National Library of Energy BETA

Sample records for mail fax secure

  1. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  2. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  3. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  4. FAX

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FATIGUE DESIGN CURVES FOR 6061-T6 ALUMINUM* G . T . Yahr Engineering Technology Division Oak Ridge National Laboratory Oak Ridge, Tennessee 37831-8051 ABSTRACT A request has been made to the ASME Boiler and Pressure Vessel Committee that 6061-T6 aluminum be approved for use in the construction of Class 1 welded nuclear vessels so it can be used for the pressure vessel of the Advanced Neutron Source research reactor. Fatigue design curves with and without mean stress effects have been proposed. A

  5. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  12. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  13. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  14. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  15. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA Production Office Contact Us Contact Us NPO Public Affairs Manager Steven Wyatt (865) 576-9918 NPO Mailing Address NNSA Production Office PO Box 2050 Oak Ridge, TN 37831 Fax...

  16. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  17. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  18. Security

    Broader source: Energy.gov [DOE]

    Security refers to the security of the stream of principal and interest repayments and what happens in the event that a secured loan defaults.

  19. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  20. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  1. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  2. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  3. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  4. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  5. security

    National Nuclear Security Administration (NNSA)

    exan-Calvin-Nelson-secures-recognition-for-expertise.aspx">Pantex website.

    Apex Gold discussion fosters international cooperation in run-up to 2016 Nuclear Security Summit...

  6. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  7. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  8. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  9. Facility Security Officer Contractor Toolcart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OPSEC What is OPSEC? Millitary term for Operations Security Five-step process / Simplified Two-step Supplements formal security disciplines Industry wide (private and govt.) Goals of OPSEC To raise security awareness Make intelligence or information gathering difficult To attempt to stop adversaries from obtaining classified or sensitive information Basic OPSEC Practices Properly handle and destroy classified and sensitive unclassified information Phones, Cell phones, faxes, and radios are

  10. Security Conditions

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-09-18

    To ensure that DOE uniformly meets the protection requirements specified in Presidential Decision Directive 39, "U.S. Policy on Counterterrorism (U)." Attachment 2 is no longer available online. Please e-mail your request for the Attachment to: Security.Directives@hq.doe.gov. DOE N 251.44, dated 05/06/02, extends this directive until 12/31/02.

  11. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  12. National Security Science | Los National Alamos Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this Issue (pdf) In 2012 NSS received an NNSA Defense Programs AWARD OF EXCELLENCE National Security Science Mail Stop A142 Los Alamos National Laboratory Los Alamos, NM...

  13. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  14. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  15. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  16. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  17. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  18. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  19. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    For general information about NNSA, please feel free to contact us: Mailing Address National Nuclear Security Administration U.S. Department of Energy 1000 Independence Ave., S.W. ...

  20. An Equal Opportunity Employer / Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's NNSA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    An Equal Opportunity Employer / Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's NNSA Associate Directorate for Business Innovation To/MS: Master Management From/MS: Carolyn Zerkle, ADBI, B254 Phone/Fax: 6-0636/Fax 6-0532 Symbol: ADBI-14-012 Date: October 27, 2014 SUBJECT: SUPPORT FOR SUBCONTRACTING OPPORTUNITIES WITH SMALL BUSINESSES Los Alamos National Laboratory has maintained a strong institutional commitment to small business subcontracting over the years

  1. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  2. Full page fax print

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Other major miscellaneous inputs Internal to the Tank Farm ... Salt crystallized from high-heat waste and low-heat waste is ... The rotary kiln primary combustion chamber will be used ...

  3. Full page fax print

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 (U) April 26, 1995 Westinghouse Savannah River Company Savannah River S~e Aiken, SC 29808 HLW-OVP-95-0031 @ Westinghouse Savannah River Company. April 27, 1995 A. B. Scoa, Jr. Va Preoident and General...,. Hgh Level Was .. ManagamenI DiviIion P. O. Box 61' Allen, SC 29602 HLW-OVP-95-0031 Keywords: Retention: High Level W88te SyslemPIan Production Plan 25 years, offer to NARA at end of retention. Disposal Auth: DOEF 1324.5 95-0002 Track .: 7605 File Record: 773-52A, Records Mr. Steven D.

  4. Fax Cover Sheet

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Council) Noah Horowitz (Natural Resources Defense Council) (by phone) Jennifer Thorne Amann (American Council for an Energy-Efficient Economy) Neal Goldberg (National Cable ...

  5. Full page fax print

    National Nuclear Security Administration (NNSA)

  6. Full page fax print

    National Nuclear Security Administration (NNSA)

  7. Full page fax print

    Office of Legacy Management (LM)

  8. Full page fax print

    Office of Scientific and Technical Information (OSTI)

    )lIJfjlHfllmj)mmllillruJt ((I(m(ti.JmlmmmlllWI ll .. . I*mw lffi )( HI I) SOVELEV RECELEV 40 40 Immlll1 illllmJil11)Immm lfm lli m l.lmillm(mj...

  9. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  10. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  11. How Do You Report A Concern? | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    How Do You Report A Concern? DOE/NNSA Federal, contractor and subcontractor employees may report their concerns to the Employee Concerns Program by: Completing the reporting form Faxing your concern to:(505) 845-4020 Mailing your concern to: DOE/NNSA/SC ECP P. O. Box 5400 Albuquerque, NM 87185-5400 Visit your local ECP Office. Sending email to: ecp@doeal.gov Calling the ECP 24-Hour Hotline to report your concerns at:1-800-688-5713 Or to make an appointment to meet with someone face to face at

  12. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  13. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  14. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  15. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  16. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  17. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  18. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  19. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  20. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  1. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  2. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  3. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  4. 16th Department of Energy Computer Security Group Training Conference: Proceedings

    SciTech Connect (OSTI)

    Not Available

    1994-04-01

    Various topic on computer security are presented. Integrity standards, smartcard systems, network firewalls, encryption systems, cryptography, computer security programs, multilevel security guards, electronic mail privacy, the central intelligence agency, internet security, and high-speed ATM networking are typical examples of discussed topics. Individual papers are indexed separately.

  5. safety and security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    safety and security

  6. Nevada National Security Site Waste Acceptance Criteria

    SciTech Connect (OSTI)

    NSTec Environmental Management

    2010-09-03

    This document establishes the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Nevada National Security Site Waste Acceptance Criteria (NNSSWAC). The NNSSWAC provides the requirements, terms, and conditions under which the Nevada National Security Site (NNSS) will accept low-level radioactive waste and mixed low-level waste for disposal. The NNSSWAC includes requirements for the generator waste certification program, characterization, traceability, waste form, packaging, and transfer. The criteria apply to radioactive waste received at the NNSS Area 3 and Area 5 Radioactive Waste Management Complex for disposal. The NNSA/NSO and support contractors are available to assist you in understanding or interpreting this document. For assistance, please call the NNSA/NSO Waste Management Project at (702) 295-7063 or fax to (702) 295-1153.

  7. Nevada National Security Site Waste Acceptance Criteria

    SciTech Connect (OSTI)

    NSTec Environmental Management

    2011-01-01

    This document establishes the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Nevada National Security Site Waste Acceptance Criteria (NNSSWAC). The NNSSWAC provides the requirements, terms, and conditions under which the Nevada National Security Site (NNSS) will accept low-level radioactive waste and mixed low-level waste for disposal. The NNSSWAC includes requirements for the generator waste certification program, characterization, traceability, waste form, packaging, and transfer. The criteria apply to radioactive waste received at the NNSS Area 3 and Area 5 Radioactive Waste Management Complex for disposal. The NNSA/NSO and support contractors are available to assist you in understanding or interpreting this document. For assistance, please call the NNSA/NSO Waste Management Project at (702) 295-7063 or fax to (702) 295-1153.

  8. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  9. Security Policy

    Broader source: Energy.gov [DOE]

    The Office of Security Policy analyzes, develops and interprets safeguards and security policy governing national security functions and the protection of related critical assets entrusted to the...

  10. An Equal Opportunity Employer / Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's NNSA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    An Equal Opportunity Employer / Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's NNSA Ethics and Audit Division To/MS: All Employees From/MS: Jeanette Y. Bennion, EA-DO, A249 Phone/Fax: 5-3104/Fax 7-7340 Symbol: EA-DO-15-029 Date: November 19, 2014 SUBJECT: CODE OF CONDUCT REGARDING HOLIDAY GIFTS Holiday season is here again, and we need to remember our responsibilities as Laboratory employees. The holiday season brings gifts and invitations to open houses from

  11. Security Specialist

    Broader source: Energy.gov [DOE]

    This position is located in the Office of Security Policy, Office of Security, Office of the Associate Under Secretary for Environment, Health, Safety, and Security (AU). The Office of Security...

  12. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Contact Us If you have questions about activities at the Sandia Field Office, please contact the SFO Public Affairs Director at (505) 845-5264. Our mailing address is: U. S. Department of Energy, National Nuclear Security Administration, Sandia Field Office, P.O. Box 5400, Albuquerque, NM 87185

  13. Electronic Comment Form | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Electronic Comment Form Draft site-wide environmental impact statement for the continued operation of the DOE/NNSA Nevada National Security Site and off-site locations in the State of Nevada. DOE/NNSA will accept comments until December 2, 2011 Name * E-mail (optional) Organization Comment * Leave this field blank Submit

  14. U.S. Department of Energy National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration 2009 Report to the President Executive Order 13171 on Hispanic Employment DOE Program Office/Site:_________________National Nuclear Security Administration Human Resources Director:____________________________________ David Amaral Diversity and Outreach Manager:______________________________Mary Ann Fresco EEO & Diversity Program Manager:______________________________Yolanda Girón Submission Contact E-mail

  15. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  16. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  17. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  18. Privacy and Security Research Group workshop on network and distributed system security: Proceedings

    SciTech Connect (OSTI)

    Not Available

    1993-05-01

    This report contains papers on the following topics: NREN Security Issues: Policies and Technologies; Layer Wars: Protect the Internet with Network Layer Security; Electronic Commission Management; Workflow 2000 - Electronic Document Authorization in Practice; Security Issues of a UNIX PEM Implementation; Implementing Privacy Enhanced Mail on VMS; Distributed Public Key Certificate Management; Protecting the Integrity of Privacy-enhanced Electronic Mail; Practical Authorization in Large Heterogeneous Distributed Systems; Security Issues in the Truffles File System; Issues surrounding the use of Cryptographic Algorithms and Smart Card Applications; Smart Card Augmentation of Kerberos; and An Overview of the Advanced Smart Card Access Control System. Selected papers were processed separately for inclusion in the Energy Science and Technology Database.

  19. Security Officer

    Broader source: Energy.gov [DOE]

    This position is located in the Security and Continuity of Operations (NN) organization of the Chief Administrative Office (N), Bonneville Power Administration. The Security and Continuity of...

  20. National Security and Cyber Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Security and Cyber Security National Security and Cyber Security National security depends on science and technology. The United States relies on Los Alamos National Laboratory for the best of both. No place on Earth pursues a broader array of world-class scientific endeavors. Contact thumbnail of Business Development Business Development Richard P. Feynman Center for Innovation (505) 665-9090 Email National security and weapons science at the laboratory spans essentially all the

  1. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  2. Safety, Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety, Security Safety, Security The Lab's mission is to develop and apply science and technology to ensure the safety, security, and reliability of the U.S. nuclear deterrent; reduce global threats; and solve other emerging national security and energy challenges. Contact Operator Los Alamos National Laboratory (505) 667-5061 We do not compromise safety for personal, programmatic, or operational reasons. Safety: we integrate safety, security, and environmental concerns into every step of our

  3. Security Perimeter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Perimeter Security Perimeter Protecting the Laboratory against threats and vulnerabilities. Contact Security Perimeter Coordinators Email The security perimeter helps to protect the Laboratory Vehicle Access Portal graphic The security perimeter is intended to protect the Laboratory against the possibility of terrorist attacks. At each point of the perimeter, access is controlled by vehicle access portals (VAPs) at the following locations: East Jemez Road VAPs (pdf) (shown above) West

  4. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  5. Water Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SunShot Grand Challenge: Regional Test Centers Water Security HomeTag:Water Security Electricity use by water service sector and county. Shown are electricity use by (a) ...

  6. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  7. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  8. Radiological Security Partnership | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration Programs / Nonproliferation / Global Material Security / Radiological Security Radiological Security Partnership Radiological Security Partnership Secure Your Business, Your Community, and Your Country. Sign Up Today for Services Provided by the Radiological Security Partnership. RSP Logo Initiative of the Global Material Security Program Formerly the Global Threat Reduction Initiative RSP Registration RSP More Info Learn More Radiological Secur

  9. Global security

    SciTech Connect (OSTI)

    Lynch, Patrick

    2014-07-14

    Patrick Lynch helps technical staff, academic leaders and governments around the world improve the safety and security of their nuclear power programs.

  10. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering ...

  11. Global security

    ScienceCinema (OSTI)

    Lynch, Patrick

    2014-07-15

    Patrick Lynch helps technical staff, academic leaders and governments around the world improve the safety and security of their nuclear power programs.

  12. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    From a Department of Defense (DoD) perspective, SMrs offer great advantage for energy security with stable fuel cost profiles, a secure installation for meeting base-load power demands with a robust, secured reactor design (i.e., energy security), potential to provide potable water and synthetic fuels, and a means to exceed DoD greenhouse gases (GhG) reduction goals. While presently SMrs are being proposed based on various reactor technologies, SMrs based on light-water reactor (lWr)

  13. physical security

    National Nuclear Security Administration (NNSA)

    5%2A en Physical Security Systems http:nnsa.energy.govaboutusourprogramsnuclearsecurityphysicalsecuritysystems

  14. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Small Modular reactors projects. the collaboration takes place under the umbrella of a joint oUSnl "Center for Energy, Security and Society". the Center serves to...

