program for 'Teaching Managers How to Manage' derived from the Department of Energy's Integrated Safety Management System and the Occupational Safety and Health Administration 's Voluntary Protection Program. Discussion topics and real-life examples concentrate on transitioning an employee from a 'Techie' to a manager; common characteristics of being a manager; the history and academic study of management; competition, change and the business of waste management; what to do after taking over a department by applying Hylko's Star of Success; command media; the formal and informal organizational charts; chain of command; hiring and developing high-degree, autonomous employees through effective communication and delegation; periodic status checks; and determining if the program is working successfully. These common characteristics of a strong management/leadership culture and practical career tips discussed herein provide a solid foundation for any company or department that is serious about developing an effective management training program for its employees. In turn, any employee in any work environment can begin using this information immediately if they want to become a better manager. (authors)

  2. 1-MWe heat exchangers for OTEC. Final acceptance document

    SciTech Connect (OSTI)

    Snyder, J.E.

    1980-06-19

    Acceptance documents for major units of 1 MWe OTEC heat exchangers, including condensers and evaporators, are provided. Included are a transportation plan for the heat exchangers and design specifications for the phase separator. (LEW)

  3. SPR Awards Exchange Contract to Shell Trading | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Awards Exchange Contract to Shell Trading SPR Awards Exchange Contract to Shell Trading May 10, 2007 - 12:55pm Addthis Deliveries to Begin in August WASHINGTON, DC - The U.S. ...

  4. Exploration Best Practices and the OpenEI Knowledge Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exploration Best Practices and the OpenEI Knowledge Exchange Webinar Exploration Best Practices and the OpenEI Knowledge Exchange Webinar Exploration Best Practices and the OpenEI ...

  5. EPA National Environmental Information Exchange Network Grant Program

    Broader source: Energy.gov [DOE]

    The U.S. Environmental Protection Agency is accepting applications for the National Environmental Information Exchange Network Grants Program to provide funding to state territories and federally recognized Indian tribes to support the development of the Environmental Information Exchange Network.

  6. Lessons Learned: Peer Exchange Calls -- No. 3 | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Lessons Learned: Peer Exchange Calls -- No. 3 Lessons Learned: Peer Exchange Calls -- No. 3, as posted on the U.S. Department of Energy's Better Buildings Residential Network...

  7. Better Buildings Workforce Peer Exchange Call: Kick-off | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Call: Kick-off Better Buildings Workforce Peer Exchange Call: Kick-off Better Buildings Workforce Peer Exchange Call: Kick-off Call Slides and Discussion Summary. April 21, 2011....

  8. Heat Exchangers for Solar Water Heating Systems | Department...

    Broader source: Energy.gov (indexed) [DOE]

    from iStockphoto.com Image of a heat exchanger. | Photo from iStockphoto.com Solar water heating systems use heat exchangers to transfer solar energy absorbed in solar...

  9. Exploration Best Practices and the OpenEI Knowledge Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exploration Best p Practices & The OpenEI Knowledge Exchange Knowledge Exchange G th l T h l i P W bi Geothermal Technologies Program Webinar Katherine R. Young Timothy Reber ...

  10. Sandwhiched Orb/Grid Heat Exchanger | Princeton Plasma Physics...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandwhiched OrbGrid Heat Exchanger The design basis of the heat exchanger is that the most efficient geometrical shape to thermally stabilize during exposure to heat or to neutron ...

  11. Growth of oxide exchange bias layers

    DOE Patents [OSTI]

    Chaiken, A.; Michel, R.P.

    1998-07-21

    An oxide (NiO, CoO, NiCoO) antiferromagnetic exchange bias layer produced by ion beam sputtering of an oxide target in pure argon (Ar) sputtering gas, with no oxygen gas introduced into the system. Antiferromagnetic oxide layers are used, for example, in magnetoresistive readback heads to shift the hysteresis loops of ferromagnetic films away from the zero field axis. For example, NiO exchange bias layers have been fabricated using ion beam sputtering of an NiO target using Ar ions, with the substrate temperature at 200 C, the ion beam voltage at 1000V and the beam current at 20 mA, with a deposition rate of about 0.2 {angstrom}/sec. The resulting NiO film was amorphous. 4 figs.

  12. Growth of oxide exchange bias layers

    DOE Patents [OSTI]

    Chaiken, Alison; Michel, Richard P.

    1998-01-01

    An oxide (NiO, CoO, NiCoO) antiferromagnetic exchange bias layer produced by ion beam sputtering of an oxide target in pure argon (Ar) sputtering gas, with no oxygen gas introduced into the system. Antiferromagnetic oxide layers are used, for example, in magnetoresistive readback heads to shift the hysteresis loops of ferromagnetic films away from the zero field axis. For example, NiO exchange bia layers have been fabricated using ion beam sputtering of an NiO target using Ar ions, with the substrate temperature at 200.degree. C., the ion beam voltage at 1000V and the beam current at 20 mA, with a deposition rate of about 0.2 .ANG./sec. The resulting NiO film was amorphous.

  13. Carbon nanotube heat-exchange systems

    DOE Patents [OSTI]

    Hendricks, Terry Joseph; Heben, Michael J.

    2008-11-11

    A carbon nanotube heat-exchange system (10) and method for producing the same. One embodiment of the carbon nanotube heat-exchange system (10) comprises a microchannel structure (24) having an inlet end (30) and an outlet end (32), the inlet end (30) providing a cooling fluid into the microchannel structure (24) and the outlet end (32) discharging the cooling fluid from the microchannel structure (24). At least one flow path (28) is defined in the microchannel structure (24), fluidically connecting the inlet end (30) to the outlet end (32) of the microchannel structure (24). A carbon nanotube structure (26) is provided in thermal contact with the microchannel structure (24), the carbon nanotube structure (26) receiving heat from the cooling fluid in the microchannel structure (24) and dissipating the heat into an external medium (19).

  14. Energy Exchange 2015 Agenda at a Glance

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Internet of Things Water Efficient Operations Economics of Financed Projects District Heating and Cooling: Optimized Comfort Data Center Energy Management Strategies...

  15. Miniaturized Air to Refrigerant Heat Exchangers | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... References: Westphalen, D., Roth, K. W. and Brodrick, J. (2006) 'Heat transfer enhancement', ASHRAE Journal, 48(4), 68-71. Contacts DOE Technology Manager: Tony Bouza Performer: ...

  16. Exchange Visitors Program | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    in the U.S. The Office of Travel Management provides assistance to DOE Program ... International Visitor Leadership Program - brings participants to the United States from ...

  17. Cesium-specific phenolic ion exchange resin

    DOE Patents [OSTI]

    Bibler, J.P.; Wallace, R.M.

    1995-08-15

    A phenolic, cesium-specific, cation exchange resin is prepared by neutralizing resorcinol with potassium hydroxide, condensing/polymerizing the resulting intermediate with formaldehyde, heat-curing the resulting polymer to effect cross-linking and grinding it to desired particle size for use. This resin will selectively and efficiently adsorb cesium ions in the presence of a high concentration of sodium ions with a low carbon to cesium ratio. 2 figs.

  18. Cesium-specific phenolic ion exchange resin

    DOE Patents [OSTI]

    Bibler, Jane P.; Wallace, Richard M.

    1995-01-01

    A phenolic, cesium-specific, cation exchange resin is prepared by neutralizing resorcinol with potassium hydroxide, condensing/polymerizing the resulting intermediate with formaldehyde, heat-curing the resulting polymer to effect cross-linking and grinding it to desired particle size for use. This resin will selectively and efficiently adsorb cesium ions in the presence of a high concentration of sodium ions with a low carbon to cesium ratio.

  19. Catalysis using hydrous metal oxide ion exchangers

    DOE Patents [OSTI]

    Dosch, R.G.; Stephens, H.P.; Stohl, F.V.

    1983-07-21

    In a process which is catalyzed by a catalyst comprising an active metal on a carrier, said metal being active as a catalyst for the process, an improvement is provided wherein the catalyst is a hydrous, alkali metal or alkaline earth metal titanate, zirconate, niobate or tantalate wherein alkali or alkaline earth metal cations have been exchanged with a catalytically effective amount of cations of said metal.

  20. Optimizing PT Arun LNG main heat exchanger

    SciTech Connect (OSTI)

    Irawan, B.

    1995-12-01

    The capacity of a LNG liquefaction unit has been increased by upgrading the refrigeration system, without making changes to the main heat exchanger (MHE). It is interesting, that after all modifications were completed, a higher refrigerant circulation alone could not increase LNG production. However, by optimizing the refrigerant component ratio, the UA of the MHE increased and LNG production improved. This technical evaluation will provide recommendations and show how the evaluation of the internal temperature profile helped optimize the MHE operating conditions.

  1. Catalysis using hydrous metal oxide ion exchanges

    DOE Patents [OSTI]

    Dosch, Robert G.; Stephens, Howard P.; Stohl, Frances V.

    1985-01-01

    In a process which is catalyzed by a catalyst comprising an active metal on a carrier, said metal being active as a catalyst for the process, an improvement is provided wherein the catalyst is a hydrous, alkali metal or alkaline earth metal titanate, zirconate, niobate or tantalate wherein alkali or alkaline earth metal cations have been exchanged with a catalytically effective amount of cations of said metal.

  2. Separation of uranium isotopes by chemical exchange

    DOE Patents [OSTI]

    Ogle, P.R. Jr.

    1974-02-26

    A chemical exchange method is provided for separating /sup 235/U from / sup 238/U comprising contacting a first phase containing UF/sub 6/ with a second phase containing a compound selected from the group consisting of NOUF/sub 6/, NOUF/sub 7/, and NO/sub 2/UF/sub 7/ until the U Fsub 6/ in the first phase becomes enriched in the /sup 235/U isotope. (Official Gazette)

  3. Conduit - Scientific Data Exchange Library for HPC Simulations

    Energy Science and Technology Software Center (OSTI)

    2014-10-22

    Conduit is a C++ software library that helps software developers with data representation and data exchange in scientific simulations

  4. Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Network: Lessons Learned: Peer Exchange Calls Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls Better Buildings Residential Network: Lessons Learned: Peer Exchange Calls, from the U.S. Department of Energy. PDF icon Lessons Learned: Peer Exchange Calls More Documents & Publications Stakeholder Mapping: Learn How to Identify Leaders, Target Audiences, and Gaps in Your Outreach Cost-Effective, Customer-Focused, and Contractor-Focused Data

  5. Porous solid ion exchange wafer for immobilizing biomolecules

    DOE Patents [OSTI]

    Arora, Michelle B.; Hestekin, Jamie A.; Lin, YuPo J.; St. Martin, Edward J.; Snyder, Seth W.

    2007-12-11

    A porous solid ion exchange wafer having a combination of a biomolecule capture-resin and an ion-exchange resin forming a charged capture resin within said wafer. Also disclosed is a porous solid ion exchange wafer having a combination of a biomolecule capture-resin and an ion-exchange resin forming a charged capture resin within said wafer containing a biomolecule with a tag. A separate bioreactor is also disclosed incorporating the wafer described above.

  6. Quality Assurance Exchange Setpebmer 2007, Volume 3 Issue 3

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange Setpebmer 2007, Volume 3 Issue 3 U.S. Department of Energy Office of Corporate Safety Analysis

  7. Quality Assurance Exchange August 2007, Volume 3 Issue 2

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange August 2007, Volume 3 Issue 2 U.S. Department of Energy Office of Corporate Safety Analysis

  8. QUALITY ASSURANCE EXCHANGE July 2005 Volume 1 Issue 1

    Broader source: Energy.gov [DOE]

    QUALITY ASSURANCE EXCHANGE July 2005 Volume 1 Issue 1 US Department of Energy, Office of Quality Assurance Programs (EH-31)

  9. Peer Exchange Calls Inspire New Lessons Learned Greatest Hits | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Peer Exchange Calls Inspire New Lessons Learned Greatest Hits Peer Exchange Calls Inspire New Lessons Learned Greatest Hits Photo of a group of people sitting at a table having a meeting. A new "Lessons Learned: Peer Exchange Calls" resource summarizes top takeaways shared by Better Buildings Residential Network members, from tips to collaborating with utilities to cost-effective rebate models. The Residential Network hosts a series of Peer Exchange Calls for members to

  10. Quality Assurance Exchange January 2007, Volume 3 Issue 1

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange January 2007, Volume 3 Issue 1 U.S. Department of Energy Office of Corporate Safety Analysis

  11. An Observation of a Transverse to Longitudinal Emittance Exchange...

    Office of Scientific and Technical Information (OSTI)

    longitudinal emittance exchange (epsilonsub xsub in Leftrightarrow epsilonsub zsub out and epsilonsub zsub in Leftrightarrow epsilonsub xsub out) has...

  12. Heat exchanger containing a component capable of discontinuous movement

    DOE Patents [OSTI]

    Wilson, David Gordon

    2001-04-17

    Regenerative heat exchangers are described for transferring heat between hot and cold fluids. The heat exchangers have seal-leakage rates significantly less than those of conventional regenerative heat exchangers because the matrix is discontinuously moved and is releasably sealed while in a stationary position. Both rotary and modular heat exchangers are described. Also described are methods for transferring heat between a hot and cold fluid using the discontinuous movement of matrices.