  15. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  16. security | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    security Apex Gold discussion fosters international cooperation in run-up to 2016 Nuclear Security Summit Participants in Apex Gold at Lawrence Livermore National Laboratory. What would national leaders do in the face of a transnational nuclear terrorism threat? Last week, ministers and other senior delegates from 37 nations, along with representatives from the International Atomic Energy Agency, the... Pantex Plant's Calvin Nelson honored as Analyst of the Year for Transportation Security

  17. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    all of our reactor designs employ a concurrent engineering approach that addresses the integration of safety, operations, security, and safeguards from the conceptual design level. Capabilities include core design, thermal hydraulics, waste characterization, simulator development, and severe service and accident testing. Design assessments include: safety, security, vulnerability, siting, emergency planning, and fuel cycle impact. organization 6221 serves as a window to sister organizations

  18. Nuclear Security Enterprise | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Our Programs Defense Programs Nuclear Security Enterprise The Nuclear Security Enterprise (NSE) mission is to ensure the Nation sustains a safe, secure, and effective ...

  19. Secure Manufacturing | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Secure Manufacturing Secure Manufacturing The depth and breadth of Y-12's manufacturing capabilities and expertise enable Y-12 to address current and emerging national security...

  20. Secure PVM

    SciTech Connect (OSTI)

    Dunigan, T.H.; Venugopal, N.

    1996-09-01

    This research investigates techniques for providing privacy, authentication, and data integrity to PVM (Parallel Virtual Machine). PVM is extended to provide secure message passing with no changes to the user`s PVM application, or, optionally, security can be provided on a message-by message basis. Diffe-Hellman is used for key distribution of a single session key for n-party communication. Keyed MD5 is used for message authentication, and the user may select from various secret-key encryption algorithms for message privacy. The modifications to PVM are described, and the performance of secure PVM is evaluated.

  1. Security Conditions

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2004-07-08

    This Notice ensures that DOE uniformly meets the requirements of the Homeland Security Advisory System outlined in Homeland Security Presidential Directive-3, Threat Conditions and Associated Protective Measures, dated 3-11-02, and provides responses specified in Presidential Decision Directive 39, U.S. Policy on Counterterrorism (U), dated 6-21-95. It cancels DOE N 473.8, Security Conditions, dated 8-7-02. Extended until 7-7-06 by DOE N 251.64, dated 7-7-05 Cancels DOE N 473.8

  2. Implementation of a parallel multilevel secure process. Master's thesis

    SciTech Connect (OSTI)

    Pratt, D.R.

    1988-06-01

    This thesis demonstrates an implementation of a parallel multilevel secure process. This is done within the framework of an electronic-mail system. Security is implemented by GEMSOS, the operating system of the Gemini Trusted Computer Base. A brief history of computer secrecy is followed by a discussion of security kernels. Event counts and sequences are used to provide concurrency control and are covered in detail. The specifications for the system are based upon the requirements for a Headquarters of a hypothetical Marine Battalion in garrison.

  3. Personnel Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-08-26

    The manual establishes the overall objectives and requirements for the Department of Energy Personnel Security Program. Cancels DOE M 472.1-1B. Canceled by DOE O 472.2.

  4. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy Nuclear

  5. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-20

    The protection and control of classified information is critical to our nations security. This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. Cancels DOE M 470.4-4A Chg except for Section D.

  6. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy Nuclear

  7. Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Two-hundred twenty-five nonprofit organizations receive monetary donations from Los Alamos National Security, LLC September 21, 2015 Recognizing employee and retiree volunteer efforts LOS ALAMOS, N.M., Sept. 21, 2015-More than 225 nonprofit organizations received $162,650 from Los Alamos National Security, LLC, which manages Los Alamos National Laboratory. The LANS contributions are determined by the number of volunteer hours logged by Laboratory employees and retirees through an organization

  8. Personnel Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-07-27

    The Order establishes requirements for a successful, efficient and cost-effective personnel security program to ensure accurate, timely and equitable determinations of individuals eligibility for access to classified information and fitness for placement or retention in national security positions. Cancels DOE M 470.4-5, DOE N 470.4 and DOE N 470.5. Admin Chg 1, 10-8-13.

  9. Security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Security The Y-12 National Security Complex places the highest priority on maintaining and improving its security posture. We employ security police officers, cyber security specialists, and other personnel to safeguard our security assets. Y-12 continuously monitors local and world events to prepare for potential risks to the site, our information and our employees. Security personnel also participate in numerous assessments each year to ensure readiness in protecting the site's vital

  10. National Nuclear Security Administration | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

  11. Radiological Security Partnership Information | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration Nonproliferation / Global Material Security / Radiological Security / Radiological Security Partnership Radiological Security Partnership Information Radioactive sources play an important role in a number of commercial, medical, and research facilities. The benefits of these sources must be balanced with proper security. The Department of Energy's (DOE) National Nuclear Security Administration (NNSA) is working with the Nuclear Regulatory Commission and state regulators,

  12. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  13. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  14. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-06-29

    Establishes security requirements for the protection and control of information and matter required to be classified or controlled by statutes, regulations, or Department of Energy directives. Section E, Technical Surveillance Countermeasures Program, is Official Use Only. Please contact the DOE Office of Health, Safety and Security at 301-903-0292 if your official duties require you to have access to this part of the directive. Cancels: DOE M 471.2-1B, DOE M 471.2-1C, DOE M 471.2-4, and DOE O 471.2A

  15. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-08-26

    This Manual establishes security requirements for the protection and control of information and matter required to be classified or controlled by statutes, regulations, or Department of Energy directives. Attachment E, Technical Surveillance Countermeasures Program, is for Official Use Only. Contact the Office of Security and Safety Performance Assurance at 301-903-3653 if your official duties require you to have access to this part of the directive. Cancels: DOE M 471.2-1B, DOE M 471.2-1C, DOE M 471.2-4, and DOE O 471.2A.

  16. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-20

    The protection and control of classified information is critical to our nations security. This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. Cancels DOE M 470.4-4A Chg except for Section D. Admin Chg 1, dated 11-23-2012, cancels DOE O 471.6. Canceled by Admin Chg 2 dated 5-15-15.

  17. Computer Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Computer Security All JLF participants must fully comply with all LLNL computer security regulations and procedures. A laptop entering or leaving B-174 for the sole use by a US citizen and so configured, and requiring no IP address, need not be registered for use in the JLF. By September 2009, it is expected that computers for use by Foreign National Investigators will have no special provisions. Notify maricle1@llnl.gov of all other computers entering, leaving, or being moved within B 174. Use

  18. Defense Nuclear Security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Programs Defense Nuclear Security The Office of Defense Nuclear Security develops and implements NNSA security programs to protect, control, and account for materials, information, and facilities across the nuclear security enterprise. The Office of the Chief, Defense Nuclear Security (CDNS) executes responsibility for the overall direction and management of security programs employed across the nuclear security enterprise comprised of NNSA's operations and facilities. The CDNS is charged with

  19. Y-12 National Security Compex | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Y-12 National Security Compex

  20. Personnel Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-07-21

    The order establishes requirements that will enable DOE to operate a successful, efficient, cost-effective personnel security program that will ensure accurate, timely and equitable determinations of individuals eligibility for access to classified information and Special Nuclear Material (SNM). Admin Chg 1, 10-8-13.

  1. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  2. Security Rulemaking | Department of Energy

    Office of Environmental Management (EM)

    Rulemaking Security Rulemaking Transportation Security Rulemaking Activities PDF icon Security Rulemaking More Documents & Publications Transportation Security Rulemaking...

  3. Nuclear security

    SciTech Connect (OSTI)

    Not Available

    1991-07-01

    This paper reports that despite an Executive Order limiting the authority to make original classification decisions to government officials, DOE has delegated this authority to a number of contractor employees. Although the number of original classification decisions made by these contractors is small, this neither negates nor diminishes the significance of the improper delegation of authority. If misclassification were to occur, particularly at the Top Secret level, U.S. national security interests could potentially be seriously affected and threatened. DOE's argument that the delegation of such authority is a long-standing policy and done on a selective basis does not legitimize the practice and does not relieve DOE of its responsibility to meet the requirements of the Executive Order. DOE needs to independently assess all original classification determinations made by contractors; otherwise, it cannot be sure that U.S. national security interests have been or are being adequately protected.

  4. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND2014-0672P Sandia National Laboratories is developing a thermal-to-electric power conversion technology that utilizes carbon dioxide (CO2) as the working fluid in a closed Brayton cycle. This technology possesses the capability to generate electricity at high efficiencies while reducing both costs and greenhouse gas emissions.

  5. Security system

    DOE Patents [OSTI]

    Baumann, Mark J.; Kuca, Michal; Aragon, Mona L.

    2016-02-02

    A security system includes a structure having a structural surface. The structure is sized to contain an asset therein and configured to provide a forceful breaching delay. The structure has an opening formed therein to permit predetermined access to the asset contained within the structure. The structure includes intrusion detection features within or associated with the structure that are activated in response to at least a partial breach of the structure.

  6. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-29

    This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. (The original DOE O 471.6 canceled DOE M 470.4-4A, except for Section D). Admin Chg 2, dated 5-15-15, supersedes Admin Chg 1. Certified 5-21-2015.

  7. Security seal

    DOE Patents [OSTI]

    Gobeli, Garth W.

    1985-01-01

    Security for a package or verifying seal in plastic material is provided by a print seal with unique thermally produced imprints in the plastic. If tampering is attempted, the material is irreparably damaged and thus detectable. The pattern of the imprints, similar to "fingerprints" are recorded as a positive identification for the seal, and corresponding recordings made to allow comparison. The integrity of the seal is proved by the comparison of imprint identification records made by laser beam projection.

  8. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ExcEptional sErvicE in thE national intErEst Investigating Containment Integrity Sandia is a nationally and internationally recognized leader in Nuclear Reactor containment research, supporting operations, lifetime extensions, and security and vulnerability assessments over a broad range of phenomena. Sandia's expertise includes evaluation of containment when subjected to high velocity impacts, enormous pressures and stresses, and attacks by saboteurs. Sandia's resources enable the completion of

  9. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to enhance the nation's security and prosperity through sustainable, transformative approaches to our most challenging energy, climate, and infrastructure problems. vision Important applications of these capabilities include performing assessment of facility vulnerabilities and resultant consequences of a range of attack scenarios related to nuclear facilities after 9/11. these comprehensive analyses were able to realistically represent the actual attack, the response of the facility to the

  10. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to enhance the nation's security and prosperity through sustainable, transformative approaches to our most challenging energy, climate, and infrastructure problems. vision applications to Systems assessment over the last three decades, Snl has developed and applied a Systems Engineering (SE) approach that includes performance assessment (pa) expertise to inform key decisions concerning radioactive waste management both in the US and internationally. the result of these efforts is a pa-based SE

  11. Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the computational, physics, and engineering capability spans multiple physics phenomenologies, engineering disciplines, and brings to bear massively parallel processing computational power to solve very complex problems that result in realistic estimates of potential consequences resulting from these types of postulated accidents. the Sar that is developed must go through rigorous external review before it goes to the national Security Council for approval prior to launch. this process provides

  12. Security Rulemaking

    Office of Environmental Management (EM)

    Securing America's Clean Energy Future The Office of Energy Efficiency and Renewable Energy (EERE) invests in clean energy technologies that strengthen the economy, reduce dependence on foreign oil, and protect the environment. EERE leverages partnerships with the private sector, state and local governments, DOE national laboratories, and universities to transform the nation's economic engine to one powered by clean energy. EERE Programs 2011 Budget (in $ millions) EERE operates with $1.8

  13. Global Security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    sector. Global Security Cooley joins Y-12's Global Security and Strategic Partnerships Manufacturing and Technical Services Nuclear Material Recovery Nuclear Detection and...

  14. Headquarters Security Quick Reference Book Headquarters Security...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Directive HSS Office of Health, Safety and Security HQ ... Regulations 707, a negative drug test result is required ... knowledgeable of security policy at HQ. Consult the HQFMSP ...

  15. physical security | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    physical security | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  16. defense nuclear security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nuclear security | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear ...

  17. Information Security: Coordination of Federal Cyber Security...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Security: Coordination of Federal Cyber Security Research and Development GAO recommends that the Office of Science and Technology Policy establish timelines for ...

  18. Personnel Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-07-21

    The order establishes requirements that will enable DOE to operate a successful, efficient, cost-effective personnel security program that will ensure accurate, timely and equitable determinations of individuals’ eligibility for access to classified information and Special Nuclear Material (SNM). This limited revision will ensure that individuals holding dual citizenship receive proper consideration from a counterintelligence perspective prior to being granted access to classified matter or Special Nuclear Material. Pg Chg 1, 7-9-14 supersedes DOE O 472.2 Admin Chg 1.

  19. Radiological Security Program | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Radiological Security Program Armenia Secures Dangerous Radioactive Sources in Cooperation with NNSA The Department of Energy's National Nuclear Security Administration (NNSA) joined the Republic of Armenia today to announce the safe and secure removal of three unused radioactive sources from two locations in Yerevan, Armenia. The successful completion of the radioactive source recovery campaign

  20. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  1. Security Notice | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Notice Security Notice Security Information This website is part of a federal computer system used to accomplish federal functions. Y-12 uses software programs to monitor this website for security purposes to ensure it remains available to all users and to protect information in the system. By accessing this website, you are expressly consenting to these monitoring activities. Unauthorized attempts to defeat or circumvent security features; to use the system for other than intended

  2. Global Material Security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Nonproliferation Global Material Security The mission of the Office of Global Material Security (GMS) is to help partner countries secure and account for nuclear weapons, weapons-useable nuclear and radiological materials, as well as to build capacity to deter, detect and interdict the illicit trafficking of such materials. GMS achieves its mission through three subprograms: International Nuclear Security Radiological Security Nuclear Smuggling Detection and Deterrence (formerly Second Line of

  3. International Nuclear Security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    International Nuclear Security The International Nuclear Security program collaborates with partners world-wide to improve the security of proliferation-sensitive materials, particularly weapons-usable nuclear material in both civilian and non-civilian use in key countries. As part of these efforts, INS works with partner countries to: Upgrade and sustain physical security and material control and accounting systems; Develop national-level nuclear security infrastructure in areas such as

  4. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  5. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  6. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  7. NERSC Computer Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security NERSC Computer Security NERSC computer security efforts are aimed at protecting NERSC systems and its users' intellectual property from unauthorized access or modification. Among NERSC's security goal are: 1. To protect NERSC systems from unauthorized access. 2. To prevent the interruption of services to its users. 3. To prevent misuse or abuse of NERSC resources. Security Incidents If you think there has been a computer security incident you should contact NERSC Security as soon as

  8. Energy Security Council

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NSEC » Energy Security Council Energy Security Council Reliable, secure, sustainable carbon energy solutions for the nation. Contact Albert Migliori (505) 663-5627 Email David Morris (505) 665 6487 Email David Watkins (50)5 665-1144 Email Energy Security Council The Los Alamos National Laboratory Energy Security Council works to develop new ideas for reliable, secure and sustainable carbon neutral energy solutions for the nation. We serve as the portal to LANL's diverse energy security research

  9. Headquarters Facilities Master Security Plan- Chapter 10, Security Awareness Program

    Broader source: Energy.gov [DOE]

    2016 Headquarters Facilities Master Security Plan - Chapter 10, Security Awareness Program Describes the DOE Headquarters Security Awareness Program

  10. Headquarters Facilities Master Security Plan- Chapter 8, Operations Security Program

    Broader source: Energy.gov [DOE]

    2016 Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program Describes the DOE Headquarters Operations Security (OPSEC) Program.

  11. Headquarters Facilities Master Security Plan- Chapter 14, Cyber Security

    Broader source: Energy.gov [DOE]

    2016 Headquarters Facilities Master Security Plan - Chapter 14, Cyber Security Describes the DOE Headquarters Cyber Security Program.

  12. Security for grids

    SciTech Connect (OSTI)

    Humphrey, Marty; Thompson, Mary R.; Jackson, Keith R.

    2005-08-14

    Securing a Grid environment presents a distinctive set of challenges. This paper groups the activities that need to be secured into four categories: naming and authentication; secure communication; trust, policy, and authorization; and enforcement of access control. It examines the current state of the art in securing these processes and introduces new technologies that promise to meet the security requirements of Grids more completely.

  13. Headquarters Facilities Master Security Plan - Chapter 10, Security...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    receives hisher security clearance; the Annual Security Refresher Briefing, which must be completed each year by all those who hold a security clearance; and the Security ...

  14. Headquarters Facilities Master Security Plan- Chapter 3, Personnel Security

    Broader source: Energy.gov [DOE]

    2016 Headquarters Facilities Master Security Plan - Chapter 3, Personnel Security Describes DOE Headquarters Personnel Security procedures for acquiring, maintaining, and passing security clearances.

  15. Nuclear Security Enterprise | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Study options for ensuring the safety, security, and reliability of nuclear warheads on a ... required to ensure the long-term safety, security, and reliability of the nuclear arsenal.

  16. Security guide for subcontractors

    SciTech Connect (OSTI)

    Adams, R.C.

    1991-01-01

    This security guide of the Department of Energy covers contractor and subcontractor access to DOE and Mound facilities. The topics of the security guide include responsibilities, physical barriers, personnel identification system, personnel and vehicular access controls, classified document control, protecting classified matter in use, storing classified matter repository combinations, violations, security education clearance terminations, security infractions, classified information nondisclosure agreement, personnel security clearances, visitor control, travel to communist-controlled or sensitive countries, shipment security, and surreptitious listening devices.

  17. Information Technology Specialist (Security)

    Broader source: Energy.gov [DOE]

    A successful candidate in this position will serve as an Information Technology Specialist (Security) responsible for providing technical support in the information security environment which...

  18. Advancing Global Nuclear Security

    Broader source: Energy.gov [DOE]

    Today world leaders gathered at The Hague for the Nuclear Security Summit, a meeting to measure progress and take action to secure sensitive nuclear materials.

  19. Personnel Security Specialist

    Broader source: Energy.gov [DOE]

    This position is located in the Office of Associate Under Secretary for Environment, Health, Safety, and Security (AU), Office of Headquarters Personnel Security Operations. A successful candidate...

  20. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal ... of September 24, 2011 3 The Department of Energy (DOE) National Nuclear Security ...

  1. National Security, Weapons Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Security, Weapons Science National security depends on science and technology. The United States relies on Los Alamos National Laboratory for the best of...

  2. Personnel Security Activities

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2003-03-25

    Establishes objectives, requirements and responsibilities for the Personnel Security Program and Personnel Security Assurance Program. Cancels DOE O 472.1B

  3. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: michele.altieri@go.doe.gov Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...

  4. CONTRACT EMPLOYEES

    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  5. Scott Campbell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Operations Technology Storage Systems User Engagement Application Performance NESAP Postdocs Org Chart NERSC History NERSC Stakeholders Usage and User Demographics Careers Visitor Info Web Policies Home » About » Staff » Networking & Security » Scott Campbell Scott Campbell scampbell.jpg Scott Campbell Security Team Networking, Servers and Security Group SCampbell@lbl.gov Phone: (510) 486-6986 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical

  6. Radiological Security Partnership | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Programs / Nonproliferation / Global Material Security / Radiological Security Radiological Security Partnership Radiological Security Partnership Secure Your Business, Your Community, and Your Country. Sign Up Today for Services Provided by the Radiological Security Partnership. RSP Logo Initiative of the Global Material Security Program Formerly the Global Threat Reduction Initiative RSP Registration RSP More Info Learn More Radiological Security Partnership Information

  7. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  8. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  9. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  10. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  11. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  12. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  13. Office of Security Assistance

    Broader source: Energy.gov [DOE]

    The Office of Security Assistance manages the Technology Deployment Program to improve the security posture of the Department of Energy and the protection of its assets and facilities through the deployment of new safeguards and security technologies and development of advanced technologies that reduce operating costs, save protective force lives, and improve security effectiveness.

  14. Personnel Security Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1998-05-22

    This Manual provides detailed requirements and procedures to supplement DOE O 472.1B, Personnel Security Activities, which establishes the overall objectives, requirements, and responsibilities for implementation and operation of the Personnel Security Program and the Personnel Security Assurance Program in the Department of Energy (DOE). This Manual addresses only the Personnel Security Program.

  15. Personnel Security Program Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-11-16

    provides detailed requirements and procedures to supplement DOE O 472.1B, PERSONNEL SECURITY ACTIVITIES, which establishes the overall objectives, requirements, and responsibilities for implementation and operation of the Personnel Security Program and the Personnel Security Assurance Program in the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE M 472.1-1

  16. Nuclear Security Summit | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Nuclear Security Summit U.S. and China Continue Cooperative Partnership to Advance Safe, Secure Civil Nuclear Energy for Clean Energy Future DOE/NNSA Hosts 11th U.S.-China Peaceful Uses of Nuclear Technology Meeting at Savannah River National Laboratory in Aiken, South Carolina (Aiken, South Carolina) - On May 10-11, 2016 the U.S. Department of Energy's (DOE) National Nuclear Security Administration (NNSA) and the China... Statement on Signing of the Administrative Arrangement to the Agreement

  17. Radiological Security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    About / Our Programs / Nonproliferation / Global Material Security Radiological Security The program collaborates with domestic and international partners to address the threat of illicit use of high-priority radiological materials in the United States and abroad. The Radiological Security program accomplishes its mission by removing and disposing of excess or orphaned radioactive sources; promoting the replacement of radioactive sources with non-isotopic technologies, where feasible; and

  18. Security Forms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Security Forms U.S. Department of Energy / U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards System Security Forms Federal Information Processing Standards Publications (FIPS PUBS) FIPS-Associated Documents FIPS 140-2 Security Requirements for Cryptograhic Modules FIPS 185 Escrowed Encryption Standard (EES) FIPS 186-2 Digital Signature Standard (DSS) From Microsoft From VeriSign Managing Contacts' Digital Certificates with Netscape Communicator Managing Contacts'

  19. National Nuclear Security Administration | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration Rights / Workforce Statistics National Nuclear Security Administration FY15 Year End Report Semi Annual Report FY14 Year End Report Semi Annual Report

  20. nuclear security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    25M NNSA Grant for Nuclear Science and Security Research Working With PNNL Mentors, Engineering Students Deliver Prototype Safeguards Fixtures Shaping the future of nuclear ...

  1. Tag: security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    our website, please follow these instructions. More... Category: Security Emergency Vocabulary These are terms you might hear during an emergency situation. More... Category:...

  2. Nuclear Security 101 | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Twenty-eight nations have plans to eliminate all current stocks of HEU by the end of 2013. Upgrading security measures, including physical protection, material control and ...

  3. Physical Security Systems | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Announces 2014 Security Professional of the Year Awards Michael Lempke receives NNSA's Gold Medal of Excellence NNSA's Nevada Field Office Transfers Two Armored Vehicles to FBI...

  4. port security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    port security NNSA Transfers Responsibility for Radiation Detection System to China Customs SHANGHAI, CHINA - Today, the Nuclear Security Administration's (NNSA) Principal Assistant Deputy Administrator for Defense Nuclear Nonproliferation (DNN), David Huizenga, participated in a ceremony commemorating the transition of a radiation detection system at the Port of Yangshan to the General

  5. Kansas City National Security Campus | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    Operations Acquisition and Project Management M & O Support Department Kansas City National Security Campus Kansas City National Security Campus National Security Campus ...

  6. Using Operational Security (OPSEC) to Support a Cyber Security...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a Cyber Security Culture in Control Systems Environments Using Operational Security (OPSEC) to Support a Cyber Security Culture in Control Systems Environments This document ...

  7. T-592: Cisco Security Advisory: Cisco Secure Access Control System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advisory: Cisco Secure Access Control System Unauthorized Password Change Vulnerability T-592: Cisco Security Advisory: Cisco Secure Access Control System Unauthorized Password ...

  8. SECURITY AND CYBER REPORTS | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SECURITY AND CYBER REPORTS SECURITY AND CYBER REPORTS Office of Security Assessments Office of Security Assessments - Report Titles

  9. Security - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security by Website Administrator Back

  10. Office of Information Security

    Broader source: Energy.gov [DOE]

    The Office of Information Security is responsible for implementation of the Classified Matter Protection and Control Program (CMPC), the Operations Security Program (OPSEC) and the Facility Clearance Program and the Survey Program for Headquarters

  11. nevada national security site

    National Nuclear Security Administration (NNSA)

    7%2A en Nevada National Security Site operator recognized for green fleet http:www.nnsa.energy.govblognevada-national-security-site-operator-recognized-green-fleet

    The...

  12. Office of Security Policy

    Broader source: Energy.gov [DOE]

    The Office of Security Policy is the central source within the Department of Energy for the development and analysis of safeguards and security policies and standards affecting facilities, nuclear materials, personnel, and classified information.

  13. Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Home Y-12 National Security Complex Home Nuclear Deterrence Global Security Naval Reactors Partnerships Security News Search form Search... Search Latest News | CNS, UT chemical...

  14. National Security Science Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NSS Archive National Security Science Latest Issue:April 2016 past issues All Issues » submit National Security Science Archive National Security Science magazine showcases the importance, breadth, and depth of the Laboratory's scientific and technical work that is used to solve key challenges to U.S. national security. NSS April 2016 April 2016 viewer | web | print NSS July 2014 July 2015 viewer | web | print NSS July 2014 December 2014 viewer | web | print NSS July 2014 July 2014 viewer | web

  15. Lemnos Interoperable Security Program

    Energy Savers [EERE]

    Lemnos Interoperable Security Program Creating common language and metrics for describing functions of network security tools and testing for interoperability As energy control systems employ more Internet-based features and routable communication methods, the need grows for enhanced security functions, such as frewalls, virtual private networks (VPNs), and intrusion detection systems. When purchasing network security products, today's control systems users cannot adequately compare products

  16. Security Risk Assessment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy ... Hydrogen Infrastructure Hydrogen Production Market Transformation Fuel Cells ...

  17. PNNL: Security & Privacy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security & Privacy Thank you for visiting the Pacific Northwest National Laboratory (PNNL) website (pnnl.gov) and reviewing our security and privacy policies. The following policies apply to all pages and sites in the pnnl.gov domain, unless otherwise noted. Security Notice This website is part of a Federal computer system used to accomplish Federal functions. The Department of Energy monitors this website for security purposes to ensure it remains available to all users and to protect

  18. Lab announces security changes

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lab announces security changes Lab announces security changes The Laboratory is implementing several changes to its security procedures as the result of a recent security assessment conducted jointly by the Department of Defense and Department of Energy. February 23, 2012 Aerial view of Los Alamos National Laboratory Aerial view of Los Alamos National Laboratory. Contact Kevin Roark Communications Office (505) 665-9202 Email LOS ALAMOS, New Mexico, February 23, 2012-Los Alamos National

  19. Security, Safety and Health

    Energy Savers [EERE]

    Security Through Innovation Security Through Innovation December 2, 2014 - 2:28pm Addthis Security, in all forms, can thrive through innovation. With a mission scope that encompasses technology, energy, science, and nuclear security, the Department of Energy (DOE) has been on the forefront of producing ground-breaking solutions to safeguard our nation's precious resources. DOE is working to develop and pioneer the next generation of technology solutions to protect our critical infrastructure.