  13. Heat exchanger containing a component capable of discontinuous movement

    DOE Patents [OSTI]

    Wilson, David G.

    1993-01-01

    Regenerative heat exchangers are described for transferring heat between hot and cold fluids. The heat exchangers have seal-leakage rates significantly less than those of conventional regenerative heat exchangers because the matrix is discontinuously moved and is releasably sealed while in a stationary position. Both rotary and modular heat exchangers are described. Also described are methods for transferring heat between a hot and cold fluid using the discontinuous movement of matrices.

  14. Heat exchanger containing a component capable of discontinuous movement

    DOE Patents [OSTI]

    Wilson, D.G.

    1993-11-09

    Regenerative heat exchangers are described for transferring heat between hot and cold fluids. The heat exchangers have seal-leakage rates significantly less than those of conventional regenerative heat exchangers because the matrix is discontinuously moved and is releasably sealed while in a stationary position. Both rotary and modular heat exchangers are described. Also described are methods for transferring heat between a hot and cold fluid using the discontinuous movement of matrices. 11 figures.

  15. Heat exchanger containing a component capable of discontinuous movement

    DOE Patents [OSTI]

    Wilson, David Gordon

    2002-01-01

    Regenerative heat exchangers are described for transferring heat between hot and cold fluids. The heat exchangers have seal-leakage rates significantly less than those of conventional regenerative heat exchangers because the matrix is discontinuously moved and is releasably sealed while in a stationary position. Both rotary and modular heat exchangers are described. Also described are methods for transferring heat between a hot and cold fluid using the discontinuous movement of matrices.

  16. Better Buildings Workforce Peer Exchange Call: Kick-off

    Broader source: Energy.gov [DOE]

    Better Buildings Workforce Peer Exchange Call: Kick-off Call Slides and Discussion Summary. April 21, 2011.

  17. Preliminary SP-100/Stirling heat exchanger designs

    SciTech Connect (OSTI)

    Schmitz, P.; Tower, L.; Dawson, R.; Blue, B.; Dunn, P.

    1994-09-01

    Analytic modeling of several heat exchanger concepts to couple the SP-100 nuclear reactor lithium loop and the Space Stirling Power Convertor (SSPC) was performed. Four 25 kWe SSPC`s are used to produce the required 100 kW of electrical power. This design work focused on the interface between a single SSPC and the primary lithium loop. Manifolding to separate and collect the four channel flow was not modeled. This work modeled two separate types of heat exchanger interfaces (conductive coupling and radiative coupling) to explore their relative advantages and disadvantages. The minimum mass design of the conductively coupled concepts was 18 kg or 0.73 kg/kWe for a single 25 kWe convertor. The minimum mass radiatively coupled concept was 41 kg or 1.64 kg/kWe. The direct conduction heat exchanger provides a lighter weight system because of its ability to operate the Stirling convertor evaporator at higher heat fluxes than those attainable by the radiatively coupled systems. Additionally the conductively coupled concepts had relatively small volumes and provide potentially simpler assembly. Their disadvantages were the tight tolerances and material joining problems associated with this refractory to superalloy interface. The advantages of the radiatively coupled designs were the minimal material interface problems.

  18. Experience with borehole heat exchangers in Switzerland

    SciTech Connect (OSTI)

    Rybach, L.; Hopkirk, R.J.

    1994-03-01

    Switzerland undertakes, like many other countries, great efforts to reduce its dependence from foreign fossil fuels. Indigenous sources of energy like the heat content of the subsurface are especially in focus, also due to environmental concern (greenhouse effect due to CO{sub 2} emissions). The most popular and technically advanced space heating system to use ground heat is the borehole heat exchanger (BHE). Shallow, coaxial or U-shaped BHEs are installed in 30-50 m deep, backfilled boreholes to extract, by closed-fluid circulation, heat from the ground. They feed the cold (evaporator) (e.g. floor panel) system to heat usually a single dwelling house. The energy supply for the heat exchanger comes from several sources: the vertical geothermal flux itself, the import of energy horizontally by conduction, advective transport with groundwater if present, and the compensating effect of heat exchange between the ground surface and the atmosphere. Multiple BHEs are installed for larger units like community buildings, etc. Since 1980, almost 5,000 such systems, using about 10,000 BHEs with a total length of more than 700,000 m have been installed in Switzerland. The BHE can be upscaled in order to be installed in otherwise abandoned deep boreholes (e.g., in {open_quotes}dry{close_quotes} geothermal or hydrocarbon exploratory holes). Experimental as well as theoretical studies have been pursued in Switzerland in the last 10 years to establish a sound technical and energy economics base for shallow and deep BHE systems.

  19. Better Buildings Neighborhood Program Workforce Peer Exchange Call:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contractor Pricing | Department of Energy Neighborhood Program Workforce Peer Exchange Call: Contractor Pricing Better Buildings Neighborhood Program Workforce Peer Exchange Call: Contractor Pricing Better Buildings Neighborhood Program Workforce Peer Exchange Call: Contractor Pricing, call slides and discussion summary, September 27, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Working Capital for Contractors Strategies for Aligning Program Demand with

  20. NREL: DOE Technology Performance Exchange - 2015 Peer Review | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy NREL: DOE Technology Performance Exchange - 2015 Peer Review NREL: DOE Technology Performance Exchange - 2015 Peer Review Presenter: Daniel Studer, NREL View the Presentation PDF icon NREL: DOE Technology Performance Exchange More Documents & Publications What is OpenStudio? OpenStudio OpenStudio Core Development and Deployment Support - 2014 BTO Peer Review OpenStudio - 2013 Peer Review

  1. Building Integrated Heat and Moisture Exchange | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Integrated Heat and Moisture Exchange Building Integrated Heat and Moisture Exchange Addthis 1 of 2 Building-integrated heat and moisture exchanger, the AirFlow(tm) Panel, installed for evaluation at Lawrence Berkeley National Lab. Image: Architectural Applications 2 of 2 A schematic of the AirFlow(tm) Panel developed by Architectural Applications. Image: Architectural Applications

  2. Bibliographic Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and more from varied resources and databases to organize references, keep notes to stay ahead of the game. Questions? 505-667-5809 Email Bibliographic management tools allow...

  3. acquisition management

    National Nuclear Security Administration (NNSA)

    the science, technology, and engineering base; and,

  4. Continue NNSA management reforms.


    • Our Values:<...

    • Energy Management

      Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

      Energy Management Utilize energy efficiency to improve your industrial customer's business performance without the cost of major capital improvements. Energy efficiency is not...

    • project management

      National Nuclear Security Administration (NNSA)

      %2A en Project Management and Systems Support http:nnsa.energy.govaboutusouroperationsapmprojectmanagementandsystemssupport

    • Quality Management

      Broader source: Energy.gov [DOE]

      The Office of Quality Management, within the Office of Health, Safety and Security develops policies and procedures to ensure the classification and control of information is effective and...

    • Position Management

      Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

      1992-06-23

      The order prescribes the policies, responsibilities, and procedures for position management within (DOE). Canceled by DOE N 1321.140. Cancels DOE 3510.1

    • Management Overview

      Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

      Management & Administration Forms (0000-1999) Management & Administration Forms (0000-1999) DOE F 206.1 (pdf) Privacy Impact Assessment (PIA) DOE F 206.4 (fillable pdf) Information Sheet for Sponsorship of HSPD-12 Credential DOE F 241.2 (fillable pdf) Notice of Energy RD&D Project DOE F 241.4 (fillable pdf) Announcement of Computer Software DOE F 241.5 (pdf) Information Collection Clearance Manager Appointment DOE F 242.1 (fillable pdf) Forms Manager Designation DOE F 243.2 (fillable

    • project management

      National Nuclear Security Administration (NNSA)

      3%2A en Project Management and Systems Support http:www.nnsa.energy.govaboutusouroperationsapmprojectmanagementandsystemssupport

    • International technology exchange in support of the Defense Waste Processing Facility wasteform production

      SciTech Connect (OSTI)

      Kitchen, B.G.

      1989-08-23

      The nearly completed Defense Waste Processing Facility (DWPF) is a Department of Energy (DOE) facility at the Savannah River Site that is designed to immobilize defense high level radioactive waste (HLW) by vitrification in borosilicate glass and containment in stainless steel canisters suitable for storage in the future DOE HLW repository. The DWPF is expected to start cold operation later this year (1990), and will be the first full scale vitrification facility operating in the United States, and the largest in the world. The DOE has been coordinating technology transfer and exchange on issues relating to HLW treatment and disposal through bi-lateral agreements with several nations. For the nearly fifteen years of the vitrification program at Savannah River Laboratory, over two hundred exchanges have been conducted with a dozen international agencies involving about five-hundred foreign national specialists. These international exchanges have been beneficial to the DOE`s waste management efforts through confirmation of the choice of the waste form, enhanced understanding of melter operating phenomena, support for paths forward in political/regulatory arenas, confirmation of costs for waste form compliance programs, and establishing the need for enhancements of melter facility designs. This paper will compare designs and schedules of the international vitrification programs, and will discuss technical areas where the exchanges have provided data that have confirmed and aided US research and development efforts, impacted the design of the DWPF and guided the planning for regulatory interaction and product acceptance.

    • International technology exchange in support of the Defense Waste Processing Facility wasteform production

      SciTech Connect (OSTI)

      Kitchen, B.G.

      1989-08-23

      The nearly completed Defense Waste Processing Facility (DWPF) is a Department of Energy (DOE) facility at the Savannah River Site that is designed to immobilize defense high level radioactive waste (HLW) by vitrification in borosilicate glass and containment in stainless steel canisters suitable for storage in the future DOE HLW repository. The DWPF is expected to start cold operation later this year (1990), and will be the first full scale vitrification facility operating in the United States, and the largest in the world. The DOE has been coordinating technology transfer and exchange on issues relating to HLW treatment and disposal through bi-lateral agreements with several nations. For the nearly fifteen years of the vitrification program at Savannah River Laboratory, over two hundred exchanges have been conducted with a dozen international agencies involving about five-hundred foreign national specialists. These international exchanges have been beneficial to the DOE's waste management efforts through confirmation of the choice of the waste form, enhanced understanding of melter operating phenomena, support for paths forward in political/regulatory arenas, confirmation of costs for waste form compliance programs, and establishing the need for enhancements of melter facility designs. This paper will compare designs and schedules of the international vitrification programs, and will discuss technical areas where the exchanges have provided data that have confirmed and aided US research and development efforts, impacted the design of the DWPF and guided the planning for regulatory interaction and product acceptance.

    • Personnel Exchange Program | The Ames Laboratory

      Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

      Personal Property Policy Personal Property Policy Personal Property Policy The DOE Personal Property Policy Division is responsible for development and oversight of the Department's personal property management program; establishes policies, standards, and guidance in accordance with applicable laws, regulations and sound personal property management practices and standards. Additionally MA-653: Advises and provides staff assistance to headquarters and field organizations that perform personal

    • Records Management

      Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

      Records Management (RM) refers to the systematic identification, creation, capture, organization, maintenance, retrieval, protection, storage and disposition of records, regardless of media, created or received in the transaction of Sandia's scientific investigations and long-term repository performance calculations within a regulatory context. Our disciplined approach to records management makes many things possible: assurance that regulatory requirements are met; reduced risk of expensive

    • Industrial energy management and utilization

      SciTech Connect (OSTI)

      Witte, L.C.; Schmidt, P.S.; Brown, D.

      1986-01-01

      This text covers the principles of industrial energy conservation and energy conservation applications, with emphasis on the energy-intensive industries. Topics covered include energy consumption, alternative energy sources, elements of energy audits, economic investment analysis, management of energy conservation programs, boilers and fired heaters, steam and condensate systems, classification and fouling of heat exchangers, heat transfer augmentation, waste heat sources, heat recovery equipment, properties and characteristics of insulation, energy conservation in industrial buildings, cogeneration, power circuit components and energy conversion devices, electrical energy conservation. A review of the fundamentals of fluid mechanics, heat transfer, and thermodynamics, as well as examples, problems, and case studies from specific industries are included.

    • Operations managers conference: summary of proceedings

      SciTech Connect (OSTI)

      None,

      1982-02-01

      The Association for Energy Systems, Operations, and Programming (AESOP) was created to provide Department of Energy (DOE) and DOE-contractor management personnel with a means for acquiring and exchanging information concerning effective management of ADP resources and personnel as well as a variety of computer applications. AESOP serves as a forum for the data processing management of more than 50 DOE offices and private corporations under contract to DOE. AESOP Operations Managers Conferences are held approximately every 18 months. Conference topics include personnel problems, training situations, reorganization plans, and work scheduling. Security and other issues affecting ADP procedures and personnel are also often addressed. Papers published in this volume of the proceedings have been summarized from speeches and discussions that were presented at the seventh AESOP Operations Managers Conference.

    • Minutes of the 28th Annual Plutonium Sample Exchange Meeting. Part II: metal sample exchange

      SciTech Connect (OSTI)

      Not Available

      1984-01-01

      Contents of this publication include the following list of participating laboratories; agenda; attendees; minutes of October 25 and 26 meeting; and handout materials supplied by speakers. The handout materials cover the following: statistics and reporting; plutonium - chemical assay 100% minus impurities; americium neptunium, uranium, carbon and iron data; emission spectroscopy data; plutonium metal sample exchange; the calorimetry sample exchange; chlorine determination in plutonium metal using phyrohydrolysis; spectrophotometric determination of 238-plutonium in oxide; plutonium measurement capabilities at the Savannah River Plant; and robotics in radiochemical laboratory.

    • Heat exchanger with auxiliary cooling system

      DOE Patents [OSTI]

      Coleman, John H. (Salem Township, Westmoreland County, PA)

      1980-01-01

      A heat exchanger with an auxiliary cooling system capable of cooling a nuclear reactor should the normal cooling mechanism become inoperable. A cooling coil is disposed around vertical heat transfer tubes that carry secondary coolant therethrough and is located in a downward flow of primary coolant that passes in heat transfer relationship with both the cooling coil and the vertical heat transfer tubes. A third coolant is pumped through the cooling coil which absorbs heat from the primary coolant which increases the downward flow of the primary coolant thereby increasing the natural circulation of the primary coolant through the nuclear reactor.

    • Electricity exchanges across international borders - 1983

      SciTech Connect (OSTI)

      Not Available

      1984-09-01

      This report summarizes the electricity exchanges between the US and Mexico and Canada during calendar year 1983. The construction, operation and maintenance of any electric transmission facility which crosses an international border of the United States requires a Presidential Permit. These permits have been granted by the Department of Energy (DOE) since its formation in 1977. Between 1953 and 1977, these permits were issued by the former Federal Power Commission. Prior to 1953, they were issued by the President of the United States. Presidential Permits require that an annual report be filed by the permit holder detailing all transactions with the foreign country.

    • Miniaturized Air-to-Refrigerant Heat Exchangers

      Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

      Miniaturized Air-to-Refrigerant Heat Exchangers 2015 Building Technologies Office Peer Review Reinhard Radermacher raderm@umd.edu 20%+ Better University of Maryland College Park Project Summary Timeline: Start date: 3/1/2013 Planned end date: 2/29/2016 Key Milestones 1. Design optimization, 3/30/14 2. Fabrication/testing, 1kW prototype, 1/30/2015 3. Fabrication/testing, 10kW prototype, 9/30/2015 Budget: Total Budget: $1500K Total UMD: $1050K Total DOE $ to date for UMD: $881K Total future DOE $

    • Heat exchanger for a Stirling engine

      SciTech Connect (OSTI)

      Fujiwara, M.; Nomaguchi, T.; Kazumoto, Y.; Tsuchino, K.; Kawajiri, K.; Hisamori, Y.

      1987-05-05

      A heat exchanger is described for a Stirling engine comprising: a domed cylinder having a domed portion and a cylindrical portion. The domed cylinder serves as a high-temperature cylinder and a regenerator housing of the Stirling engine; a cylindrical inner liner which is coaxially disposed inside the domed cylinder and which divides the inside of the domed cylinder into an expansion space inside of the inner liner and a regenerator space between the outer surface of the inner liner and the inner surface of the cylindrical portion of the domed cylinder.

  1. Acoustic resonance in heat exchanger tube bundles

    SciTech Connect (OSTI)

    Blevins, R.D. )

    1994-02-01

    A series of experiments has been made on aeroacoustic tones produced by flow over tubes in a duct. The sound is characterized by the onset of a loud and persistent acoustic resonance. The acoustic resonance occurs at the frequency of the acoustic modes. The magnitude and extent of the resonance are functions of tube pattern and tube pitch. The sound levels increase in proportion with Mach number, dynamic head and pressure drop. A design procedure for predicting the magnitude of the sound within the tube array is presented. Methods of resonance avoidance are illustrated. An example is made for a large petrochemical heat exchanger.

  2. Biodegradation of ion-exchange media

    SciTech Connect (OSTI)

    Bowerman, B.S.; Clinton, J.H.; Cowdery, S.R.

    1988-01-01

    The purpose of this study was to investigate further the potential for ion-exchange media (resin beads or powdered filter media) to support biological growth. A mixed microbial culture was grown from resin wastes obtained from the BNL HFBR by mixing the resin with a nutrient salt solution containing peptone and yeast extract. Bacterial and fungal growths appeared in the solution and on the resins after 7 to 10 days incubation at 337)degree)C. The mixed microbial cultures were used to inoculate several resin types, both irradiated and unirradiated. 12 refs., 5 tabs.

  3. Advanced Rotating Heat Exchangers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    D., Roth, K. W. and Brodrick,J. (2006) 'Heat transfer enhancement', ASHRAE Journal,48(4), 68-71.) Contacts DOE Technology Manager: Tony Bouza Performer: Ed Vineyard,...

  4. Advanced Rotating Heat Exchangers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    D., Roth, K. W. and Brodrick,J. (2006) 'Heat transfer enhancement', ASHRAE Journal,48(4), 68-71.) Contacts DOE Technology Manager: Tony Bouza Performer: Omar Abdelaziz, ...

  5. Multicomponent liquid ion exchange with chabazite zeolites

    SciTech Connect (OSTI)

    Robinson, S.M.; Arnold, W.D. Jr.; Byers, C.W.

    1993-10-01

    In spite of the increasing commercial use of zeolites for binary and multicomponent sorption, the understanding of the basic mass-transfer processes associated with multicomponent zeolite ion-exchange systems is quite limited. This study was undertaken to evaluate Na-Ca-Mg-Cs-Sr ion exchange from an aqueous solution using a chabazite zeolite. Mass-transfer coefficients and equilibrium equations were determined from experimental batch-reactor data for single and multicomponent systems. The Langmuir isotherm was used to represent the equilibrium relationship for binary systems, and a modified Dubinin-Polyani model was used for the multicomponent systems. The experimental data indicate that diffusion through the microporous zeolite crystals is the primary diffusional resistance. Macropore diffusion also significantly contributes to the mass-transfer resistance. Various mass-transfer models were compared to the experimental data to determine mass-transfer coefficients. Effective diffusivities were obtained which accurately predicted experimental data using a variety of models. Only the model which accounts for micropore and macropore diffusion occurring in series accurately predicted multicomponent data using single-component diffusivities. Liquid and surface diffusion both contribute to macropore diffusion. Surface and micropore diffusivities were determined to be concentration dependent.

  6. Muon Emittance Exchange with a Potato Slicer

    SciTech Connect (OSTI)

    Summers, D. J.; Hart, T. L.; Acosta, J. G.; Cremaldi, L. M.; Oliveros, S. J.; Perera, L. P.; Neuffer, D. V.

    2015-04-15

    We propose a novel scheme for final muon ionization cooling with quadrupole doublets followed by emittance exchange in vacuum to achieve the small beam sizes needed by a muon collider. A flat muon beam with a series of quadrupole doublet half cells appears to provide the strong focusing required for final cooling. Each quadrupole doublet has a low beta region occupied by a dense, low Z absorber. After final cooling, normalized transverse, longitudinal, and angular momentum emittances of 0.100, 2.5, and 0.200 mm-rad are exchanged into 0.025, 70, and 0.0 mm-rad. A skew quadrupole triplet transforms a round muon bunch with modest angular momentum into a flat bunch with no angular momentum. Thin electrostatic septa efficiently slice the flat bunch into 17 parts. The 17 bunches are interleaved into a 3.7 meter long train with RF deflector cavities. Snap bunch coalescence combines the muon bunch train longitudinally in a 21 GeV ring in 55 µs, one quarter of a synchrotron oscillation period. A linear long wavelength RF bucket gives each bunch a different energy causing the bunches to drift in the ring until they merge into one bunch and can be captured in a short wavelength RF bucket with a 13% muon decay loss and a packing fraction as high as 87 %.

  7. Conference Management

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-01-25

    The Order establishes requirements and responsibilities for managing conferences sponsored or co-sponsored by the Department of Energy, including the National Nuclear Security Administration. Cancels DOE O 110.3. Canceled by DOE N 251.97.

  8. Management Reminders

    Broader source: Energy.gov [DOE]

    This document is normally shared by the HQ Program Manager a week prior to the scheduled mediation and is intented to serve as a reminder of the pertinent aspects of the mediation process.

  9. PROJECT MANAGEMENT PLANS Project Management Plans

    Office of Environmental Management (EM)

    MANAGEMENT PLANS Project Management Plans Overview Project Management Plan Suggested Outline Subjects Crosswalk between the Suggested PMP Outline Subjects and a Listing ...

  10. Summary - Environmental Management Waste Management Facility...

    Office of Environmental Management (EM)

    Waste Management Facility (EMWMF) at Oak Ridge, TN Why DOE-EM Did This Review The Environmental Management Waste Management Facility (EMWMF) is a land disposal facility for ...

  11. Health Education Specialist/Project Manager Oak Ridge Institute for Science and Education

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    inFormation about the CHRIS faith-based approach to addressing minority health disparities in your community, please contact: rose marie Womble, mSSW Health Education Specialist/Project Manager Oak Ridge Institute for Science and Education P.O. Box 117, MS-37 Oak Ridge, TN 37831-0117 E-mail: rose.womble@orise.orau.gov Telephone: 865.576.6256 Fax: 865.241.3851 "The beauty of the CHRIS program is that it's tailored to provide information that addresses a wide array of health issues within a

  12. Managements Discussion and Analysis

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    regulatory assets are included in IOU exchange benefits and current assets in the Balance Sheets. Additional Information For general information about BPA, refer to BPA's...

  13. Emittance and Phase Space Exchange for Advanced Beam Manipulation and

    Office of Scientific and Technical Information (OSTI)

    Diagnostics (Journal Article) | SciTech Connect Phase Space Exchange for Advanced Beam Manipulation and Diagnostics Citation Details In-Document Search Title: Emittance and Phase Space Exchange for Advanced Beam Manipulation and Diagnostics Alternative chicane-type beam lines are proposed for exact emittance exchange between transverse phase space (x,x') and longitudinal phase space (z,{delta}), where x is the transverse position, x' is the transverse divergence, and z and {delta} are

  14. Three Elements to Remember When Establishing Your Microsoft Exchange Server

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - Nercenergy Three Elements to Remember When Establishing Your Microsoft Exchange Server Microsoft Exchange Server is among the world's most popular email messaging and collaborative systems. Due to its advanced-level structuring, yet user-friendly interface, it's utilized by businesses and corporations of all sizes. While you may be familiar with Exchange, and perhaps you even utilize this service for your email communications, there are several elements you must remember while you

  15. Better Buildings Workforce Peer Exchange Quality Assurance Strategies |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Quality Assurance Strategies Better Buildings Workforce Peer Exchange Quality Assurance Strategies Better Buildings Workforce Peer Exchange Quality Assurance Strategies, call slides and discussion summary, November 17, 2011. PDF icon Call Slides and Discussion Summary More Documents & Publications Better Buildings Workforce Peer Exchange Call: Kick-off Recruiting a Local and Diverse Workforce and Mitigating Barriers to Entry Better Buildings Neighborhood Program

  16. Heat exchanger and water tank arrangement for passive cooling system

    DOE Patents [OSTI]

    Gillett, James E. (Greensburg, PA); Johnson, F. Thomas (Baldwin Boro, PA); Orr, Richard S. (Pittsburgh, PA); Schulz, Terry L. (Murrysville Boro, PA)

    1993-01-01

    A water storage tank in the coolant water loop of a nuclear reactor contains a tubular heat exchanger. The heat exchanger has tubesheets mounted to the tank connections so that the tubesheets and tubes may be readily inspected and repaired. Preferably, the tubes extend from the tubesheets on a square pitch and then on a rectangular pitch therebetween. Also, the heat exchanger is supported by a frame so that the tank wall is not required to support all of its weight.

  17. What Certificates Should My Microsoft Exchange Server Have? - Nercenergy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    What Certificates Should My Microsoft Exchange Server Have? Much like any other network application, in order to secure the functionality and safety of Microsoft Exchange Servers, it's essential to adopt specific certificates. Due to the literally thousands, if not millions, of security threats bombarding your Exchange Server every day, these certificates ensure users have a safe messaging experience while simultaneously safeguarding your data and sensitive information from being intercepted.

  18. 2012 National Trainers' Exchange for Department of Energy Safety and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Health Trainers | Department of Energy 2012 National Trainers' Exchange for Department of Energy Safety and Health Trainers 2012 National Trainers' Exchange for Department of Energy Safety and Health Trainers Workshop Dates: May 7-8, 2012 The National Institute of Environmental Health Sciences Worker Education and Training Program (NIEHS WETP) hosted the first National Trainers' Exchange for Department of Energy (DOE) safety and health trainers on May 7-8, 2012 in Knoxville, TN. Over 100

  19. Self-defrosting recuperative air-to-air heat exchanger

    DOE Patents [OSTI]

    Drake, Richard L.