  20. Energy Security Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Security Center Energy Security Center Developing new ideas for reliable, secure, and sustainable carbon neutral energy solutions for the nation-the portal to LANL's diverse energy security research enterprise. Contact Leader Steven Buelow (505) 663 5629 Email Program Administrator Jutta Kayser (505) 663-5649 Email Research focus areas Materials and concepts for clean energy Science for renewable energy sources Superconducting cables Energy storage Fuel cells Mitigating impacts of global

  1. Personnel Security Program Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-07-12

    This Manual provides detailed requirements and procedures to supplement DOE O 472.1B, Personnel Security Activities, which establishes the overall objectives, requirements, and responsibilities for implementation and operation of the Personnel Security Program and the Personnel Security Assurance Program in the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Extended until 7-7-06 by DOE N 251.64, dated 7-7-05 Cancels: DOE M 472.1-1A.

  2. Security of databases

    SciTech Connect (OSTI)

    Yeh, Y.S.

    1985-01-01

    In this thesis, the security of databases using cryptographic methods is considered. An algebra for encrypted relational databases is considered and examined. Other database cryptosystems are presented, namely multilevel secure databases including three different approaches; multikey multilevel, cumulative key multilevel, and permutational multilevel secure databases. Finally, entity-relationship encryption is examined.

  3. Safeguards and Security and Cyber Security RM | Department of Energy

    Energy Savers [EERE]

    Safeguards and Security and Cyber Security RM Safeguards and Security and Cyber Security RM The SSCS RM is a tool that assists the DOE federal project review teams in evaluating the technical sufficiency of the project SSCS activities at CD-0 through CD-4. PDF icon Safeguards and Security and Cyber Security RM More Documents & Publications Safeguards and Security Program, acronyms and abbereviations - DOE M 470.4-7 Safeguards and Security Glossary - DOE M 470.4-7 References, Canceled -7

  4. Secure Transportation Management

    SciTech Connect (OSTI)

    Gibbs, P. W.

    2014-10-15

    Secure Transport Management Course (STMC) course provides managers with information related to procedures and equipment used to successfully transport special nuclear material. This workshop outlines these procedures and reinforces the information presented with the aid of numerous practical examples. The course focuses on understanding the regulatory framework for secure transportation of special nuclear materials, identifying the insider and outsider threat(s) to secure transportation, organization of a secure transportation unit, management and supervision of secure transportation units, equipment and facilities required, training and qualification needed.

  5. safeguards and security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    safeguards and security ProForce marks 65 years protecting Sandia resources, facilities, ... Over the past 65 years, the force has changed in size and structure but its mission has... ...

  6. NATIONAL SECURITY TECHNOLOGIES - NEVADA NATIONAL SECURITY SITE

    National Nuclear Security Administration (NNSA)

    - NEVADA NATIONAL SECURITY SITE FISCAL YEARS 2009 THRU 2015 SMALL BUSINESS PROGRAM RESULTS & FORECAST CATEGORY Total Procurement Total SB Small Disad. Bus Woman-Owned SB Hub-Zone ...

  7. Secure Storage | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    material that it protects. Y-12 is the "Fort Knox" of uranium. We oversee the secure management and storage of strategic and special nuclear materials that have been removed...

  8. UNCLASSIFIED UNCLASSIFIED Nuclear Materials Management & Safeguards System

    National Nuclear Security Administration (NNSA)

    UNCLASSIFIED Nuclear Materials Management & Safeguards System CONTACT INFORMATION UPDATE REPORTING IDENTIFICATION SYMBOL (RIS) RIS: Address: Facility Name: CONTACTS Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Return Via Mail To: U.S Department Of Energy ATTN: NMMSS Staff NA-73, GTN 1000 Independence Avenue, SW Washington, DC 20585-1290 Return Via Fax To: 301-903-1998 Return Via E-Mail To: NMMSS@nnsa.doe.gov

  9. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  10. Information Security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Information Security Information security deals with requirements for the protection and control of information and matter required to be classified or controlled by statutes, regulations, or NNSA and Department of Energy (DOE) directives. Classified Matter Protection and Control ensures the protection and control of classified matter. It includes briefing and training requirements for personnel who work with classified on identifying, marking, reproducing, protecting, handling, transmitting,

  11. Sandia Energy - Installation Energy Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Installation Energy Security Home Stationary Power Safety, Security & Resilience of Energy Infrastructure Grid Modernization Resilient Electric Infrastructures Military...

  12. What is Security? A perspective on achieving security

    SciTech Connect (OSTI)

    Atencio, Julian J.

    2014-05-05

    This presentation provides a perspective on achieving security in an organization. It touches upon security as a mindset, ability to adhere to rules, cultivating awareness of the reason for a security mindset, the quality of a security program, willingness to admit fault or acknowledge failure, peer review in security, science as a model that can be applied to the security profession, the security vision, security partnering, staleness in the security program, security responsibilities, and achievement of success over time despite the impossibility of perfection.

  13. NNSA orders security enhancements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Administration labs and sites get girls excited about engineering Wednesday, March 16, 2016 - 1:41pm Future engineers K. Potter, left, and T. Herrin at Y-12 National Security Complex's Introduce a Girl to Engineering event. NNSA workers across the nuclear security enterprise took advantage of "Introduce a girl to engineering day" to instill hundreds of young women with excitement for science, technology, engineering, and math (STEM) careers. This year's theme,

  14. National Security Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science National Security Science Latest Issue:April 2016 past issues All Issues » submit National Security Science Showcasing Los Alamos National Laboratory's work on nuclear weapons and in science for national and global security April 2016 july 2015 The Hurt-Locker School Explosive Results Questing for the Holy Grail of High Explosives Learning from (Near) Disaster A Safer Liftoff Shake, Rattle, and Roll Manhattan Project National Historical Park Strategic Deterrent Forces Charting a

  15. Security | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Enhancing national and homeland security requires technological advancements in everything from biosensors to risk assessments. Game-changing scientific discovery is required for the development of sensors, detectors and other technological advancements used to protect and defend our country. At Argonne, our highly collaborative community of scientists and engineers discover and develop critical security and defense technologies to prevent and mitigate events with the potential for mass

  16. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA hosts CTBT inspectors at Nevada National Security Site Read more Y-12 honors its inventors for technology transfer Read more Sandia National Laboratories Contract Process Announced Read more NNSA honors two security professionals who protect U.S. nuclear enterprise Read more NNSA lab makes fire tornados to ensure weapon safety Read more Sandia's California site invites community to 60th anniversary Read more CTBT inspectors Tech Transfer Sandia Contract Security awards Fire tornados Sandia

  17. Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eleven nonprofit organizations receive community giving grants from Los Alamos National Security, LLC December 15, 2009 Los Alamos, New Mexico, December 15, 2009- Eleven local nonprofit organizations with projects supported by Los Alamos National Laboratory employee volunteers received $75,000 in Community Giving grants from Los Alamos National Security, LLC, the company that manages the Lab for the National Nuclear Security Administration. The organizations are located in Los Alamos, Española,

  18. Security Risk Assessment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Risk Assessment - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  19. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    The Department of Energy (DOE), the National Nuclear Security Administration (NNSA) and the University of California (UC) have agreed on new management and operations contracts for ...

  20. Security Forms and Information

    Broader source: Energy.gov [DOE]

    Homeland Security Presidential Directive HSPD-12 established new policy for a common identification standard for Federal Employees and contractors. As of October 27, 2005, all new Federal employees...

  1. Sandia Energy - Water Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas...

  2. SecuritySmart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    House); * TA-00, Bldg. 760 (Legal Counsel); and * TA-3, Bldg. 1411 (Occupational Medicine). All other buildings in non-secure areas must be individually accounted for in...

  3. National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    aspects relating to the Materials Security and Consolidation Project includine Energy Systems Acquisition Advisory Board equivalents, Critical Decisions, and Quarterly Project...

  4. Oil Security Metrics Model

    SciTech Connect (OSTI)

    Greene, David L.; Leiby, Paul N.

    2005-03-06

    A presentation to the IWG GPRA USDOE, March 6, 2005, Washington, DC. OSMM estimates oil security benefits of changes in the U.S. oil market.

  5. National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    or 1-888-246-2460 using the following timeframes

    using the following timeframes

    //A * ~ w r_ra (b11 II V &. l,4t~Cf..-"i National Nuclear Security Administration DOE/NV--325-Rev. lOa February 2015 Nevada National Security Site Waste Acceptance Criteria Prepared by U.S. Department of Energy National Nuclear Security Administration Nevada Field Office . Environmental Management Operations February 2015 Nevada National Security Site Waste Acceptance Criteria Disclaimer Notice

  6. Office of Radiological Security

    National Nuclear Security Administration (NNSA)

    of physical security of radiological materials;

  7. Provision of mobile and man-portable radiation detection equipment;
  8. Regional cooperation on safeguards...

  9. Cyber Security Architecture Guidelines

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-03-08

    This Guide provides supplemental information on the implementation of cyber security architectures throughout the Department of Energy. Canceled by DOE N 205.18

  10. Supervisory Industrial Security Specialist

    Broader source: Energy.gov [DOE]

    A successful candidate in this position will serve as the Deputy Assistant Manager for Safeguards, Security, and Emergency Management sharing the overall responsibility for execution of the...

  11. Sandia Energy - Water Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Home Analysis Permalink Gallery Climate Change Is the Subject of a New Book Analysis, Climate, Global Climate & Energy, Monitoring, News, News & Events, Sensing, Sensing &...

  12. defense nuclear security

    National Nuclear Security Administration (NNSA)

    3%2A en Defense Nuclear Security http:www.nnsa.energy.govaboutusourprogramsnuclearsecurity

  13. Nuclear Security Summit

    National Nuclear Security Administration (NNSA)

    Joint Research Centre and the United States Department of Energy's National Nuclear Security Administration regarding the reduction of excess nuclear material http:...

  14. Nevada National Security Site

    National Nuclear Security Administration (NNSA)

    ... and Beyond - National Security - Non-Proliferation - Environmental Management Defense ... explosive devices and to detect the proliferation of weapons of mass destruction. * ...

  15. Security | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... or mentalpersonality disorders, alcohol abuse, use of illegal drugs or the abuse ... in the Human Reliability and Alcohol Abuse Within the Office Secure ...

  16. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    preparedness Read More NSC leader recognized as community role model Read More Apex Gold discussion fosters international cooperation in run-up to 2016 Nuclear Security Summit...

  17. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones

    2012-12-01

    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  18. Security Council Approval of Kofi

    Energy Savers [EERE]

    Security Control Assessor Security Control Assessor Cyber-security-300x199.jpg The Security Control Assessor (SOA) is responsible for assessing the management, operational, assurance, and technical security controls implemented on an information system via security testing and evaluation (ST&E) methods. The SOA must be independent of system development, operation, and deficiency mitigation. PDF icon Security Control Assessor Core Competency Training Worksheet More Documents &

  19. Office of Global Material Security | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration Global Material Security NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In

  20. Incidents of Security Concern

    SciTech Connect (OSTI)

    Atencio, Julian J.

    2014-05-01

    This presentation addresses incidents of security concern and an incident program for addressing them. It addresses the phases of an inquiry, and it divides incidents into categories based on severity and interest types based on whether security, management, or procedural interests are involved. A few scenarios are then analyzed according to these breakdowns.

  21. Water Security Toolkit

    Energy Science and Technology Software Center (OSTI)

    2012-09-11

    The Water Security Toolkit (WST) provides software for modeling and analyzing water distribution systems to minimize the potential impact of contamination incidents. WST wraps capabilities for contaminant transport, impact assessment, and sensor network design with response action plans, including source identification, rerouting, and decontamination, to provide a range of water security planning and real-time applications.

  22. Operations Security (OPSEC) Reminder

    Broader source: Energy.gov [DOE]

    DOE O 471.6, Section 4.f, Information Security Manual and the DOE Headquarters Facilities Master Security Plan, Section 8, OPSEC, require that each element review information before it is posted to their publicly accessible website to ensure the data does not contain Controlled Unclassified Information and/or sensitive (critical information).

  1. Secure video communications system

    DOE Patents [OSTI]

    Smith, Robert L.

    1991-01-01

    A secure video communications system having at least one command network formed by a combination of subsystems. The combination of subsystems to include a video subsystem, an audio subsystem, a communications subsystem, and a control subsystem. The video communications system to be window driven and mouse operated, and having the ability to allow for secure point-to-point real-time teleconferencing.

  2. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2010-12-29

    The Safeguards and Security Program ensures that the Department of Energy efficiently and effectively meets all its obligations to protect Special Nuclear Material, other nuclear materials, classified matter, sensitive information, government property, and the safety and security of employees, contractors, and the general public. Supersedes DOE P 470.1.

  3. Information Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1992-10-19

    To establish the Department of Energy (DOE) Information Security Program and set forth policies, procedures and responsibilities for the protection and control of classified and sensitive information. The Information Security Program is a system of elements which serve to deter collection activities, This directive does not cancel another directive. Canceled by DOE O 471.2 of 9-28-1995.

  4. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2016-02-10

    The Safeguards and Security Program ensures that the Department of Energy efficiently and effectively meets all its obligations to protect Special Nuclear Material, other nuclear materials, classified matter, sensitive information, government property and facilities, and the safety and security of employees, contractors, and the general public. Supersedes DOE P 470.1A.

  5. CIOs Uncensored: Security Smarts.

    SciTech Connect (OSTI)

    Johnson, Gerald R.