    1993-01-01

    A heat exchanger includes a stationary spirally or concentrically wound heat exchanger core with rotating baffles on upper and lower ends thereof. The rotating baffles include rotating inlets and outlets which are in communication with respective fixed inlets and outlets via annuli. The rotation of the baffles causes a concurrent rotation of the temperature distribution within the stationary exchanger core, thereby preventing frost build-up in some applications and preventing the formation of hot spots in other applications.

  20. Information systems to enhance technology exchange

    SciTech Connect (OSTI)

    Hunter, T.; Harrington, M.; Harlan, C.; Drozhko, E.

    1994-03-01

    A fundamental part of international technology exchange is the compilation and dissemination of information. Worldwide environmental problems and technology development activities form the basis for important opportunities across the world and especially for those in the former Soviet Union. Recently, important agreements have been reached among Russian institutes engaged in environmental work and the US Department of Energy (DOE) and its national laboratories. These agreements will allow a systematic compilation of information on environmental contamination problems in Russia that can be included in DOE`s environmental information systems. A computer hardware and software system has been loaned to Russian scientists by the DOE for the sharing of environmental software and data, while establishing standards for future information networks.

  1. Poly(phenylene)-based anion exchange membrane

    DOE Patents [OSTI]

    Hibbs, Michael; Cornelius, Christopher J.; Fujimoto, Cy H.

    2011-02-15

    A poly(phenylene) compound of copolymers that can be prepared with either random or multiblock structures where a first polymer has a repeat unit with a structure of four sequentially connected phenyl rings with a total of 2 pendant phenyl groups and 4 pendant tolyl groups and the second polymer has a repeat unit with a structure of four sequentially connected phenyl rings with a total of 6 pendant phenyl groups. The second polymer has chemical groups attached to some of the pendant phenyl groups selected from CH.sub.3, CH.sub.2Br, and CH.sub.2N(CH.sub.3).sub.3Br groups. When at least one group is CH.sub.2N(CH.sub.3).sub.3Br, the material functions as an anion exchange membrane.

  2. Three Companies Awarded Contracts for Royalty-in-Kind Exchanges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (DOE) today awarded contracts to Shell Trading Company, Sunoco Logistics, and BP North ... Related Articles SPR Awards Exchange Contract to Shell Trading Contracts Awarded for ...

  3. Quality Assurance Exchange June 2006, Volume 2 Issue 2

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange June 2006, Volume 2 Issue 2 U.S. Department of Energy, Office of Corporate Performance Assessment Office of Quality Assurance Programs (EH-31)

  4. Renormalized anisotropic exchange for representing heat assisted magnetic recording media

    SciTech Connect (OSTI)

    Jiao, Yipeng; Liu, Zengyuan; Victora, R. H.

    2015-05-07

    Anisotropic exchange has been incorporated in a description of magnetic recording media near the Curie temperature, as would be found during heat assisted magnetic recording. The new parameters were found using a cost function that minimized the difference between atomistic properties and those of renormalized spin blocks. Interestingly, the anisotropic exchange description at 1.5 nm discretization yields very similar switching and magnetization behavior to that found at 1.2 nm (and below) discretization for the previous isotropic exchange. This suggests that the increased accuracy of anisotropic exchange may also reduce the computational cost during simulation.

  5. Peer Exchange Call on Financing and Revenue: Bond Funding

    Broader source: Energy.gov [DOE]

    Better Buildings Neighborhood Program Peer Exchange Call on Financing and Revenue: Bond Funding, call slides and discussion summary, March 28, 2013.

  6. Emittance and Phase Space Exchange (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Emittance and Phase Space Exchange Citation Details In-Document Search Title: Emittance and Phase Space Exchange Alternative chicane-type beam lines are proposed for exact emittance exchange between horizontal phase space (x; x{prime}) and longitudinal phase space (z; {delta}). Methods to achieve exact phase space exchanges, i.e. mapping x to z, x{prime} to {delta}, z to x and {delta} to x{prime} are suggested. Methods to mitigate the thick-lens effect of the transverse cavity on emittance

  7. An Observation of a Transverse to Longitudinal Emittance Exchange...

    Office of Scientific and Technical Information (OSTI)

    new beamline, including two magnetic dogleg channels and a TMsub 110 deflecting mode radio frequency cavity, were constructed for the emittance exchange experiment. The first...

  8. Lessons Learned: Peer Exchange Calls –- No. 3

    Broader source: Energy.gov [DOE]

    Lessons Learned: Peer Exchange Calls -– No. 3, as posted on the U.S. Department of Energy's Better Buildings Residential Network website.

  9. New Lessons Learned: Peer Exchange Call "Greatest Hits" Out Now...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    summarizes top marketing and outreach takeaways from Better Buildings Residential Network members during spring 2015 Peer Exchange Calls: Effective marketing of multifamily ...

  10. Program Sustainability Peer Exchange Call: Lender-based Revenues...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Program Sustainability Peer Exchange Call: Lender-based Revenues and Cost-savings Call ... 2142013 10 Future Program Sustainability Call Topics Program Sustainability ...

  11. Large Scale Geothermal Exchange System for Residential, Office...

    Open Energy Info (EERE)

    cool the project. To develop the geothermal exchange system, engineers at Madison-based Sustainable Engineering Group (SEG), collaborated with architects at Milwaukee-based...

  12. Quality Assurance Exchange March 2006, Volume 2 Issue 1

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange March 2006, Volume 2 Issue 1 U.S. Department of Energy, Office of Corporate Performance Assessment Office of Quality Assurance Programs (EH-31)

  13. Climate Exchange Plc formerly Chicago Environmental Plc | Open...

    Open Energy Info (EERE)

    search Name: Climate Exchange Plc (formerly Chicago Environmental Plc) Place: Isle of Man, United Kingdom Zip: IM1 1JE Product: An environmental investment company concentrating...

  14. 2012 National Trainers' Exchange for Department of Energy Safety...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The goals are to meet and share ideas about how to create more effective and empowering training, improve training skills, and exchange best practices and techniques. The NIEHS ...

  15. QUALITY ASSURANCE EXCHANGE December 2005 Volume 1 Issue 3

    Broader source: Energy.gov [DOE]

    QUALITY ASSURANCE EXCHANGE December 2005 Volume 1 Issue 3 U.S. Department of Energy, Office of Corporate Performance Assessment Office of Quality Assurance Programs (EH-31)

  16. December 15-16, 2015 - Technical Exchange Meeting - Richland...

    Broader source: Energy.gov (indexed) [DOE]

    Technical Exchange Meeting, December 15 and 16, 2015, Washington State Department of Ecology Offices, Richland, WA. Theme: Interpretation of Performance and Risk Assessment...

  17. The Energy Efficiency Exchange Website | Open Energy Information

    Open Energy Info (EERE)

    Equivalent URI: cleanenergysolutions.orgcontentenergy-efficiency-exchange-website Language: English Policies: "Deployment Programs,Financial Incentives" is not in the list of...

  18. Better Buildings Residential Network Peer Exchange Call Series...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... the PTEE Knowledge Exchange, a dynamic digital companion to the Road Shows featuring ... partners, multifamily housing, and marketing & outreach for all stages of program ...

  19. Better Buildings Low Income Peer Exchange CallFeaturing: Case...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BetterBuildings Low Income Peer Exchange Call Featuring: Case study on integration of ... and Roll Call * Case study on integration of income-qualified programs into ...

  20. Technical Information Exchange on Pyrolysis Oil: Potential for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Two-day agenda from the workshop: Technical Information Exchange on Pyrolysis Oil: Potential for a renewable heating oil substitution fuel in New England. PDF icon ...

  1. Remarkable Effect of Molecular Architecture on Chain Exchange...

    Office of Scientific and Technical Information (OSTI)

    Remarkable Effect of Molecular Architecture on Chain Exchange in Triblock Copolymer Micelles Citation Details In-Document Search Title: Remarkable Effect of Molecular Architecture...

  2. Quality Assurance Exchange Winter 2010 Volume 6 Issue 1

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange Winter 2010 Volume 6 Issue 1 U.S. Department of Energy Office of Quality Assurance Policy and Assistance

  3. New PerfSONAR Updates Showcased at 2015 Technology Exchange

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Exchange Updates include support for accelerating node deployment; reduction of NOC costs October 5, 2015 To propel the automation and deployment of large scale...

  4. Quality Assurance Exchange October 2008 Volume 4 Issue 2

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange October 2008 Volume 4 Issue 2 U.S. Department of Energy Office of Quality Assurance Policy and Assistance

  5. Energy Exchange: Recruiting, Developing, and Retaining the Next...

    Broader source: Energy.gov (indexed) [DOE]

    8:30AM to 10:00AM EDT Location: Phoenix Convention Center, Phoenix, Arizona Website: http:energy.goveerefempenergy-exchange Contact: Recruitment@doe.gov...

  6. Kinetics of oxygen surface exchange on epitaxial Ruddlesden-Popper...

    Office of Scientific and Technical Information (OSTI)

    Kinetics of oxygen surface exchange on epitaxial Ruddlesden-Popper phases and correlations to first-principles descriptors Citation Details In-Document Search This content will ...

  7. High-Performance Refrigerator Using Novel Rotating Heat Exchanger...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... 10. This thinning of the boundary layer significantly improves the air-side heat transfer coefficient of the rotating heat exchanger compared with traditional fan and fin devices. ...

  8. California Climate Exchange CaCX | Open Energy Information

    Open Energy Info (EERE)

    CaCX Jump to: navigation, search Name: California Climate Exchange (CaCX) Place: California Product: Aims to reducte CO2 emission in California. References: California Climate...

  9. Building-Integrated Heat & Moisture Exchange (STTR Phase 1 and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Current energy recovery ventilators (ERVs) offer low humidity exchange with high attendant pressure, resulting in low market penetration and limited impact. By integrating the two ...

  10. Liquid Metal Heat Exchanger for Geologic Deposits - Energy Innovation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liquid Metal Heat Exchanger for Geologic Deposits Oak Ridge National Laboratory Contact ... The apparatus provides more efficient heat transfer than existing technologies for ...

  11. Integrated Three-Dimensional Module Heat Exchange for Power Electronic...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Return to Search Integrated Three-Dimensional Module Heat Exchange for Power Electronics ... while at the same time enabling heat removal from the semiconductor devices ...

  12. Light weight and economical exhaust heat exchanger for waste...

    Broader source: Energy.gov (indexed) [DOE]

    A hybrid heat exchanger is designed to keep highly stressed materials around the working ... More Documents & Publications Dual Loop ParallelSeries Waste Heat Recovery System ...

  13. Advanced Heat/Mass Exchanger Technology for Geothermal and solar...

    Broader source: Energy.gov (indexed) [DOE]

    HeatMass Exchanger Technology for Geothermal and solar Renewable Energy Systems presentation at the April 2013 peer review meeting held in Denver, Colorado. PDF icon ...

  14. Quality Assurance Exchange August 2009, Volume 5 Issue 2

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange August 2009, Volume 5 Issue 2 U.S. Department of Energy Office of Quality Assurance Policy and Assistance

  15. Advanced heat exchanger development for molten salts

    SciTech Connect (OSTI)

    Sabharwall, Piyush; Clark, Denis; Glazoff, Michael; Zheng, Guiqiu; Sridharan, Kumar; Anderson, Mark

    2014-12-01

    This study addresses present work concerned with advanced heat exchanger development for molten salt in nuclear and non nuclear thermal systems. The molten salt systems discussed herein use alloys, such as Hastelloy N and 242, which show corrosion resistance to molten salt at nominal operating temperatures up to 700°C. These alloys were diffusion welded, and the corresponding information is presented. Test specimens were prepared for exposing diffusion welds to molten salt environments. Hastelloy N and 242 were found to be weldable by diffusion welding, with ultimate tensile strengths about 90% of base metal values. Both diffusion welds and sheet material in Hastelloy N were corrosion tested in?58 mol% KF and 42 mol% ZrF4 at 650, 700, and 850°C for 200, 500, and 1,000 hours. Corrosion rates found were similar between welded and nonwelded materials, typically <10 mils per year. For materials of construction, nickel and alloys with dense nickel coatings are effectively inert to corrosion in fluorides, but not so in chlorides. Hence, additional testing of selected alloys for resistance to intergranular corrosion is needed, as is a determination of corrosion rate as a function of contaminant type and alloy composition with respect to chromium and carbon to better define the optimal chromium and carbon composition, independent of galvanic or differential solubility effects. Also presented is the division of the nuclear reactor and high temperature components per ASME standards, along with design requirements for a subcritical Rankine power cycle heat exchanger that has to overcome pressure difference of about 17 MPa.

  16. Advanced heat exchanger development for molten salts

    SciTech Connect (OSTI)

    Sabharwall, Piyush; Clark, Denis; Glazoff, Michael; Zheng, Guiqiu; Sridharan, Kumar; Anderson, Mark

    2014-12-01

    This study addresses present work concerned with advanced heat exchanger development for molten salt in nuclear and non nuclear thermal systems. The molten salt systems discussed herein use alloys, such as Hastelloy N and 242, which show corrosion resistance to molten salt at nominal operating temperatures up to 700C. These alloys were diffusion welded, and the corresponding information is presented. Test specimens were prepared for exposing diffusion welds to molten salt environments. Hastelloy N and 242 were found to be weldable by diffusion welding, with ultimate tensile strengths about 90% of base metal values. Both diffusion welds and sheet material in Hastelloy N were corrosion tested in?58 mol% KF and 42 mol% ZrF4 at 650, 700, and 850C for 200, 500, and 1,000 hours. Corrosion rates found were similar between welded and nonwelded materials, typically <10 mils per year. For materials of construction, nickel and alloys with dense nickel coatings are effectively inert to corrosion in fluorides, but not so in chlorides. Hence, additional testing of selected alloys for resistance to intergranular corrosion is needed, as is a determination of corrosion rate as a function of contaminant type and alloy composition with respect to chromium and carbon to better define the optimal chromium and carbon composition, independent of galvanic or differential solubility effects. Also presented is the division of the nuclear reactor and high temperature components per ASME standards, along with design requirements for a subcritical Rankine power cycle heat exchanger that has to overcome pressure difference of about 17 MPa.

  17. Advanced heat exchanger development for molten salts

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Sabharwall, Piyush; Clark, Denis; Glazoff, Michael; Zheng, Guiqiu; Sridharan, Kumar; Anderson, Mark

    2014-12-01

    This study addresses present work concerned with advanced heat exchanger development for molten salt in nuclear and non nuclear thermal systems. The molten salt systems discussed herein use alloys, such as Hastelloy N and 242, which show corrosion resistance to molten salt at nominal operating temperatures up to 700°C. These alloys were diffusion welded, and the corresponding information is presented. Test specimens were prepared for exposing diffusion welds to molten salt environments. Hastelloy N and 242 were found to be weldable by diffusion welding, with ultimate tensile strengths about 90% of base metal values. Both diffusion welds and sheet materialmore » in Hastelloy N were corrosion tested in?58 mol% KF and 42 mol% ZrF4 at 650, 700, and 850°C for 200, 500, and 1,000 hours. Corrosion rates found were similar between welded and nonwelded materials, typically <10 mils per year. For materials of construction, nickel and alloys with dense nickel coatings are effectively inert to corrosion in fluorides, but not so in chlorides. Hence, additional testing of selected alloys for resistance to intergranular corrosion is needed, as is a determination of corrosion rate as a function of contaminant type and alloy composition with respect to chromium and carbon to better define the optimal chromium and carbon composition, independent of galvanic or differential solubility effects. Also presented is the division of the nuclear reactor and high temperature components per ASME standards, along with design requirements for a subcritical Rankine power cycle heat exchanger that has to overcome pressure difference of about 17 MPa.« less

  18. Data Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Data Management Data Management PDSF and IHEP, in Beijing, China, are the two main computing facitilies for the Daya Bay experiment with PDSF being used primarily by North American collaborators and IHEP by Asian collaborators. All raw data from the experimental facility is first transferred to IHEP and then transferred to PDSF. Data transfer rates of 5 to 10 MB/s result in up to about 500GB transferred daily. The tool used to transfer the data is called SPADE and has also been used at PDSF by

  19. Data Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Data Management Data Management Data Transfer STAR makes use of grid-based file transfers between PDSF and Brookhaven for two main purposes. The first is to transfer input/output files for simulation jobs submitted from Brookhaven to/from PDSF. The jobs come in through pdsfgrid.nersc.gov making use of the OSG software installation and the files are transferred through pdsfdtn1.nersc.gov to and from /project/projectdirs/osg. The second purpose is for bulk replication of microDST's from

  20. Better Buildings Neighborhood Program Financing Peer Exchange Call: PowerSaver Program Call Slides and Discussion Summary, September 22, 2011

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2, 2011 Better Buildings Neighborhood Program Financing Peer Exchange Call: PowerSaver Program Call Slides and Discussion Summary Agenda * Call Logistics and Attendance  What are participants interested in knowing about PowerSaver? * PowerSaver Overview and Implementation:  Patricia McBarron, Program Manager, PowerSaver Program, U.S. Department of Housing and Urban Development  Cynthia Adams, Executive Director, Local Energy Reliance Program (LEAP), Charlottesville, VA * Grant Project

  1. Exchange-Spring Magnets: Nanocomposite Exchange-Spring Magnets for Motor and Generator Applications

    SciTech Connect (OSTI)

    2012-01-01

    REACT Project: ANL will develop a cost-effective exchange-spring magnet to use in the electric motors of wind generators and EVs that uses no rare earth materials. This ANL exchange-spring magnet combines a hard magnetic outer shell with a soft magnetic inner corecoupling these together increases the performance (energy density and operating temperature). The hard and soft magnet composite particles would be created at the molecular level, followed by consolidation in a magnetic field. This process allows the particles to be oriented to maximize the magnetic properties of low-cost and abundant metals, eliminating the need for expensive imported rare earths. The ultimate goal of this project is to demonstrate this new type of magnet in a prototype electric motor.

  2. Ion exchange materials, method of forming ion exchange materials, and methods of treating liquids

    DOE Patents [OSTI]

    Wertsching, Alan K. (Idaho Falls, ID); Peterson, Eric S. (Idaho Falls, ID); Wey, John E. (Idaho Falls, ID)

    2007-12-25

    The invention includes an ion affinity material having an organic component which is sulfonated and which is chemically bonded to an inorganic substrate component. The invention includes a method of forming a metal binding material. A solid support material comprising surface oxide groups is provided and an organic component having at least one alkyl halide is covalently linked to at least some of the surface oxide groups to form a modified support material. The at least one alkyl halide is subsequently converted into an alkyl sulfonate. The invention further includes a method and system for extracting ions from a liquid. An ion exchange material having a sulfonated alkyl silane component covalently bonded to a metal oxide support material is provided and a liquid is exposed to the ion exchange material.

  3. TECHNICAL COMPARISON OF CANDIDATE ION EXCHANGE MEDIA FOR SMALL COLUMN ION EXCHANGE (SCIX) APPLICATIONS IN SUPPORT OF SUPPLEMENTAL LAW PRETREATMENT

    SciTech Connect (OSTI)

    RAMSEY AA; THORSON MR

    2010-12-28

    At-tank supplemental pretreatment including both filtration and small column ion exchange is currently under evaluation to facilitate salt waste retrieval and processing in the Hanford tank farms. Spherical resorcinol formaldehyde (sRF) resin is the baseline ion exchange resin for use in the Waste Treatment and Immobilization Plant (WTP). This document provides background and technical rationale to assist in determining whether spherical resorcinol formaldehyde (sRF) is also the appropriate ion exchange resin for supplemental LAW pretreatment processes and compares sRF with crystalline silicotitanate (CST) as potential supplemental pretreatment ion exchange media.

  4. Oracle Management Tool Suite

    Energy Science and Technology Software Center (OSTI)

    2007-06-01

    The Oracle Management Tool Suite is used to automatically manage Oracle based systems. This includes startup and shutdown of databases and application servers as well as backup, space management, workload management and log file management.

  5. Federal Energy Management Program Training | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Training Federal Energy Management Program Training Watch a short video to learn about the upcoming Federal Thought Leaders Roundtable First Thursday Seminar, which is scheduled for June 2, 2016. Read more Registration now open for the 2016 Energy Exchange, which is scheduled for August 9-11 in Providence, Rhode Island. Read more Complete sets of accredited courses for comprehensive instruction on timely energy-management topics. Read more This eTraining core course offers a concise introduction

  6. Universal Monitor (UM) for OTEC compact heat exchangers

    SciTech Connect (OSTI)

    Kuzay, T.M.

    1981-09-01

    Universal Monitor (UM), is a device-independent concept to measure, with precision, the initiation and progression of fouling in any given OTEC Compact Heat Exchanger model with or without the application of countermeasures. Design description and supporting analyses for the Universal Monitor for OTEC Compact Heat Exchangers are presented.

  7. Epoxy-crosslinked sulfonated poly (phenylene) copolymer proton exchange membranes

    DOE Patents [OSTI]

    Hibbs, Michael; Fujimoto, Cy H.; Norman, Kirsten; Hickner, Michael A.

    2010-10-19

    An epoxy-crosslinked sulfonated poly(phenylene) copolymer composition used as proton exchange membranes, methods of making the same, and their use as proton exchange membranes (PEM) in hydrogen fuel cells, direct methanol fuel cell, in electrode casting solutions and electrodes, and in sulfur dioxide electrolyzers. These improved membranes are tougher, have higher temperature capability, and lower SO.sub.2 crossover rates.

  8. Technology Solutions Case Study: Foundation Heat Exchanger, Oak Ridge, Tennessee

    SciTech Connect (OSTI)

    2014-03-01

    The foundation heat exchanger, developed by Oak Ridge National Laboratory, is a new concept for a cost-effective horizontal ground heat exchanger that can be connected to water-to-water or water-to-air heat pump systems for space conditioning as well as domestic water heating.

  9. Ion-exchange material and method of storing radioactive wastes

    DOE Patents [OSTI]

    Komarneni, S.; Roy, D.M.

    1983-10-31

    A new cation exchanger is a modified tobermorite containing aluminum isomorphously substituted for silicon and containing sodium or potassium. The exchanger is selective for lead, rubidium, cobalt, and cadmium and is selective for cesium over calcium or sodium. The tobermorites are compatible with cement and are useful for the long-term fixation and storage of radioactive nuclear wastes.

  10. CATION EXCHANGE METHOD FOR THE RECOVERY OF PROTACTINIUM

    DOE Patents [OSTI]

    Studier, M.H.; Sullivan, J.C.

    1959-07-14

    A cation exchange prccess is described for separating protactinium values from thorium values whereby they are initially adsorbed together from an aqueous 0.1 to 2 N hydrochloric acid on a cation exchange resin in a column. Then selectively eluting the thorium by an ammonium sulfate solution and subsequently eluting the protactinium by an oxalate solution.

  11. Anisotropic microporous supports impregnated with polymeric ion-exchange materials

    DOE Patents [OSTI]

    Friesen, D.; Babcock, W.C.; Tuttle, M.

    1985-05-07

    Novel ion-exchange media are disclosed, the media comprising polymeric anisotropic microporous supports containing polymeric ion-exchange or ion-complexing materials. The supports are anisotropic, having small exterior pores and larger interior pores, and are preferably in the form of beads, fibers and sheets. 5 figs.

  12. CAD data exchange with Martin Marietta Energy Systems, Inc., Oak Ridge, TN

    SciTech Connect (OSTI)

    Smith, K.L.

    1994-10-01

    This document has been developed to provide guidance in the interchange of electronic CAD data with Martin Marietta Energy Systems, Inc., Oak Ridge, Tennessee. It is not meant to be as comprehensive as the existing standards and specifications, but to provide a minimum set of practices that will enhance the success of the CAD data exchange. It is now a Department of Energy (DOE) Oak Ridge Field Office requirement that Architect-Engineering (A-E) firms prepare all new drawings using a Computer Aided Design (CAD) system that is compatible with the Facility Manager`s (FM) CAD system. For Oak Ridge facilities, the CAD system used for facility design by the FM, Martin Marietta Energy Systems, Inc., is Intregraph. The format for interchange of CAD data for Oak Ridge facilities will be the Intergraph MicroStation/IGDS format.

  13. Office of Legacy Management. Information and Records Management. Transition Guidance

    SciTech Connect (OSTI)

    2004-03-01

    The Office of Legacy Management (LM) is an integral part of the U.S. Department of Energy’s (DOE’s) strategy to ensure that legacy liabilities of former nuclear weapons production sites are properly managed following the completion of environmental cleanup activities. LM will work with each site using an integrated team approach to ensure a successful transition. Part of this process will include transition of Government records and information. The Office of Legacy Management Information and Records Management Transition Guidance focuses on LM’s goal to preserve and protect legacy records and information. This guidance document establishes a framework for the transfer of records management responsibilities for sites transferring to LM. It describes the requirements, responsibilities, and procedures for the efficient and cost-effective transfer of custody, ownership, and management of records and other information products from the transfer site to LM. Records management practices are critical to the functions of Federal agencies because records provide information about, or evidence of, the organization, functions, policies, decisions, procedures, operations, or other activities. Therefore, the information generated by an agency is created, maintained, and dispositioned through records management processes that ensure the appropriate preservation and retrieval of essential information. Because of their intrinsic value, best practices to preserve information and records should be utilized when records are transferred from one organization to another. As the transfer program completes cleanup activities at closure sites, a transitional process will facilitate the transparent shift in the management of site records activities to LM. The roles and responsibilities of the transfer site and/or program and LM described in this document are a necessary foundation for cooperation and coordination and are essential to the successful transition of records and information responsibilities. The DOE Office of the Chief Information Officer (OCIO) has a central role in DOE records management by providing guidance, expertise, and coordination to all DOE offices and organizations and coordination with the National Archives and Records Administration (NARA). LM and the transfer site will complete an integrated transition plan which will integrate all transition elements including information and records. As part of the overall transition plan, an Information and Records Transition Plan will be developed consistent with the integrated transition plan for the site transfer and included as an attachment. The Information and Records Management Transition Plan will be developed to assist both organizations in organizing the tasks; establishing a timetable and milestones for their completion; and identifying manpower, funding and other resources that will be needed to complete the ownership transfer. In addition, the plan will provide a valuable exchange of institutional knowledge that will assist LM in meeting the obligations of responsibly managing legacy records. Guidance for the development of the plan is included in this document. Records management concerns that may arise during site closure, such as management support, contract language and agreements, interactions with the OCIO and NARA, resource and budget considerations, and procedures to safeguard records are addressed. Guidelines and criteria for records management transition activities are also provided. These include LM expectations for the inventory, scheduling, and disposition of records; the management and transfer of electronic files, including databases and software; records finding aids, indices, and recordkeeping systems; and the process for the transfer of hard copy and electronic records to LM.