    2008-02-25

    This commentary for the CIOs Uncensored section of InformationWeek will discuss PNNLs defense in depth approach to cyber security. It will cover external and internal safeguards, as well as the all-important role of employees in the cyber security equation. For employees are your greatest vulnerability and your last line of defense.

  6. Information Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-03-27

    Establishes an Information Security Program for the protection and control of classified and sensitive information. Extended until 5-11-06 by DOE N 251.63, dated 5-11-05. DOE O 471.2A, Information Security Program, dated 3/27/1997, extended by DOE N 251.57, dated 4/28/2004. Cancels: DOE O 471.2

  7. international security policy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    security policy Nuclear Verification Challenge: Maintain the U.S. ability to monitor and verify nuclear reduction agreements and detect violations of treaties and other nuclear nonproliferation commitments. Solution: Develop and deploy measures to ensure verifiable compliance with treaties and other international agreements,... International Nuclear Safeguards Challenge: Detect/deter undeclared nuclear materials and activities. Solution: Build capacity of the International Atomic Energy Agency

  8. international security | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    security Nuclear Verification Challenge: Maintain the U.S. ability to monitor and verify nuclear reduction agreements and detect violations of treaties and other nuclear nonproliferation commitments. Solution: Develop and deploy measures to ensure verifiable compliance with treaties and other international agreements,... International Nuclear Safeguards Challenge: Detect/deter undeclared nuclear materials and activities. Solution: Build capacity of the International Atomic Energy Agency and

  9. International Nuclear Security

    SciTech Connect (OSTI)

    Doyle, James E.

    2012-08-14

    This presentation discusses: (1) Definitions of international nuclear security; (2) What degree of security do we have now; (3) Limitations of a nuclear security strategy focused on national lock-downs of fissile materials and weapons; (4) What do current trends say about the future; and (5) How can nuclear security be strengthened? Nuclear security can be strengthened by: (1) More accurate baseline inventories; (2) Better physical protection, control and accounting; (3) Effective personnel reliability programs; (4) Minimize weapons-usable materials and consolidate to fewer locations; (5) Consider local threat environment when siting facilities; (6) Implement pledges made in the NSS process; and (7) More robust interdiction, emergency response and special operations capabilities. International cooperation is desirable, but not always possible.

  10. Indirection and computer security.

    SciTech Connect (OSTI)

    Berg, Michael J.

    2011-09-01

    The discipline of computer science is built on indirection. David Wheeler famously said, 'All problems in computer science can be solved by another layer of indirection. But that usually will create another problem'. We propose that every computer security vulnerability is yet another problem created by the indirections in system designs and that focusing on the indirections involved is a better way to design, evaluate, and compare security solutions. We are not proposing that indirection be avoided when solving problems, but that understanding the relationships between indirections and vulnerabilities is key to securing computer systems. Using this perspective, we analyze common vulnerabilities that plague our computer systems, consider the effectiveness of currently available security solutions, and propose several new security solutions.

  11. Headquarters Facilities Master Security Plan- Chapter 1, Physical Security

    Broader source: Energy.gov [DOE]

    2016 Headquarters Facilities Master Security Plan - Chapter 1, Physical Security Describes DOE Headquarters Physical Security procedures related to badges, inspections, access controls, visitor controls, and removal of government property.

  12. Information Security: Coordination of Federal Cyber Security Research and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development | Department of Energy Security: Coordination of Federal Cyber Security Research and Development Information Security: Coordination of Federal Cyber Security Research and Development GAO recommends that the Office of Science and Technology Policy establish timelines for developing a federal agenda for cyber security research. GAO also recommends that the Office of Management and Budget (OMB) issue guidance to agencies for providing cyber security research data to repositories. In

  13. Categorical Exclusion Determinations: Health, Safety, and Security...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Health, Safety, and Security Categorical Exclusion Determinations: Health, Safety, and Security Categorical Exclusion Determinations issued by Health, Safety, and Security. ...

  14. National Security Technology Center | Y-12 National Security...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to NSTC. Global Security Cooley joins Y-12's Global Security and Strategic Partnerships Manufacturing and Technical Services Nuclear Material Recovery Nuclear Detection and...

  15. Office of Radiological Security | National Nuclear Security Administra...

    National Nuclear Security Administration (NNSA)

    Gallery Photo Gallery Jobs Apply for Our Jobs Our Jobs Working at NNSA Blog Home Office of Radiological Security Office of Radiological Security NNSA Provides Tajikistan...

  16. Office of Radiological Security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office of Radiological ... Office of Radiological Security Read more about Y-12's contributions of the Global Threat Reduction Initiative to secure the world's most vulnerable...

  17. Tag: global security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Global Security Global Security Analysis and Training Program Sr. Manager Toby Williams describes the GSAT program and its important role to combat radiological terrorism....

  18. Tag: Global Security | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Global Security Global Security Analysis and Training Program Sr. Manager Toby Williams describes the GSAT program and its important role to combat radiological terrorism....

  19. V-186: Drupal Login Security Module Security Bypass and Denial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    V-186: Drupal Login Security Module Security Bypass and Denial of Service Vulnerability ... Related Articles U-162: Drupal Multiple Vulnerabilities V-052: Drupal Core Access Bypass ...

  20. hrp | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    hrp Personnel Security Program NNSA is responsible for managing national nuclear security and supports several key program areas including Defense, Nuclear Nonproliferation, Naval Reactors, Emergency Operations, Infrastructure and Environment, Nuclear Security, Management and Administration and the Office of the Administrator.

  1. Departmental Cyber Security Management Policy

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-05-08

    The Departmental Cyber Security Management (DCSM) Policy was developed to further clarify and support the elements of the Integrated Safeguards and Security Management (ISSM) Policy regarding cyber security. Certified 9-23-10. No cancellation.

  2. Office of Departmental Personnel Security

    Office of Energy Efficiency and Renewable Energy (EERE)

    The Office of Departmental Personnel Security serves as the central leader and advocate vested with the authority to ensure consistent and effective implementation of personnel security programs Department-wide (including for the National Nuclear Security Administration (NNSA).

  3. Security Review Processing Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security Review Processing Form Security Review Processing Form Security Review Process - Please review carefully. Security Acknowledge Form - Complete and return immediately. ...

  4. Security and Cyber Guidance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security and Cyber Guidance Security and Cyber Guidance Appraisal Process Guides Security Evaluations Appraisal Process Guide - April 2008 Cyber Security Evaluations Appraisal ...

  5. Security Control Assessor | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security Control Assessor Security Control Assessor Cyber-security-300x199.jpg The Security Control Assessor (SOA) is responsible for assessing the management, operational, ...

  6. PRIVACY/SECURITY NOTICE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PRIVACY/SECURITY NOTICE By continuing to use this system you indicate your awareness of and consent to the following terms and conditions of use. LOG OFF IMMEDIATELY if you do not agree to the conditions stated in this warning. SECURITY NOTICE This Web site is part of a Federal computer system used to accomplish Federal functions. The Department of Energy monitors this Web site for security purposes to ensure it remains available to all users and to protect information in the system. The system

  7. Nevada National Security Site

    National Nuclear Security Administration (NNSA)

    Nevada National Security Site Proud Past, Exciting Future Nevada National Security Site Pre-Proposal Meeting November 19, 2015 Agenda * 8:30 am Welcome * 9:00 am Overview of NNSS and NFO * 10:00 am Break * 10:30 am NNSS Video * 11:00 am Questions * 11:30 am Lunch * 1:00 pm Solicitation Overview * 2:15 pm Break * 2:45 pm Questions * 4:00 pm Conclusion The Nevada National Security Site * Large geographically diverse outdoor laboratory - 1,360 square miles of federally owned and controlled land -

  8. Headquarters Facilities Master Security Plan

    Energy Savers [EERE]

    0-1 Chapter 10 Security Awareness Program This chapter describes the DOE HQ Security Awareness Program. It implements the requirements of:  Title 32, CFR, Part 2001, Classified National Security Information  Executive Order 13526, Classified National Security Information  DOE Order 470.4B, Safeguards and Security (S&S) Program, Appendix B. Section 3  DOE Order 475.2A, Identifying Classified Information  DOE Order 475.1, Counterintelligence Program The Security Awareness

  9. Microsoft Word - BPD Security - PM

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Performance Database Security (Updated 2015-02) The Department of Energy (DOE) ... controls to ensure the security of data stored in the Building Performance Database (BPD). ...

  10. BPD Security | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information related to the Building Performance Database (BPD) security and software controls. PDF icon Building Performance Database (BPD) Security More Documents & Publications ...

  11. Chapter_3_Personnel_Security

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Security Acknowledgement * DOE F 472.1, Fair Credit Reporting Act Release Authorization ... Security Acknowledgement * DOE F 472.1, Fair Credit Reporting Act Release Authorization ...

  12. Safeguards & Security | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cyber system operations and security, and business and budget operations including property management. Supports EM headquarters with safeguards and security assistance. ...

  13. Los Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Leadership, Governance Los Alamos National Security, LLC Los Alamos National Security, LLC (LANS) The Lab's mission is to develop and apply science and technology to...

  14. Accomplishments | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ... In FY 2009, ASC released improved codes to support stockpile stewardship and other nuclear security missions, including secure transportation, NSE infrastructure, and nuclear ...

  15. SSIP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  16. DNS | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  17. contractor | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  18. NMSSUP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  19. Facility Security Officer Contractor Toolcart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    not download the form and save on place it on your hard drive. Proper Completion of Security Termination Statements: When completing Security Termination Statements for submittal...

  20. Smart-Grid Security Issues

    SciTech Connect (OSTI)

    Khurana, Himanshu; Hadley, Mark D.; Lu, Ning; Frincke, Deborah A.

    2010-01-29

    TITLE: Smart-Grid Security Issues (Editorial Material, English) IEEE SECURITY & PRIVACY 8 (1). JAN-FEB 2010. p.81-85 IEEE COMPUTER SOC, LOS ALAMITOS

  1. Budget | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    7 budget for NNSA are available here. National Nuclear Security Administration Highlights FY'17 Budget Request Budget Request Reflects Commitment to Maintain a Safe, Secure, and...

  2. EIA-800

    U.S. Energy Information Administration (EIA) Indexed Site

    Email: Floor, Suite): Fax: (202) 586-1076 City: State: Zip: - Secure File Transfer: Electronic Transmission: City: State: Zip: - Contact Name: Phone No.: Ext: Fax No.: Questions? ...

  3. Nevada National Security Site

    Broader source: Energy.gov [DOE]

    HISTORYIn 1950, President Truman established what is now known as the Nevada National Security Site (NNSS) to perform nuclear weapons testing activities.  In support of national defense initiatives...

  4. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-07-21

    The order establishes responsibilities and program planning and management requirements for the Safeguards and Security Program. Admin Chg 1, dated 2-15-13, supersedes DOE O 470.4B.

  5. Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security, LLC during a recognition event beginning at 9:30 a.m. Thursday, June 28, at Fuller Lodge in downtown Los Alamos. LANS contributions are determined by the number of...

  6. Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security (LANS), LLC during a recognition event beginning at 9:30 a.m. June 12, at Fuller Lodge in downtown Los Alamos. LANS contributions are determined by the number of...

  7. Safety and Security Officer

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-07-20

    Designated as the DOE official responsible for enforcement of 10 CFR 824 pertaining to the assessment of civil penalties for classified information security violations, and the management and administration of agency occupational safety and health program pursuant to EO 12196

  8. Operations Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1992-04-30

    To establish policies, responsibilities and authorities for implementing and sustaining the Department of Energy (DOE) Operations Security (OPSEC) Program. Cancels DOE O 5632.3B. Canceled by DOE O 471.2 of 9-28-1995.

  9. national security campus

    National Nuclear Security Administration (NNSA)

    1%2A en National Security Campus http:nnsa.energy.govaboutusourlocationsnsc

    Page...

  10. Cognitive Computing for Security.

    SciTech Connect (OSTI)

    Debenedictis, Erik; Rothganger, Fredrick; Aimone, James Bradley; Marinella, Matthew; Evans, Brian Robert; Warrender, Christina E.; Mickel, Patrick

    2015-12-01

    Final report for Cognitive Computing for Security LDRD 165613. It reports on the development of hybrid of general purpose/ne uromorphic computer architecture, with an emphasis on potential implementation with memristors.

  11. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1988-01-22

    To establish the policy and responsibilities for the Department of Energy safeguards and security program. Does not cancel another directive. Canceled by DOE O 5630.11A dated 12-7-92.

  12. defense nuclear security

    National Nuclear Security Administration (NNSA)

    3%2A en Defense Nuclear Security http:nnsa.energy.govaboutusourprogramsnuclearsecurity

    Page...

  13. Requirements for security signalling

    SciTech Connect (OSTI)

    Pierson, L.G.; Tarman, T.D.

    1995-02-05

    There has been some interest lately in the need for ``authenticated signalling``, and the development of signalling specifications by the ATM Forum that support this need. The purpose of this contribution is to show that if authenticated signalling is required, then supporting signalling facilities for directory services (i.e. key management) are also required. Furthermore, this contribution identifies other security related mechanisms that may also benefit from ATM-level signalling accommodations. For each of these mechanisms outlined here, an overview of the signalling issues and a rough cut at the required fields for supporting Information Elements are provided. Finally, since each of these security mechanisms are specified by a number of different standards, issues pertaining to the selection of a particular security mechanism at connection setup time (i.e. specification of a required ``Security Quality of Service``) are also discussed.

  14. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-05-25

    The Order establishes roles and responsibilities for the Department of Energy Safeguards and Security Program. Cancels DOE O 470.4. Canceled by DOE O 470.4B

  15. Energy Security Council

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Council Reliable, secure, sustainable carbon energy solutions for the nation. Contact Albert Migliori (505) 663-5627 Email David Morris (505) 665 6487 Email David Watkins (50)5...

  16. Data port security lock

    DOE Patents [OSTI]

    Quinby, Joseph D. (Albuquerque, NM); Hall, Clarence S. (Albuquerque, NM)

    2008-06-24

    In a security apparatus for securing an electrical connector, a plug may be fitted for insertion into a connector receptacle compliant with a connector standard. The plug has at least one aperture adapted to engage at least one latch in the connector receptacle. An engagement member is adapted to partially extend through at least one aperture and lock to at least one structure within the connector receptacle.

  17. Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2006, the National Nuclear Security Administration (NNSA) announced the selection of National Security Technologies, LLC (NSTec) to manage and operate the Nevada Test Site (NTS) for the NNSA Nevada Site Office. The contract, valued at approxi- mately $500 million annually, is for five years. There are poten- tially five additional perform- ance-based award-term years available under this contract. NSTec is made up of Northrop Grumman, AECOM, CH2M Hill, and Nuclear Fuel Services. Dr. James E.

  18. Lemnos Interoperable Security Program

    SciTech Connect (OSTI)

    Stewart, John; Halbgewachs, Ron; Chavez, Adrian; Smith, Rhett; Teumim, David

    2012-01-31

    The manner in which the control systems are being designed and operated in the energy sector is undergoing some of the most significant changes in history due to the evolution of technology and the increasing number of interconnections to other system. With these changes however come two significant challenges that the energy sector must face; 1) Cyber security is more important than ever before, and 2) Cyber security is more complicated than ever before. A key requirement in helping utilities and vendors alike in meeting these challenges is interoperability. While interoperability has been present in much of the discussions relating to technology utilized within the energy sector and especially the Smart Grid, it has been absent in the context of cyber security. The Lemnos project addresses these challenges by focusing on the interoperability of devices utilized within utility control systems which support critical cyber security functions. In theory, interoperability is possible with many of the cyber security solutions available to utilities today. The reality is that the effort required to achieve cyber security interoperability is often a barrier for utilities. For example, consider IPSec, a widely-used Internet Protocol to define Virtual Private Networks, or tunnels , to communicate securely through untrusted public and private networks. The IPSec protocol suite has a significant number of configuration options and encryption parameters to choose from, which must be agreed upon and adopted by both parties establishing the tunnel. The exercise in getting software or devices from different vendors to interoperate is labor intensive and requires a significant amount of security expertise by the end user. Scale this effort to a significant number of devices operating over a large geographical area and the challenge becomes so overwhelming that it often leads utilities to pursue solutions from a single vendor. These single vendor solutions may inadvertently lock utilities into proprietary and closed systems.

  19. Incidents of Security Concern

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2004-03-17

    Sets forth requirements for the DOE Incidents of Security Concern Program, including timely identification and notification of, response to, inquiry into, reporting of, and closure actions for incidents of security concern. Cancels Chapter VII of DOE O 470.1; DOE N 471.3; and Chapter IV of DOE M 471.2-1B (Note: Paragraphs 1 and 2 of Chapter III remain in effect.) Canceled by DOE O 470.4.

  20. Secure Sensor Platform

    Energy Science and Technology Software Center (OSTI)

    2010-08-25

    The Secure Sensor Platform (SSP) software provides a framework of functionality to support the development of low-power autonomous sensors for nuclear safeguards. This framework provides four primary functional blocks of capabilities required to implement autonomous sensors. The capabilities are: communications, security, power management, and cryptography. Utilizing this framework establishes a common set of functional capabilities for seamless interoperability of any sensor based upon the SSP concept.

  1. Infrastructure Security Executive Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executive Summary Energy, Climate, and Infrastructure Executive Summary / 3 Message from the VP Rick Stulen, Vice President Energy, Climate, & Infrastructure Security SMU Access to reliable, affordable, and sustainable sources of energy is essential for all modern economies. Since the late 1950s, we Americans have not been energy self-sufficient. Our addiction to foreign oil and fossil fuels puts our economy, our environment, and ultimately our national security at risk. Furthermore, there

  2. Alamos National Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    companies get boost from Los Alamos National Security November 19, 2012 Venture Acceleration Fund awards help region's businesses grow LOS ALAMOS, New Mexico, November 19, 2012- Two local biotech start ups, a water and power company and a hardware inventor are the latest recipients of $165,000 in Venture Acceleration Fund (VAF) awards from Los Alamos National Security, LLC. Mustomo, Inc., IX Power, Synfolia, and Tape-Ease will receive funding to take their products and services to the next

  3. Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    200 nonprofit organizations to receive monetary donations from Los Alamos National Security, LLC June 7, 2010 Employee volunteer efforts to be recognized LOS ALAMOS, New Mexico, June 7, 2010-Nonprofit organizations are receiving more than $117,000 from Los Alamos National Security, LLC during a recognition event beginning at 9 a.m. Wednesday at Fuller Lodge in downtown Los Alamos. The monetary donations are being made to the nonprofits as a result of the volunteer efforts of Los Alamos National

  4. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    20 National Nuclear Security Administration FY 2013 PER Babcock & Wilcox Technical Services Y-12, LLC Performance Evaluation Report NNSA Production Office Y-12 Nuclear Security Complex Performance Period: October 2012 - September 2013 December 24, 2013 APPROVED FOR PUBLIC RELEASE This document has been approved for release to the public by: Name / Title: Scott A. Hawks, NPO Y-12 Classification Officer Date: 12/31/2013 NNSA Production Office, Y-12 Page 2 of 20 Executive Summary This

  5. Well Logging Security Initiatives | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Well Logging Security ... Well Logging Security Initiatives The mp4 video format is not supported by this browser. Download video Captions: On Watch as GTRI demonstrates the threat to the security of (oil) well logging systems and outlines the initiatives that are enhancing the security of these sources worldwide

  6. PACE: Pattern Accurate Computationally Efficient Bootstrapping for Timely Discovery of Cyber-Security Concepts

    SciTech Connect (OSTI)

    McNeil, Nikki C; Bridges, Robert A; Iannacone, Michael D; Czejdo, Bogdan; Perez, Nicolas E; Goodall, John R

    2013-01-01

    Public disclosure of important security information, such as knowledge of vulnerabilities or exploits, often occurs in blogs, tweets, mailing lists, and other online sources significantly before proper classification into structured databases. In order to facilitate timely discovery of such knowledge, we propose a novel semi-supervised learning algorithm, PACE, for identifying and classifying relevant entities in text sources. The main contribution of this paper is an enhancement of the traditional bootstrapping method for entity extraction by employing a time-memory trade-off that simultaneously circumvents a costly corpus search while strengthening pattern nomination, which should increase accuracy. An implementation in the cyber-security domain is discussed as well as challenges to Natural Language Processing imposed by the security domain.

  7. Broader National Security Missions | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Broader National Security ... Broader National Security Missions Learn more For 70 years, the Y-12 National Security Complex has transformed in response to changing national security priorities and assigned missions, evolving technological opportunities, and growing concerns regarding health and public safety. As the global security situation has changed, the site has adapted - beginning as a uranium enrichment facility, transforming to a weapons manufacturing facility, and accepting new

  8. Security and Training | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security and Training Security and Training Instability in parts of the world and increased terrorist activities worldwide intensify security concerns in protecting personnel, materials and infrastructure. As a globally recognized leader in safeguards and security, Y-12 provides immediate and deployable solutions to mitigate these risks. We provide security solutions to other federal customers, other countries, commercial entities, universities and medical institutions, among others, and provide

  9. > FAQs for Survey Form EIA-888

    Gasoline and Diesel Fuel Update (EIA)

    Fax - fax price(s) to a secure, toll-free fax number, 1-877-359-6637 Telephone ... of the Federal Energy Administration Act of 1974 (FEAA) (Public Law 93-275), as amended. ...

  10. FAQs for Survey Form EIA-878

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Fax - fax prices to a secure, toll-free fax number, 1-877-359-6637 Telephone ... of the Federal Energy Administration Act of 1974 (FEAA) (Public Law 93-275), as amended. ...

  11. Technology Convergence and National Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Convergence and National Security Rob Leland Sandia National Laboratories To Be Determined T.B.D. Outline * Part 1: National Security * Part 2: Technology Convergence * Part 3: An example Part 1: National Security What is national security? Global Constructive Destructive * Resource conflicts * Sustainable dev. * Ecomigration * Conventional engage. * Nuclear deterrence *Military containment * Prosperity * Health care * Education * Terrorism * Crime Environmental Local Human need War Homeland

  12. NSDD | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NSDD NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In

  13. containers | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    containers NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In

  14. Security News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security News Security News January 14, 2016 A Centerra Protective Force employee uses a mirror to check the undercarriage of a transport trailer before it enters a Savannah River Site Limited Area. EM Headquarters Office Ensures Safeguards, Security, Emergency Preparedness WASHINGTON, D.C. - The Office of Safeguards, Security and Emergency Preparedness has a unique function supporting the EM mission

  15. Security Review Process | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security Review Process Security Review Process PDF icon Security Review Process More Documents & Publications Headquarters Facilities Master Security Plan - Chapter 3, Personnel Security Headquarters Facilities Master Security Plan - Chapter 1, Physical Security PSH-14-0092 - In the Matter of Personnel Security

  16. Elizabeth Bautista

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth Bautista Elizabeth Bautista ejb-headshot.jpg Elizabeth J. Bautista Group Lead Operations Technology Group EJBautista@lbl.gov Phone: (510) 486-7454 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 Biographical Sketch Elizabeth Bautista is Group Lead for the Operations Technology Group, the team that ensures the accessibility, reliability, security and connectivity of NERSC and ESnet (ESnet http://www.es.net) by providing a central location for problem

  17. SWEAChapter1

    National Nuclear Security Administration (NNSA)

    COVER SHEET RESPONSIBLE AGENCY: National Nuclear Security Administration (NNSA) TITLE: Final Site-Wide Environmental Assessment (SWEA) for Sandia National Laboratories/California (DOE/EA-1422) CONTACT: For further information concerning the Draft Site-Wide Environmental Assessment (SWEA), contact: Susan Lacy, NEPA Document Manager NNSA, Sandia Site Office P.O. Box 5400, Albuquerque, NM 87185 Telephone: 1-505-845-5542, Fax: 505-845-4710 For further information by way of electronic mail, contact:

  18. Computer Security Risk Assessment

    Energy Science and Technology Software Center (OSTI)

    1992-02-11

    LAVA/CS (LAVA for Computer Security) is an application of the Los Alamos Vulnerability Assessment (LAVA) methodology specific to computer and information security. The software serves as a generic tool for identifying vulnerabilities in computer and information security safeguards systems. Although it does not perform a full risk assessment, the results from its analysis may provide valuable insights into security problems. LAVA/CS assumes that the system is exposed to both natural and environmental hazards and tomore » deliberate malevolent actions by either insiders or outsiders. The user in the process of answering the LAVA/CS questionnaire identifies missing safeguards in 34 areas ranging from password management to personnel security and internal audit practices. Specific safeguards protecting a generic set of assets (or targets) from a generic set of threats (or adversaries) are considered. There are four generic assets: the facility, the organization''s environment; the hardware, all computer-related hardware; the software, the information in machine-readable form stored both on-line or on transportable media; and the documents and displays, the information in human-readable form stored as hard-copy materials (manuals, reports, listings in full-size or microform), film, and screen displays. Two generic threats are considered: natural and environmental hazards, storms, fires, power abnormalities, water and accidental maintenance damage; and on-site human threats, both intentional and accidental acts attributable to a perpetrator on the facility''s premises.« less

  19. Secure Information Sharing

    Energy Science and Technology Software Center (OSTI)

    2005-09-09

    We are develoing a peer-to-peer system to support secure, location independent information sharing in the scientific community. Once complete, this system will allow seamless and secure sharing of information between multiple collaborators. The owners of information will be able to control how the information is stored, managed. ano shared. In addition, users will have faster access to information updates within a collaboration. Groups collaborating on scientific experiments have a need to share information and data.more » This information and data is often represented in the form of files and database entries. In a typical scientific collaboration, there are many different locations where data would naturally be stored. This makes It difficult for collaborators to find and access the information they need. Our goal is to create a lightweight file-sharing system that makes it’easy for collaborators to find and use the data they need. This system must be easy-to-use, easy-to-administer, and secure. Our information-sharing tool uses group communication, in particular the InterGroup protocols, to reliably deliver each query to all of the current participants in a scalable manner, without having to discover all of their identities. We will use the Secure Group Layer (SGL) and Akenti to provide security to the participants of our environment, SGL will provide confldentiality, integrity, authenticity, and authorization enforcement for the InterGroup protocols and Akenti will provide access control to other resources.« less

  20. nopnproliferation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nopnproliferation Radiological Security The program collaborates with domestic and international partners to address the threat of illicit use of high-priority radiological materials in the United States and abroad. The Radiological Security program accomplishes its mission by removing and disposing of excess or orphaned... International Nuclear Security The International Nuclear Security program collaborates with partners world-wide to improve the security of proliferation-sensitive materials,

  1. Framework for SCADA Security Policy

    Energy Savers [EERE]

    Framework for SCADA Security Policy Dominique Kilman Jason Stamp dkilman@sandia.gov jestamp@sandia.gov Sandia National Laboratories Albuquerque, NM 87185-0785 Abstract - Modern automation systems used in infrastruc- ture (including Supervisory Control and Data Acquisition, or SCADA) have myriad security vulnerabilities. Many of these relate directly to inadequate security administration, which precludes truly effective and sustainable security. Adequate security management mandates a clear

  2. Chapter_14_Cyber_Security

    Office of Environmental Management (EM)

    4 Cyber Security The DOE Cyber Security Program aims to protect the Department's diverse missions in a cost- effective manner; identify threats, risks, and mitigations; and remain flexible in a changing environment. Key Departmental directives, policies, and procedures governing the implementation of the Cyber Security Program at DOE HQ are: * DOE Order 205.1B, Department of Energy Cyber Security Management * DOE Policy 205.1, Department of Energy Cyber Security Management Policy * Headquarters

  3. Chapter_3_Personnel_Security

    Office of Environmental Management (EM)

    Personnel Security This chapter covers the security procedures adopted by DOE HQ to implement the requirements of the following DOE directives: * Privacy Act of 1974 * Title 10, Code of Federal Regulations, Part 707 * Title 10, Code of Federal Regulations, Part 710 * Title 48, Code of Federal Regulations, Part 952.204-2 * DOE Order 470.4B, Safeguards and Security Program * DOE Order 472.2, Personnel Security * DOE Order 475.1, Counterintelligence Program The DOE Personnel Security Program is

  4. Technical Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2015-09-02

    This order implements the Department of Energy (DOE) Technical Security Program (TSP). This program represents the convergence of two distinct disciplines: Counterintelligence (CI) and Security Countermeasures. The elements of the TSP are driven by national level, interagency programs that are codified in various laws, Executive Orders, national polices and directives. Supersedes DOE M 470.4-4A Chg 1, dated 10-12-2010, Section D – Technical Surveillance Countermeasures (Official Use Only) and classified annex (Secret); and DOE M 205.1-3 (Official Use Only) and Part II (Secret), dated 4-17-2006.