  14. NGNP Process Heat Utilization: Liquid Metal Phase Change Heat Exchanger

    SciTech Connect (OSTI)

    Piyush Sabharwall; Mike Patterson; Vivek Utgikar; Fred Gunnerson

    2008-09-01

    One key long-standing issue that must be overcome to fully realize the successful growth of nuclear power is to determine other benefits of nuclear energy apart from meeting the electricity demands. The Next Generation Nuclear Plant (NGNP) will most likely be producing electricity and heat for the production of hydrogen and/or oil retrieval from oil sands and oil shale to help in our national pursuit of energy independence. For nuclear process heat to be utilized, intermediate heat exchange is required to transfer heat from the NGNP to the hydrogen plant or oil recovery field in the most efficient way possible. Development of nuclear reactor - process heat technology has intensified the interest in liquid metals as heat transfer media because of their ideal transport properties. Liquid metal heat exchangers are not new in practical applications. An important rational for considering liquid metals is the potential convective heat transfer is among the highest known. Thus explains the interest in liquid metals as coolant for intermediate heat exchange from NGNP. For process heat it is desired that, intermediate heat exchangers (IHX) transfer heat from the NGNP in the most efficient way possible. The production of electric power at higher efficiency via the Brayton Cycle, and hydrogen production, requires both heat at higher temperatures and high effectiveness compact heat exchangers to transfer heat to either the power or process cycle. Compact heat exchangers maximize the heat transfer surface area per volume of heat exchanger; this has the benefit of reducing heat exchanger size and heat losses. High temperature IHX design requirements are governed in part by the allowable temperature drop between the outlet and inlet of the NGNP. In order to improve the characteristics of heat transfer, liquid metal phase change heat exchangers may be more effective and efficient. This paper explores the overall heat transfer characteristics and pressure drop of the phase change heat exchanger with Na as the heat exchanger coolant. In order to design a very efficient and effective heat exchanger one must optimize the design such that we have a high heat transfer and a lower pressure drop, but there is always a trade-off between them. Based on NGNP operational parameters, a heat exchanger analysis with the sodium phase change will be presented to show that the heat exchanger has the potential for highly effective heat transfer, within a small volume at reasonable cost.

  15. Circulating heat exchangers for oscillating wave engines and refrigerators

    DOE Patents [OSTI]

    Swift, Gregory W.; Backhaus, Scott N.

    2003-10-28

    An oscillating-wave engine or refrigerator having a regenerator or a stack in which oscillating flow of a working gas occurs in a direction defined by an axis of a trunk of the engine or refrigerator, incorporates an improved heat exchanger. First and second connections branch from the trunk at locations along the axis in selected proximity to one end of the regenerator or stack, where the trunk extends in two directions from the locations of the connections. A circulating heat exchanger loop is connected to the first and second connections. At least one fluidic diode within the circulating heat exchanger loop produces a superimposed steady flow component and oscillating flow component of the working gas within the circulating heat exchanger loop. A local process fluid is in thermal contact with an outside portion of the circulating heat exchanger loop.

  16. HYDROGEN-DEUTERIUM EXCHANGE IN PHOTOLYZED METHANE-WATER ICES

    SciTech Connect (OSTI)

    Weber, Amanda S.; Hodyss, Robert; Johnson, Paul V.; Willacy, Karen; Kanik, Isik

    2009-09-20

    Previous work has concluded that H-D exchange occurs readily in polycyclic aromatic hydrocarbons frozen in deuterated water (D{sub 2}O) irradiated with ultraviolet light. Here, we examine H-D exchange in methane-water ices following exposure to ultraviolet radiation and analyze the products formed as a result. We find that H-D exchange also occurs in methane-water ices by means of ultraviolet photolysis. Exchange proceeds through a radical mechanism that implies that almost all organic species will undergo significant H-D exchange with the matrix in water ices exposed to ultraviolet radiation. Given sufficient energetic processing of the ice, the H/D ratio of an ice matrix may be transferred to the organic species in the ice.

  17. Quantitative ion-exchange separation of plutonium from impurities

    SciTech Connect (OSTI)

    Pietri, C.E.; Freeman, B.P.; Weiss, J.R.

    1981-09-01

    The methods used at the New Brunswick Laboratory for the quantitative ion exchange separation of plutonium from impurities prior to plutonium assay are described. Other ion exchange separation procedures for impurity determination and for isotopic abundance measurements are given. The primary technique used consists of sorption of plutonium(IV) in 8N HNO/sub 3/ on Dowex-1 anion exchange resin and elution of the purified plutonium with 0.3N HCl-0.01N HF. Other methods consist of the anion exchange separation of plutonium(IV) in 12N HCl and the cation exchange separation of plutonium(III) in 0.2 N HNO/sub 3/. The application of these procedures to the subsequent assay of plutonium, isotopic analysis, and impurity determination is described.

  18. Managing Critical Management Improvement Initiatives

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2003-10-01

    Provides requirements and responsibilities for planning, executing and assessing critical management improvement initiatives within DOE. DOE N 251.59, dated 9/27/2004, extends this Notice until 10/01/2005. Archived 11-8-10. Does not cancel other directives.

  19. Environmental Management

    SciTech Connect (OSTI)

    2014-11-12

    Another key aspect of the NNSS mission is Environmental Management program, which addresses the environmental legacy from historic nuclear weapons related activities while also ensuring the health and safety of present day workers, the public, and the environment as current and future missions are completed. The Area 5 Radioactive Waste Management site receives low-level and mixed low-level waste from some 28 different generators from across the DOE complex in support of the legacy clean-up DOE Environmental Management project. Without this capability, the DOE would not be able to complete the clean up and proper disposition of these wastes. The program includes environmental protection, compliance, and monitoring of the air, water, plants, animals, and cultural resources at the NNSS. Investigation and implementation of appropriate corrective actions to address the contaminated ground water facilities and soils resulting from historic nuclear testing activities, the demolition of abandoned nuclear facilities, as well as installation of ground water wells to identify and monitor the extent of ground water contamination.

  20. Environmental Management

    ScienceCinema (OSTI)

    None

    2015-01-07

    Another key aspect of the NNSS mission is Environmental Management program, which addresses the environmental legacy from historic nuclear weapons related activities while also ensuring the health and safety of present day workers, the public, and the environment as current and future missions are completed. The Area 5 Radioactive Waste Management site receives low-level and mixed low-level waste from some 28 different generators from across the DOE complex in support of the legacy clean-up DOE Environmental Management project. Without this capability, the DOE would not be able to complete the clean up and proper disposition of these wastes. The program includes environmental protection, compliance, and monitoring of the air, water, plants, animals, and cultural resources at the NNSS. Investigation and implementation of appropriate corrective actions to address the contaminated ground water facilities and soils resulting from historic nuclear testing activities, the demolition of abandoned nuclear facilities, as well as installation of ground water wells to identify and monitor the extent of ground water contamination.

  1. Management & Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management & Administration Management & Administration Management & Administration The Office of Management and Administration directs the development, coordination, and execution ...

  2. Environmental Management System

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Management System Environmental Management System An Environmental Management System (EMS) is a set of processes and practices that enable an organization to reduce its...

  3. ORISE: Emergency Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Management Emergency Management Effective emergency management relies on thorough integration of preparedness plans at all levels of government. The Oak Ridge Institute for Science...

  4. Tc-99 Ion Exchange Resin Testing

    SciTech Connect (OSTI)

    Valenta, Michelle M.; Parker, Kent E.; Pierce, Eric M.

    2010-08-01

    Pacific Northwest National Laboratory was contracted by CHPRC to evaluate the release of 99Tc from spent resin used to treat water from well 299-W15-765 and stored for several years. The key questions to be answered are: 1) does 99Tc readily release from the spent ion exchange resin after being in storage for several years; 2) if hot water stripping is used to remove the co-contaminant carbon tetrachloride, will 99Tc that has been sequestered by the resin be released; and 3) can spent resin be encapsulated into a cementitious waste form; if so, how much 99Tc would be released from the weathering of the monolith waste form? The results from the long term stability leach test results confirm that the resin is not releasing a significant amount of the sequestered 99Tc, evident by the less than 0.02% of the total 99Tc loaded being identified in the solution. Furthermore, it is possible that the measured 99Tc concentration is the result of 99Tc contained in the pore spaces of the resin. In addition to these results, analyses conducted to examine the impact of hot water on the release of 99Tc suggest that only a small percentage of the total is being released. This suggest that hot water stripping to remove carbon tetrachloride will not have a significant affect on the resins ability to hold-on to sequestered 99Tc. Finally, encapsulation of spent resin in a cementitious material may be a viable disposal option, but additional tests are needed to examine the extent of physical degradation caused by moisture loss and the effect this degradation process can have on the release of 99Tc.

  5. M E Environmental Management Environmental Management

    Energy Savers [EERE]

    safety  performance  cleanup  closure M E Environmental Management Environmental Management safety  performance  cleanup  closure M E Environmental Management Environmental Management M E Environmental Management Environmental Management Office of Site Restoration, EM-10 Office of D&D and Facility Engineering, EM-13 Facility Deactivation & Decommissioning (D&D) D&D Program Map Addendum: Impact of American Recovery and Reinvestment Act (ARRA) on EM's D&D

  6. Heat exchanger and water tank arrangement for passive cooling system

    DOE Patents [OSTI]

    Gillett, J.E.; Johnson, F.T.; Orr, R.S.; Schulz, T.L.

    1993-11-30

    A water storage tank in the coolant water loop of a nuclear reactor contains a tubular heat exchanger. The heat exchanger has tube sheets mounted to the tank connections so that the tube sheets and tubes may be readily inspected and repaired. Preferably, the tubes extend from the tube sheets on a square pitch and then on a rectangular pitch there between. Also, the heat exchanger is supported by a frame so that the tank wall is not required to support all of its weight. 6 figures.

  7. Microchannel laminated mass exchanger and method of making

    DOE Patents [OSTI]

    Martin, Peter M.; Bennett, Wendy D.; Matson, Dean W.; Stewart, Donald C.; Drost, Monte K.; Wegeng, Robert S.; Perez, Joseph M.; Feng, Xiangdong; Liu, Jun

    2000-01-01

    The present invention is a microchannel mass exchanger having a first plurality of inner thin sheets and a second plurality of outer thin sheets. The inner thin sheets each have a solid margin around a circumference, the solid margin defining a slot through the inner thin sheet thickness. The outer thin sheets each have at least two header holes on opposite ends and when sandwiching an inner thin sheet. The outer thin sheets further have a mass exchange medium. The assembly forms a closed flow channel assembly wherein fluid enters through one of the header holes into the slot and exits through another of the header holes after contacting the mass exchange medium.

  8. Microchannel laminated mass exchanger and method of making

    DOE Patents [OSTI]

    Martin, Peter M [Kennewick, WA; Bennett, Wendy D [Kennewick, WA; Matson, Dean W [Kennewick, WA; Stewart, Donald C [Richland, WA; Drost, Monte K [Pasco, WA; Wegeng, Robert S [Richland, WA; Perez, Joseph M [Richland, WA; Feng, Xiangdong [West Richland, WA; Liu, Jun [West Richland, WA

    2002-03-05

    The present invention is a microchannel mass exchanger having a first plurality of inner thin sheets and a second plurality of outer thin sheets. The inner thin sheets each have a solid margin around a circumference, the solid margin defining a slot through the inner thin sheet thickness. The outer thin sheets each have at least two header holes on opposite ends and when sandwiching an inner thin sheet. The outer thin sheets further have a mass exchange medium. The assembly forms a closed flow channel assembly wherein fluid enters through one of the header holes into the slot and exits through another of the header holes after contacting the mass exchange medium.