  5. Security Clearances; Limitations

    Energy Savers [EERE]

    SEC. 1072. SECURITY CLEARANCES; LIMITATIONS. (a) In General.-Title III of the Intelligence Reform and Terrorism Prevention Act of 2004 (50 U.S.C. 435b) is amended by adding at the end the following new section: "SEC. 3002. SECURITY CLEARANCES; LIMITATIONS. "(a) Definitions.-In this section: "(1) Controlled substance.-The term `controlled substance' has the meaning given that term in section 102 of the Controlled Substances Act (21 U.S.C. 802). "(2) Covered person.-The term

  6. Nevada National Security Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proud Past, Exciting Future Nevada National Security Site Pre-Proposal Meeting November 19, 2015 Agenda * 8:30 am Welcome * 9:00 am Overview of NNSS and NFO * 10:00 am Break * 10:30 am NNSS Video * 11:00 am Questions * 11:30 am Lunch * 1:00 pm Solicitation Overview * 2:15 pm Break * 2:45 pm Questions * 4:00 pm Conclusion The Nevada National Security Site * Large geographically diverse outdoor laboratory - 1,360 square miles of federally owned and controlled land - Surrounded by 4,500 square

  7. Cyber Security Evaluation Tool

    SciTech Connect (OSTI)

    2009-08-03

    CSET is a desktop software tool that guides users through a step-by-step process to assess their control system network security practices against recognized industry standards. The output from CSET is a prioritized list of recommendations for improving the cyber security posture of your organization?¢????s ICS or enterprise network. CSET derives the recommendations from a database of cybersecurity standards, guidelines, and practices. Each recommendation is linked to a set of actions that can be applied to enhance cybersecurity controls.

  8. Cyber Security Evaluation Tool

    Energy Science and Technology Software Center (OSTI)

    2009-08-03

    CSET is a desktop software tool that guides users through a step-by-step process to assess their control system network security practices against recognized industry standards. The output from CSET is a prioritized list of recommendations for improving the cyber security posture of your organization’s ICS or enterprise network. CSET derives the recommendations from a database of cybersecurity standards, guidelines, and practices. Each recommendation is linked to a set of actions that can be applied tomore » enhance cybersecurity controls.« less

  9. Alamos National Security, LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    More than 240 nonprofit organizations to receive monetary donations from Los Alamos National Security, LLC June 10, 2013 Employees and retirees perform 270,000 volunteer hours LOS ALAMOS, N.M., June 10, 2013-Nonprofit organizations will receive more than $180,000 from Los Alamos National Security (LANS), LLC during a recognition event beginning at 9:30 a.m. June 12, at Fuller Lodge in downtown Los Alamos. LANS contributions are determined by the number of volunteer hours logged by Los Alamos

  10. NATIONAL SECURITY TECHNOLOGIES - NEVADA NATIONAL SECURITY SITE

    National Nuclear Security Administration (NNSA)

    - NEVADA NATIONAL SECURITY SITE FISCAL YEARS 2009 THRU 2015 SMALL BUSINESS PROGRAM RESULTS & FORECAST CATEGORY Total Procurement Total SB Small Disad. Bus Woman-Owned SB Hub-Zone SB Veteran-Owned SB Service Disabled Vet. SB FY 2009 Dollars Goal (projected) $210,000,000 $139,860,000 $12,600,000 $14,700,000 $6,300,000 $42,000,000 $4,200,000 FY 2009 Dollars Accomplished $222,209,712 $142,098,377 $7,570,924 $11,761,989 $3,243,572 $79,415,951 $2,797,603 FY 2009 % Goal 66.60% 6.00% 7.00% 3.00%

  11. Security classification of information

    SciTech Connect (OSTI)

    Quist, A.S.

    1989-09-01

    Certain governmental information must be classified for national security reasons. However, the national security benefits from classifying information are usually accompanied by significant costs -- those due to a citizenry not fully informed on governmental activities, the extra costs of operating classified programs and procuring classified materials (e.g., weapons), the losses to our nation when advances made in classified programs cannot be utilized in unclassified programs. The goal of a classification system should be to clearly identify that information which must be protected for national security reasons and to ensure that information not needing such protection is not classified. This document was prepared to help attain that goal. This document is the first of a planned four-volume work that comprehensively discusses the security classification of information. Volume 1 broadly describes the need for classification, the basis for classification, and the history of classification in the United States from colonial times until World War 2. Classification of information since World War 2, under Executive Orders and the Atomic Energy Acts of 1946 and 1954, is discussed in more detail, with particular emphasis on the classification of atomic energy information. Adverse impacts of classification are also described. Subsequent volumes will discuss classification principles, classification management, and the control of certain unclassified scientific and technical information. 340 refs., 6 tabs.

  12. Information Security Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2009-01-16

    This Manual establishes security requirements for the protection and control of matter required to be classified or controlled by statutes, regulations, or U.S. Department of Energy directives. Cancels DOE M 470.4-4 Chg 1. DOE M 470.4-4A Chg 1 issued 10-12-10.

  13. Information Security Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2010-10-12

    The Manual establishes security requirements for the protection and control of matter required to be classified or controlled by statutes, regulations, or U.S. Department of Energy (DOE) directives. Original dated dated 1-16-09. Canceled by DOE O 471.6--except for Section D.

  14. Transmission Line Security Monitor

    ScienceCinema (OSTI)

    None

    2013-05-28

    The Transmission Line Security Monitor is a multi-sensor monitor that mounts directly on high-voltage transmission lines to detect, characterize and communicate terrorist activity, human tampering and threatening conditions around support towers. For more information about INL's critical infrastructure protection research, visit http://www.facebook.com/idahonationallaboratory.

  15. Transmission Line Security Monitor

    SciTech Connect (OSTI)

    2011-01-01

    The Transmission Line Security Monitor is a multi-sensor monitor that mounts directly on high-voltage transmission lines to detect, characterize and communicate terrorist activity, human tampering and threatening conditions around support towers. For more information about INL's critical infrastructure protection research, visit http://www.facebook.com/idahonationallaboratory.

  16. Headquarters Security Operations

    Broader source: Energy.gov [DOE]

    DOE strengthens national security by protecting personnel, facilities, property, classified information, and sensitive unclassified information for DOE Headquarters facilities in the National Capital Area under normal and abnormal (i.e., emergency) conditions; manages access authorization functions; ensures that executives and dignitaries are fully protected, and supports efforts to ensure the continuity of government in all circumstances as mandated by Presidential Decision Directive.

  17. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-08-26

    Establishes roles and responsibilities for the Department of Energy Safeguards and Security Program. Cancels: DOE O 470.1, DOE O 471.2A, DOE O 471.4, DOE O 472.1C, DOE O 473.1, DOE O 473.2, DOE O 474.1A. Canceled by DOE O 470.4A.

  18. National Security System Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-03-08

    The manual provides baseline requirements and controls for the graded protection of the confidentiality, integrity, and availability of classified information and information systems used or operated by the Department of Energy (DOE), contractors, and any other organization on behalf of DOE, including the National Nuclear Security Administration. Cancels DOE M 471.2-2. Canceled by DOE O 205.1B.

  19. Metaphors for cyber security.

    SciTech Connect (OSTI)

    Moore, Judy Hennessey; Parrott, Lori K.; Karas, Thomas H.

    2008-08-01

    This report is based upon a workshop, called 'CyberFest', held at Sandia National Laboratories on May 27-30, 2008. Participants in the workshop came from organizations both outside and inside Sandia. The premise of the workshop was that thinking about cyber security from a metaphorical perspective could lead to a deeper understanding of current approaches to cyber defense and perhaps to some creative new approaches. A wide range of metaphors was considered, including those relating to: military and other types of conflict, biological, health care, markets, three-dimensional space, and physical asset protection. These in turn led to consideration of a variety of possible approaches for improving cyber security in the future. From the proposed approaches, three were formulated for further discussion. These approaches were labeled 'Heterogeneity' (drawing primarily on the metaphor of biological diversity), 'Motivating Secure Behavior' (taking a market perspective on the adoption of cyber security measures) and 'Cyber Wellness' (exploring analogies with efforts to improve individual and public health).

  20. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-07-21

    To establish responsibilities for the U.S. Department of Energy (DOE) Safeguards and Security (S&S) Program, and to establish program planning and management requirements for the S&S Program. Cancels DOE O 470.4A, DOE M 470.4-1, Chg. 2, and DOE O 142.1.

  1. Information Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1995-09-28

    Establishes an Information Security Program for the protection and control of classified and sensitive information. Cancels DOE 5630.8A, DOE 5639.1, DOE 5639.5, DOE 5639.6A, DOE 5639.7, DOE M 5632.1C-1, Chapter III, Para. 1, 2, and 4-9

  2. AUDIT REPORT Security at the Nevada National Security Site

    Broader source: Energy.gov (indexed) [DOE]

    Security at the Nevada National Security Site OAS-L-15-06 May 2015 U.S. Department of Energy Office of Inspector General Office of Audits and Inspections . Department of Energy...

  3. Nevada National Security Site | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Nevada National Security Site The Nevada National Security Site (NNSS) safely conducts high-hazard operations, testing, and training in support of NNSA, the U.S. Department of Defense, and other agencies. NNSS is run by National Security Technologies, LLC. Visit our website NNSS Related News NNSA hosts international CTBT on-site inspection experts at Nevada National Security Site NNSS celebrates its 65 anniversary NNSA Conducts Fifth Experiment aimed to Improve U.S. Ability to Detect Foreign

  4. nevada national security site | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nevada national security site NNSA hosts international CTBT on-site inspection experts at Nevada National Security Site This month, NNSA hosted a Comprehensive Nuclear-Test-Ban Treaty (CTBT) on-site inspection activity at the Nevada National Security Site (NNSS). For the first time, CTBT surrogate inspectors and other inspection experts were able to visit NNSS, a former nuclear explosive test site that now supports... NNSS celebrates its 65 anniversary The Nevada National Security Site (NNSS)

  5. Y-12 National Security Campus | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Y-12 National Security Campus Ambassador Ensher visits Y-12 and NNSS Ambassador Henry S. Ensher, the top U.S. diplomat at the United States Mission to International Organizations in Vienna, Austria, recently visited two facilities to understand NNSA's mission better: the Y-12 National Security Complex and the Nevada National Security Site (NNSS). At Y-12, he

  6. Departmental Personnel Security- Clearance Automation

    Broader source: Energy.gov [DOE]

    The primary objective of the DOE Integrated Security System (eDISS+) Initiative is to support the integration of multiple DOE security systems and databases. This integrated environment provides...

  7. Secure key storage and distribution

    DOE Patents [OSTI]

    Agrawal, Punit

    2015-06-02

    This disclosure describes a distributed, fault-tolerant security system that enables the secure storage and distribution of private keys. In one implementation, the security system includes a plurality of computing resources that independently store private keys provided by publishers and encrypted using a single security system public key. To protect against malicious activity, the security system private key necessary to decrypt the publication private keys is not stored at any of the computing resources. Rather portions, or shares of the security system private key are stored at each of the computing resources within the security system and multiple security systems must communicate and share partial decryptions in order to decrypt the stored private key.

  8. Facility Security Officer Contractor Toolcart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Tools Security Minutes New! SIMP Late Reporting Social Media Email Association Official Use Only (OUO) Majordomo Email List Risks Email Vacating Spaces Reporting Monitors Review and Approval Top of page

  9. Asian Energy Security

    SciTech Connect (OSTI)

    Peter Hayes, PhD

    2003-12-01

    OAK-B135 In the Asian Energy Security (AES) Project, Nautilus Institute works together with a network of collaborating groups from the countries of Northeast Asia to evaluate the energy security implications of different national and regional energy ''paths''. The goal of the Asia Energy Security project is to illuminate energy paths--and the energy policy choices that might help to bring them about--that result in a higher degree of energy security for the region and for the world as a whole, that is, to identify energy paths that are ''robust'' in meeting many different energy security and development objectives, while also offering flexibility in the face of uncertainty. In work to date, Nautilus has carefully assembled a network of colleagues from the countries of the region, trained them together as a group in the use of a common, flexible, and transparent energy and environmental analysis planning software tool (LEAP, the Long-range Energy Alternatives Planning system), and worked with them to prepare base-year energy sector models for each country. To date, complete data sets and models for ''Business as Usual'' (BAU) energy paths have been compiled for China, Japan, the Republic of Korea, and the Democratic Peoples' Republic of Korea. A partial data set and BAU path has been compiled for the Russian Far East, and a data set is being started in Mongolia, where a team of researchers has just joined the AES project. In several countries, ''Alternative'' energy paths have been developed as well, or partially elaborated. National energy sector developments, progress on national LEAP modeling, additional LEAP training, and planning for the next phase of the AES project were the topics of a recent (early November) workshop held in Vancouver, British Columbia. With funding from the Department of Energy, Nautilus is poised to build upon the successes of the project to date with a coordinated international effort to research the energy security ramifications of regional coordination on energy issues in Northeast Asia. The paragraphs below summarize Nautilus' plans for the AES project in the coming months.