  9. Microchannel laminated mass exchanger and method of making

    DOE Patents [OSTI]

    Martin, Peter M [Kennewick, WA; Bennett, Wendy D [Kennewick, WA; Matson, Dean W [Kennewick, WA; Stewart, Donald C [Richland, WA; Drost, Monte K [Pasco, WA; Wegeng, Robert S [Richland, WA; Perez, Joseph M [Richland, WA; Feng, Xiangdong [West Richland, WA; Liu, Jun [West Richland, WA

    2003-03-18

    The present invention is a microchannel mass exchanger having a first plurality of inner thin sheets and a second plurality of outer thin sheets. The inner thin sheets each have a solid margin around a circumference, the solid margin defining a slot through the inner thin sheet thickness. The outer thin sheets each have at least two header holes on opposite ends and when sandwiching an inner thin sheet. The outer thin sheets further have a mass exchange medium. The assembly forms a closed flow channel assembly wherein fluid enters through one of the header holes into the slot and exits through another of the header holes after contacting the mass exchange medium.

  10. System for exchanging tools and end effectors on a robot

    DOE Patents [OSTI]

    Burry, D.B.; Williams, P.M.

    1991-02-19

    A system and method for exchanging tools and end effectors on a robot permits exchange during a programmed task. The exchange mechanism is located off the robot, thus reducing the mass of the robot arm and permitting smaller robots to perform designated tasks. A simple spring/collet mechanism mounted on the robot is used which permits the engagement and disengagement of the tool or end effector without the need for a rotational orientation of the tool to the end effector/collet interface. As the tool changing system is not located on the robot arm no umbilical cords are located on robot. 12 figures.

  11. System for exchanging tools and end effectors on a robot

    DOE Patents [OSTI]

    Burry, David B.; Williams, Paul M.

    1991-02-19

    A system and method for exchanging tools and end effectors on a robot permits exchange during a programmed task. The exchange mechanism is located off the robot, thus reducing the mass of the robot arm and permitting smaller robots to perform designated tasks. A simple spring/collet mechanism mounted on the robot is used which permits the engagement and disengagement of the tool or end effector without the need for a rotational orientation of the tool to the end effector/collet interface. As the tool changing system is not located on the robot arm no umbilical cords are located on robot.

  12. Heat exchanger for fuel cell power plant reformer

    DOE Patents [OSTI]

    Misage, Robert; Scheffler, Glenn W.; Setzer, Herbert J.; Margiott, Paul R.; Parenti, Jr., Edmund K.

    1988-01-01

    A heat exchanger uses the heat from processed fuel gas from a reformer for a fuel cell to superheat steam, to preheat raw fuel prior to entering the reformer and to heat a water-steam coolant mixture from the fuel cells. The processed fuel gas temperature is thus lowered to a level useful in the fuel cell reaction. The four temperature adjustments are accomplished in a single heat exchanger with only three heat transfer cores. The heat exchanger is preheated by circulating coolant and purge steam from the power section during startup of the latter.

  13. Self-defrosting recuperative air-to-air heat exchanger

    DOE Patents [OSTI]

    Drake, R.L.

    1993-12-28

    A heat exchanger is described which includes a stationary spirally or concentrically wound heat exchanger core with rotating baffles on upper and lower ends thereof. The rotating baffles include rotating inlets and outlets which are in communication with respective fixed inlets and outlets via annuli. The rotation of the baffles causes a concurrent rotation of the temperature distribution within the stationary exchanger core, thereby preventing frost build-up in some applications and preventing the formation of hot spots in other applications. 3 figures.

  14. Financial Management Committee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this fiscal year, putting downward pressure on net secondary revenues. - Some of this revenue shortfall is offset by reduced spending, most notably in the Residential Exchange...

  15. Best Management Practice #1: Water Management Planning

    Broader source: Energy.gov [DOE]

    A successful water management program starts with developing a comprehensive water management plan. This plan should be included within existing facility operating plans.

  16. Data Management

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Data Management Please remove ALL data from /house! Do you still have data in /house/homedirs? Do you know if you have data in /house/homedirs? Please check now and make a plan for moving that data to the archiver or one of the NERSC file systems (for more information on these filesystems go to File storage and I/O). Moving data from house to DnA The DnA file system is primarily for finished projects, data that is ready to be archived, or data that is shared between groups. It is mounted

  17. 2016 DOE Project Management Workshop - "Enhancing Project Management...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management Workshop - "Enhancing Project Management" 2016 DOE Project Management Workshop - "Enhancing Project Management" 20160407-doe-project-management-workshop-ADJUST-slide.png ...

  18. The Office of Environmental Management technical reports: A bibliography

    SciTech Connect (OSTI)

    1998-07-01

    The Office of Environmental Management`s (EM) technical reports bibliography is an annual publication that contains information on scientific and technical reports sponsored by the Office of Environmental Management added to the Energy Science and Technology Database from July 1, 1995--that were published from October 1, 1996--September 30, 1997. This information is divided into the following categories: Miscellaneous, Focus Areas and Crosscutting Programs, Support Programs, Technology Integration and International Technology Exchange, are now included in the Miscellaneous category. The Office of Environmental Management within the Department of Energy (DOE) is responsible for environmental restoration, waste management, technology development and facility transition and management. Subjects include: subsurface contaminants; mixed waste characterization, treatment and disposal; radioactive tank waste remediation; plutonium; deactivation and decommissioning; robotics; characterization, monitoring, and sensor technology; and efficient separations. 880 refs.

  19. Risk Management Process Overview

    Broader source: Energy.gov [DOE]

    The cybersecurity risk management process explained in the Electricity Sector Cybersecurity Risk Management Process (RMP) Guideline has two primary components: the risk management model and the the risk management cycle.

  20. The Office of Environmental Management technical reports: a bibliography

    SciTech Connect (OSTI)

    1997-07-01

    The Office of Environmental Management`s (EM) technical reports bibliography is an annual publication that contains information on scientific and technical reports sponsored by the Office of Environmental Management added to the Energy Science and Technology Database from July 1, 1995 through Sept. 30, 1996. This information is divided into the following categories: Focus Areas and Crosscutting Programs. Support Programs, Technology Integration and International Technology Exchange are now included in the General category. EM`s Office of Science and Technology sponsors this bibliography.

  1. Your Records Management Responsibilities

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Your Records Management Responsibilities Table of Contents INTRODUCTION RECORDS MANAGEMENT IN THE FEDERAL GOVERNMENT RECORDS MANAGEMENT IN THE DEPARTMENT OF ENERGY IMPORTANCE OF RECORDS MANAGEMENT YOUR RECORDS MANAGEMENT RESPONSIBILITIES RECORDS MANAGEMENT LIFE CYCLE ELECTRONIC RECORDS & RECORDKEEPING LAW, REGULATION, AND POLICY ASSISTANCE RECORDS MANAGEMENT TERMS 2 INTRODUCTION If you are a government employee or contractor working for a federal agency, records management is part of your

  2. Energy Management and Financing

    Office of Energy Efficiency and Renewable Energy (EERE)

    This Tuesday Webcast for Industry covers how to become a Certified Energy Manager and Certified Practitioner in Energy Management Systems

  3. Efficient, Low-cost Microchannel Heat Exchanger - Energy Innovation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Find More Like This Return to Search Efficient, Low-cost Microchannel Heat Exchanger ... will not only be much more efficient, but will also be manufactured at a much lower cost. ...

  4. Process for exchanging hydrogen isotopes between gaseous hydrogen and water

    DOE Patents [OSTI]

    Hindin, Saul G.; Roberts, George W.

    1980-08-12

    A process for exchanging isotopes of hydrogen, particularly tritium, between gaseous hydrogen and water is provided whereby gaseous hydrogen depeleted in tritium and liquid or gaseous water containing tritium are reacted in the presence of a metallic catalyst.

  5. New Lessons Learned: Peer Exchange Call "Greatest Hits" Out Now

    Broader source: Energy.gov [DOE]

    The latest in a series of Lessons Learned: Peer Exchange Call “greatest hits” summarizes top marketing and outreach takeaways from Better Buildings Residential Network members during spring 2015...

  6. Anion Exchange Membranes for Fuel Cells | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for Fuel Cells Anion Exchange Membranes for Fuel Cells Presentation at the AMFC Workshop, May 8-9, 2011, Arlington, VA PDF icon amfc110811herring.pdf More Documents & ...

  7. All-inorganic Germanium nanocrystal films by cationic ligand exchange

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Wheeler, Lance M.; Nichols, Asa W.; Chernomordik, Boris D.; Anderson, Nicholas C.; Beard, Matthew C.; Neale, Nathan R.

    2016-01-21

    In this study, we introduce a new paradigm for group IV nanocrystal surface chemistry based on room temperature surface activation that enables ionic ligand exchange. Germanium nanocrystals synthesized in a gas-phase plasma reactor are functionalized with labile, cationic alkylammonium ligands rather than with traditional covalently bound groups. We employ Fourier transform infrared and 1H nuclear magnetic resonance spectroscopies to demonstrate the alkylammonium ligands are freely exchanged on the germanium nanocrystal surface with a variety of cationic ligands, including short inorganic ligands such as ammonium and alkali metal cations. This ionic ligand exchange chemistry is used to demonstrate enhanced transport inmore » germanium nanocrystal films following ligand exchange as well as the first photovoltaic device based on an all-inorganic germanium nanocrystal absorber layer cast from solution. This new ligand chemistry should accelerate progress in utilizing germanium and other group IV nanocrystals for optoelectronic applications.« less

  8. Effect of non-uniform exchange field in ferromagnetic graphene

    SciTech Connect (OSTI)

    Chowdhury, Debashree Basu, B.

    2015-04-15

    We have presented here the consequences of the non-uniform exchange field on the spin transport issues in spin chiral configuration of ferromagnetic graphene. Taking resort to the spin–orbit coupling (SOC) term and non-uniform exchange coupling term we are successful to express the expression of Hall conductivity in terms of the exchange field and SOC parameters through the Kubo formula approach. However, for a specific configuration of the exchange parameter we have evaluated the Berry curvature of the system. We also have paid attention to the study of SU(2) gauge theory of ferromagnetic graphene. The generation of anti damping spin–orbit torque in spin chiral magnetic graphene is also briefly discussed.

  9. Alkaline Anion Exchange Membrane Fuel Cells (AEM-FC) Status

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Most of the papers are focused on development of anion conducting polymers for AEMs 2000 2005 2010 2015 2020 Year Dario R. Dekel Web of Science @Feb 2016 PEM: TS"proton exchange ...

  10. Quality Assurance Exchange September 2005, Volume 1 Issue 2

    Broader source: Energy.gov [DOE]

    Quality Assurance Exchange September 2005, Volume 1 Issue 2 U.S. Department of Energy, Off ice of Corporate Performance Assessment Off ice of Quality Assurance Programs (EH-31)

  11. Isotope Transport and Exchange within the Coso Geothermal System...

    Open Energy Info (EERE)

    and the nearby Coso Hot Springs using finite element models of single-phase, variable-density fluid flow, conductive- convective heat transfer, fluid-rock isotope exchange, and...

  12. Energy Efficiency Exchange 2015: Federal Training and Knowledge

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency Exchange 2015: Federal Training and Knowledge Overview Webinars: March 25 & April 8, 2015 Timothy D. Unruh PhD, PE, CEM Program Director DOE FEMP 2 Energy...

  13. Energy Exchange Agenda at a Glance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    One page agenda at a glance for the Energy Exchange, a two-and-a-half day training event scheduled for August 11-13, 2015, at the Phoenix Convention Center in Phoenix, Arizona. PDF ...

  14. Oscillating side-branch enhancements of thermoacoustic heat exchangers

    DOE Patents [OSTI]

    Swift, Gregory W.

    2003-05-13

    A regenerator-based engine or refrigerator has a regenerator with two ends at two different temperatures, through which a gas oscillates at a first oscillating volumetric flow rate in the direction between the two ends and in which the pressure of the gas oscillates, and first and second heat exchangers, each of which is at one of the two different temperatures. A dead-end side branch into which the gas oscillates has compliance and is connected adjacent to one of the ends of the regenerator to form a second oscillating gas flow rate additive with the first oscillating volumetric flow rate, the compliance having a volume effective to provide a selected total oscillating gas volumetric flow rate through the first heat exchanger. This configuration enables the first heat exchanger to be configured and located to better enhance the performance of the heat exchanger rather than being confined to the location and configuration of the regenerator.

  15. Better Buildings Neighborhood Program Multi-Family Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Neighborhood Program Multi- Family Peer Exchange Call: Shared Space vs. In- unit Upgrades ... focusing on shared space and technology in multi-family buildings vs. in-unit upgrades? ...

  16. State Administration for Foreign Exchange | Open Energy Information

    Open Energy Info (EERE)

    State Administration for Foreign Exchange Jump to: navigation, search TODO: More information needed This article is a stub. You can help OpenEI by expanding it. China's State...

  17. Technical Information Exchange on Pyrolysis Oil: Potential for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewab;e Heating Oil Substation Fuel in New England Technical Information Exchange on Pyrolysis Oil: Potential for a Renewab;e Heating Oil Substation Fuel in New England This ...

  18. Sodium citrate-assisted anion exchange strategy for construction...

    Office of Scientific and Technical Information (OSTI)

    strategy for construction of Bisub 2Osub 2COsub 3BiOI photocatalysts Citation Details In-Document Search Title: Sodium citrate-assisted anion exchange strategy for ...

  19. Three Companies Awarded Contracts for Royalty-in-Kind Exchanges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy (DOE) today awarded contracts to Shell Trading Company, Sunoco Logistics, and BP North America for exchange of 12.3 million barrels of royalty oil produced...

  20. North America's net terrestrial CO2 exchange with the atmosphere...

    Office of Scientific and Technical Information (OSTI)

    a synthesis of net land-atmosphere CO2 exchange for North America (Canada, United States, and Mexico) over the period 1990-2009. Only CO2 is considered, not methane or...

  1. The Role of Surface Energy Exchange for Simulating Wind Inflow...

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Search Results Technical Report: The Role of Surface Energy Exchange for Simulating Wind Inflow: An Evaluation of Multiple Land Surface Models in WRF for the ...

  2. Decontamination of water using nitrate selective ion exchange resin

    DOE Patents [OSTI]

    Lockridge, J.E.; Fritz, J.S.

    1990-07-31

    A method for nitrate decontamination of water which involves passing the water through a bed of alkyl phosphonium anion exchange resin which has pendant alkyl groups of C[sub 3] or larger.

  3. Two-Phase Heat Exchanger for Power Electronics Cooling - Energy...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Find More Like This Return to Search Two-Phase Heat Exchanger for Power Electronics ... Heat dissipation is a limiting factor in reducing the size and cost of the power ...

  4. Decontamination of water using nitrate selective ion exchange resin

    DOE Patents [OSTI]

    Lockridge, James E. (Ames, IA); Fritz, James S. (Ames, IA)

    1990-07-31

    A method for nitrate decontamination of water which involves passing the water through a bed of alkyl phosphonium anion exchange resin which has pendant alkyl groups of C.sub.3 or larger.

  5. Metal-air cell with ion exchange material

    SciTech Connect (OSTI)

    Friesen, Cody A.; Wolfe, Derek; Johnson, Paul Bryan

    2015-08-25

    Embodiments of the invention are related to anion exchange membranes used in electrochemical metal-air cells in which the membranes function as the electrolyte material, or are used in conjunction with electrolytes such as ionic liquid electrolytes.

  6. Microchannel crossflow fluid heat exchanger and method for its fabrication

    DOE Patents [OSTI]

    Swift, G.W.; Migliori, A.; Wheatley, J.C.

    1985-05-14

    A microchannel crossflow fluid heat exchanger and a method for its fabrication are disclosed. The heat exchanger is formed from a stack of thin metal sheets which are bonded together. The stack consists of alternating slotted and unslotted sheets. Each of the slotted sheets includes multiple parallel slots which form fluid flow channels when sandwiched between the unslotted sheets. Successive slotted sheets in the stack are rotated ninety degrees with respect to one another so as to form two sets of orthogonally extending fluid flow channels which are arranged in a crossflow configuration. The heat exchanger has a high surface to volume ratio, a small dead volume, a high heat transfer coefficient, and is suitable for use with fluids under high pressures. The heat exchanger has particular application in a Stirling engine that utilizes a liquid as the working substance. 9 figs.

  7. Microchannel crossflow fluid heat exchanger and method for its fabrication

    DOE Patents [OSTI]

    Swift, Gregory W.; Migliori, Albert; Wheatley, John C.

    1985-01-01

    A microchannel crossflow fluid heat exchanger and a method for its fabrication are disclosed. The heat exchanger is formed from a stack of thin metal sheets which are bonded together. The stack consists of alternating slotted and unslotted sheets. Each of the slotted sheets includes multiple parallel slots which form fluid flow channels when sandwiched between the unslotted sheets. Successive slotted sheets in the stack are rotated ninety degrees with respect to one another so as to form two sets of orthogonally extending fluid flow channels which are arranged in a crossflow configuration. The heat exchanger has a high surface to volume ratio, a small dead volume, a high heat transfer coefficient, and is suitable for use with fluids under high pressures. The heat exchanger has particular application in a Stirling engine that utilizes a liquid as the working substance.

  8. Microchannel crossflow fluid heat exchanger and method for its fabrication

    DOE Patents [OSTI]

    Swift, G.W.; Migliori, A.; Wheatley, J.C.

    1982-08-31

    A microchannel crossflow fluid heat exchanger and a method for its fabrication are disclosed. The heat exchanger is formed from a stack of thin metal sheets which are bonded together. The stack consists of alternating slotted and unslotted sheets. Each of the slotted sheets includes multiple parallel slots which form fluid flow channels when sandwiched between the unslotted sheets. Successive slotted sheets in the stack are rotated ninety degrees with respect to one another so as to form two sets of orthogonally extending fluid flow channels which are arranged in a crossflow configuration. The heat exchanger has a high surface to volume ratio, a small dead volume, a high heat transfer coefficient, and is suitable for use with fluids under high pressures. The heat exchanger has particular application in a Stirling engine that utilizes a liquid as the working substance.

  9. Investing in International Information Exchange Activities to Improve the Safety, Cost Effectiveness and Schedule of Cleanup - 13281

    SciTech Connect (OSTI)

    Seed, Ian; James, Paula; Mathieson, John; Judd, Laurie; Elmetti-Ramirez, Rosa; Han, Ana

    2013-07-01

    With decreasing budgets and increasing pressure on completing cleanup missions as quickly, safely and cost-effectively as possible, there is significant benefit to be gained from collaboration and joint efforts between organizations facing similar issues. With this in mind, the US Department of Energy (DOE) and the UK Nuclear Decommissioning Authority (NDA) have formally agreed to share information on lessons learned on the development and application of new technologies and approaches to improve the safety, cost effectiveness and schedule of the cleanup legacy wastes. To facilitate information exchange a range of tools and methodologies were established. These included tacit knowledge exchange through facilitated meetings, conference calls and Site visits as well as explicit knowledge exchange through document sharing and newsletters. A DOE web-based portal has been established to capture these exchanges and add to them via discussion boards. The information exchange is operating at the Government-to-Government strategic level as well as at the Site Contractor level to address both technical and managerial topic areas. This effort has resulted in opening a dialogue and building working relationships. In some areas joint programs of work have been initiated thus saving resource and enabling the parties to leverage off one another activities. The potential benefits of high quality information exchange are significant, ranging from cost avoidance through identification of an approach to a problem that has been proven elsewhere to cost sharing and joint development of a new technology to address a common problem. The benefits in outcomes significantly outweigh the costs of the process. The applicability of the tools and methods along with the lessons learned regarding some key issues is of use to any organization that wants to improve value for money. In the waste management marketplace, there are a multitude of challenges being addressed by multiple organizations and the effective pooling and exchange of knowledge and experience can only be of benefit to all participants to help complete the cleanup mission more quickly and more cost effectively. This paper examines in detail the tools and processes used to promote information exchange and the progress made to date. It also discusses the challenges and issues involved and proposes recommendations to others who are involved in similar activities. (authors)

  10. Purpose and Need: CEQ Exchange of Letters with Secretary of Transporta...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Purpose and Need: CEQ Exchange of Letters with Secretary of Transportation Purpose and Need: CEQ Exchange of Letters with Secretary of Transportation A discussion between the ...

  11. BetterBuildings Financing Peer Exchange Kick-off Call Call Slides...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Call Slides and Discussion Summary Agenda * What are peer exchange calls? * Call logistics and attendance * Potential financing peer exchange topics * Grant project go-around: ...

  12. Office of Environmental Management | Department of Energy

    Office of Environmental Management (EM)

    your e-mail address below. * indicates required Email * Subscribe Stay Connected YouTube Icon EM FISCAL YEAR 2016 BUDGET The EM Fiscal Year 2016 budget request places a...

  13. Emittance and phase space exchange for advanced beam manipulation and

    Office of Scientific and Technical Information (OSTI)

    diagnostics (Journal Article) | SciTech Connect phase space exchange for advanced beam manipulation and diagnostics Citation Details In-Document Search Title: Emittance and phase space exchange for advanced beam manipulation and diagnostics Authors: Xiang, Dao ; Chao, Alex Publication Date: 2011-11-14 OSTI Identifier: 1101174 Type: Published Article Journal Name: Physical Review Special Topics - Accelerators and Beams Additional Journal Information: Journal Volume: 14; Journal Issue: 11;

  14. Extraction of exchange parameters in transition-metal perovskites (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Extraction of exchange parameters in transition-metal perovskites Citation Details In-Document Search This content will become publicly available on September 14, 2016 Title: Extraction of exchange parameters in transition-metal perovskites Authors: Furrer, A. ; Podlesnyak, A. ; Krämer, K. W. Publication Date: 2015-09-15 OSTI Identifier: 1215771 Type: Publisher's Accepted Manuscript Journal Name: Physical Review B Additional Journal Information: Journal Volume:

  15. Liquid Salt Heat Exchanger Technology for VHTR Based Applications

    Office of Scientific and Technical Information (OSTI)

    (Technical Report) | SciTech Connect Liquid Salt Heat Exchanger Technology for VHTR Based Applications Citation Details In-Document Search Title: Liquid Salt Heat Exchanger Technology for VHTR Based Applications The objective of this research is to evaluate performance of liquid salt fluids for use as a heat carrier for transferring high-temperature process heat from the very high-temperature reactor (VHTR) to chemical process plants. Currently, helium is being considered as the heat

  16. Technology Performance Exchange - 2013 BTO Peer Review | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Performance Exchange - 2013 BTO Peer Review Technology Performance Exchange - 2013 BTO Peer Review Commercial Buildings Integration Project for the 2013 Building Technologies Office's Program Peer Review PDF icon commlbldgs01_livingood_040213.pdf More Documents & Publications Building Energy Modeling Library - 2013 BTO Peer Review Whole Building Performance-Based Procurement Training Small- and Medium-Size Building Automation and Control System Needs: Scoping Study

  17. Bayonet heat exchangers in heat-assisted Stirling heat pump

    SciTech Connect (OSTI)

    Yagyu, S.; Fukuyama, Y.; Morikawa, T.; Isshiki, N.; Satoh, I.; Corey, J.; Fellows, C.

    1998-07-01

    The Multi-Temperature Heat Supply System is a research project creating a city energy system with lower environmental load. This system consists of a gas-fueled internal combustion engine and a heat-assisted Stirling heat pump utilizing shaft power and thermal power in a combination of several cylinders. The heat pump is mainly driven by engine shaft power and is partially assisted by thermal power from engine exhaust heat source. Since this heat pump is operated by proportioning the two energy sources to match the characteristics of the driving engine, the system is expected to produce cooling and heating water at high COP. This paper describes heat exchanger development in the project to develop a heat-assisted Stirling heat pump. The heat pump employs the Bayonet type heat exchangers (BHX Type I) for supplying cold and hot water and (BHX Type II) for absorbing exhaust heat from the driving engine. The heat exchanger design concepts are presented and their heat transfer and flow loss characteristics in oscillating gas flow are investigated. The main concern in the BHX Type I is an improvement of gas side heat transfer and the spirally finned tubes were applied to gas side of the heat exchanger. For the BHX Type II, internal heat transfer characteristics are the main concern. Shell-and-tube type heat exchangers are widely used in Stirling machines. However, since brazing is applied to the many tubes for their manufacturing processes, it is very difficult to change flow passages to optimize heat transfer and loss characteristics once they have been made. The challenge was to enhance heat transfer on the gas side to make a highly efficient heat exchanger with fewer parts. It is shown that the Bayonet type heat exchanger can have good performance comparable to conventional heat exchangers.

  18. FASTGAS: Fast Gas Sampling for palladium exchange tests

    SciTech Connect (OSTI)

    Malinowski, M.E.; Stewart, K.D.; VerBerkmoes, A.A.

    1991-06-01

    A mass spectrometric technique for measuring the composition of gas flows in rapid H/D exchange reactions in palladium compacts has been developed. This method, called FASTGAS (Fast Gas Sampling)'' has been used at atmospheric pressures and above with a time response of better than 100 ms. The current implementation of the FASTGAS technique is described in detail and examples of its application to palladium hydride exchange tests are given. 12 refs., 10 figs.

  19. Technical Exchange and Cooperation Agreement between the Department of

    Energy Savers [EERE]

    Energy and the European Atomic Energy Community | Department of Energy Technical Exchange and Cooperation Agreement between the Department of Energy and the European Atomic Energy Community Technical Exchange and Cooperation Agreement between the Department of Energy and the European Atomic Energy Community The objective of this technical arrangement is to establish a framework for co-operation between the Parties in the field of nuclear-related technology research and development based upon

  20. PHOENIX - PNNL Hanford Online Environmental Information Exchange - Hanford

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Site PHOENIX - Hanford Site Data About Us PHOENIX - PNNL Hanford Online Environmental Information Exchange Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size NEW! PNNL just launched the latest addition to the PHOENIX Web Application - PHOENIX Tanks! Click the button at the bottom of this page to go to PHOENIX Tanks. The PNNL Hanford Online Environmental Information Exchange (PHOENIX) was launched to improve public access to public data and to enhance decision