  10. FOILFEST :community enabled security.

    SciTech Connect (OSTI)

    Moore, Judy Hennessey; Johnson, Curtis Martin; Whitley, John B.; Drayer, Darryl Donald; Cummings, John C., Jr.

    2005-09-01

    The Advanced Concepts Group of Sandia National Laboratories hosted a workshop, ''FOILFest: Community Enabled Security'', on July 18-21, 2005, in Albuquerque, NM. This was a far-reaching look into the future of physical protection consisting of a series of structured brainstorming sessions focused on preventing and foiling attacks on public places and soft targets such as airports, shopping malls, hotels, and public events. These facilities are difficult to protect using traditional security devices since they could easily be pushed out of business through the addition of arduous and expensive security measures. The idea behind this Fest was to explore how the public, which is vital to the function of these institutions, can be leveraged as part of a physical protection system. The workshop considered procedures, space design, and approaches for building community through technology. The workshop explored ways to make the ''good guys'' in public places feel safe and be vigilant while making potential perpetrators of harm feel exposed and convinced that they will not succeed. Participants in the Fest included operators of public places, social scientists, technology experts, representatives of government agencies including DHS and the intelligence community, writers and media experts. Many innovative ideas were explored during the fest with most of the time spent on airports, including consideration of the local airport, the Albuquerque Sunport. Some provocative ideas included: (1) sniffers installed in passage areas like revolving door, escalators, (2) a ''jumbotron'' showing current camera shots in the public space, (3) transparent portal screeners allowing viewing of the screening, (4) a layered open/funnel/open/funnel design where open spaces are used to encourage a sense of ''communitas'' and take advantage of citizen ''sensing'' and funnels are technological tunnels of sensors (the tunnels of truth), (5) curved benches with blast proof walls or backs, (6) making it easy for the public to report, even if not sure/''non-event'' (e.g. ''I'm uncomfortable'') and processing those reports in aggregate not individually, (7) transforming the resident working population into a part-time undercover security/sensor force through more innovative training and (8) adding ambassadors/security that engage in unexpected conversation with the public. The group recommended that we take actions to pursue the following ideas next: (a) A concept for a mobile sensor transport (JMP); (b) Conduct a follow-on workshop; (c) Conduct social experiments/activities to see how people would react to the concepts related to community and security; (d) Explore further aesthetically pleasing, blast-resistance seating areas; and (e) The Art of Freedom (an educational, multi-media campaign).

  11. April 2014 | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Y-12 Press Release Apr 6, 2014 Security Improvements Project Completed Ahead of Schedule, 20 Million Under Budget The National Nuclear Security Administration's (NNSA) Security...

  12. National Security & Safety Reports | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    IG-0787 The Department's Cyber Security Incident Management Program January 2, 2008 Inspection Report: IG-0785 Incident of Security Concern at the Y-12 National Security Complex...

  13. Enforcement Letter, Lawrence Livermore National Security, LLC...

    Office of Environmental Management (EM)

    Security, LLC - May 2008 Enforcement Letter, Lawrence Livermore National Security, LLC - May 2008 May 15, 2008 Issued to Lawrence Livermore National Security, LLC related to the...

  14. Safeguards and Security Program - DOE Directives, Delegations...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4B Admin Chg 1, Safeguards and Security Program by Marc Brooks Functional areas: Administrative Change, Safeguards, Security, and Emergency Management, Safety, Safety and Security,...

  15. Technical Security Program - DOE Directives, Delegations, and...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    470.6, Technical Security Program by Sam Soley Functional areas: Security, Counterintelligence This order implements the Department of Energy (DOE) Technical Security Program...

  16. Security Enforcement Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Documents Available for Download September 23, 2015 Enforcement Letter, Los Alamos National Security, LLC Security Enforcement Letter issued to Los Alamos National Security, LLC ...

  17. ADMINISTRATIVE RECORDS SCHEDULE 18: SECURITY, EMERGENCY PLANNING...

    Energy Savers [EERE]

    18: SECURITY, EMERGENCY PLANNING, AND SAFETY RECORDS More Documents & Publications ADM 18 PDF Security, Emergency Planning & Safety Records Security, Emergency Planning &...

  18. Safeguards and Security Program References

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-08-26

    The manual establishes definitions for terms related to the Department of Energy Safeguards and Security (S&S) Program and includes lists of references and acronyms/abbreviations applicable to S&S Program directives. Cancels the Safeguards and Security Glossary of Terms, dated 12-18-95. Current Safeguards and Security Program References can also be found at Safeguards and Security Policy Information Resource (http://pir.pnl.gov/)

  19. Security and Privacy Notices | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security and Privacy Notices Security Notice This Web site is part of a Federal computer system used to accomplish Federal functions. The National Renewable Energy Laboratory monitors this Web site for security purposes to ensure it remains available to all users and to protect information in the system. By accessing this Web site, you are expressly consenting to these monitoring activities. Unauthorized attempts to defeat or circumvent security features, to use the system for other than

  20. accountability | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    accountability | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  1. emergencyresponse | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    emergencyresponse | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  2. whistleblower | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    whistleblower | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  3. gms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    gms NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In... NNSA Provides Tajikistan Specialized Vehicles to Transport Radiological Materials NNSA Program Manager Nick Cavellero, right, and NRSA

  4. iaea | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    iaea Ambassador Ensher visits Y-12 and NNSS Ambassador Henry S. Ensher, the top U.S. diplomat at the United States Mission to International Organizations in Vienna, Austria, recently visited two facilities to understand NNSA's mission better: the Y-12 National Security Complex and the Nevada National Security Site (NNSS). At Y-12, he... NNSA keeps the promises borne out of the Nuclear Security Summit On Thursday and Friday President Obama will host his fourth and final Nuclear Security Summit in

  5. Safeguard Security and Awareness Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2002-10-02

    Provides detailed requirements and procedures to supplement DOE O 470.1, Safeguards and Security Program, Chapter IV.

  6. Protocol, Security Assistance- January 2007

    Broader source: Energy.gov [DOE]

    Provide timely technical assistance and system support to Field and HQ Elements to enhance site safeguards and security.

  7. David Telles wins NNSA Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David Telles wins NNSA Security Professional of the Year award May 7, 2009 LOS ALAMOS, New Mexico, May 7, 2009 - David M. Telles, who leads Los Alamos National Laboratory's Vulnerability Analysis Office, received a 2008 National Nuclear Security Administration Security Professional of the Year award. NNSA administrator Tom D'Agostino said, "Our security professionals dedicate themselves to protecting some of the nation's most vital strategic assets, and in so doing, help advance broader

  8. Cyber Security Process Requirements Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2008-08-12

    The Manual establishes the minimum implementation standards for cyber security management processes throughout the Department. No cancellation.

  9. Secure computing for the 'Everyman'

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Secure computing for the 'Everyman' Secure computing for the 'Everyman' If implemented on a wide scale, quantum key distribution technology could ensure truly secure commerce, banking, communications and data transfer. September 2, 2014 This small device developed at Los Alamos National Laboratory uses the truly random spin of light particles as defined by laws of quantum mechanics to generate a random number for use in a cryptographic key that can be used to securely transmit information

  10. Secure Storage Architectures

    SciTech Connect (OSTI)

    Aderholdt, Ferrol; Caldwell, Blake A; Hicks, Susan Elaine; Koch, Scott M; Naughton, III, Thomas J; Pogge, James R; Scott, Stephen L; Shipman, Galen M; Sorrillo, Lawrence

    2015-01-01

    The purpose of this report is to clarify the challenges associated with storage for secure enclaves. The major focus areas for the report are: - review of relevant parallel filesystem technologies to identify assets and gaps; - review of filesystem isolation/protection mechanisms, to include native filesystem capabilities and auxiliary/layered techniques; - definition of storage architectures that can be used for customizable compute enclaves (i.e., clarification of use-cases that must be supported for shared storage scenarios); - investigate vendor products related to secure storage. This study provides technical details on the storage and filesystem used for HPC with particular attention on elements that contribute to creating secure storage. We outline the pieces for a a shared storage architecture that balances protection and performance by leveraging the isolation capabilities available in filesystems and virtualization technologies to maintain the integrity of the data. Key Points: There are a few existing and in-progress protection features in Lustre related to secure storage, which are discussed in (Chapter 3.1). These include authentication capabilities like GSSAPI/Kerberos and the in-progress work for GSSAPI/Host-keys. The GPFS filesystem provides native support for encryption, which is not directly available in Lustre. Additionally, GPFS includes authentication/authorization mechanisms for inter-cluster sharing of filesystems (Chapter 3.2). The limitations of key importance for secure storage/filesystems are: (i) restricting sub-tree mounts for parallel filesystem (which is not directly supported in Lustre or GPFS), and (ii) segregation of hosts on the storage network and practical complications with dynamic additions to the storage network, e.g., LNET. A challenge for VM based use cases will be to provide efficient IO forwarding of the parallel filessytem from the host to the guest (VM). There are promising options like para-virtualized filesystems to help with this issue, which are a particular instances of the more general challenge of efficient host/guest IO that is the focus of interfaces like virtio. A collection of bridging technologies have been identified in Chapter 4, which can be helpful to overcome the limitations and challenges of supporting efficient storage for secure enclaves. The synthesis of native filesystem security mechanisms and bridging technologies led to an isolation-centric storage architecture that is proposed in Chapter 5, which leverages isolation mechanisms from different layers to facilitate secure storage for an enclave. Recommendations: The following highlights recommendations from the investigations done thus far. - The Lustre filesystem offers excellent performance but does not support some security related features, e.g., encryption, that are included in GPFS. If encryption is of paramount importance, then GPFS may be a more suitable choice. - There are several possible Lustre related enhancements that may provide functionality of use for secure-enclaves. However, since these features are not currently integrated, the use of Lustre as a secure storage system may require more direct involvement (support). (*The network that connects the storage subsystem and users, e.g., Lustre s LNET.) - The use of OpenStack with GPFS will be more streamlined than with Lustre, as there are available drivers for GPFS. - The Manilla project offers Filesystem as a Service for OpenStack and is worth further investigation. Manilla has some support for GPFS. - The proposed Lustre enhancement of Dynamic-LNET should be further investigated to provide more dynamic changes to the storage network which could be used to isolate hosts and their tenants. - The Linux namespaces offer a good solution for creating efficient restrictions to shared HPC filesystems. However, we still need to conduct a thorough round of storage/filesystem benchmarks. - Vendor products should be more closely reviewed, possibly to include evaluation of performance/protection of select products. (Note, we are investigation the option of evaluating equipment from Seagate/Xyratex.) Outline: The remainder of this report is structured as follows: - Section 1: Describes the growing importance of secure storage architectures and highlights some challenges for HPC. - Section 2: Provides background information on HPC storage architectures, relevant supporting technologies for secure storage and details on OpenStack components related to storage. Note, that background material on HPC storage architectures in this chapter can be skipped if the reader is already familiar with Lustre and GPFS. - Section 3: A review of protection mechanisms in two HPC filesystems; details about available isolation, authentication/authorization and performance capabilities are discussed. - Section 4: Describe technologies that can be used to bridge gaps in HPC storage and filesystems to facilitate...

  11. Nuclear Safeguards and Security Challenge:

    National Nuclear Security Administration (NNSA)

    Safeguards and Security Challenge: The international safeguards and security system is being challenged by evolving proliferation and terrorism threats, expanding International Atomic Energy Agency (IAEA) responsibilities, a retiring safeguards workforce, and the need for better technologies to detect and deter proliferation, theft, and sabotage. Response: Revitalize, strengthen, and sustain U.S. and international safeguards and security capabilities through the Next Generation Safeguards

  12. Armenia | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Armenia Armenia Secures Dangerous Radioactive Sources in Cooperation with NNSA The Department of Energy's National Nuclear Security Administration (NNSA) joined the Republic of Armenia today to announce the safe and secure removal of three unused radioactive sources from two locations in Yerevan, Armenia. The successful completion of the radioactive source recovery campaign

  13. The Cyber Security Crisis

    ScienceCinema (OSTI)

    Spafford, Eugene [Purdue University, West Lafayette, Indiana, United States

    2009-09-01

    Despite considerable activity and attention, the overall state of information security continues to get worse. Attacks are increasing, fraud and theft are rising, and losses may exceed $100 billion per year worldwide. Many factors contribute to this, including misplaced incentives for industry, a lack of attention by government, ineffective law enforcement, and an uninformed image of who the perpetrators really are. As a result, many of the intended attempts at solutions are of limited (if any) overall effectiveness. This presentation will illustrate some key aspects of the cyber security problem and its magnitude, as well as provide some insight into causes and enabling factors. The talk will conclude with some observations on how the computing community can help improve the situation, as well as some suggestions for 'cyber self-defense.'

  14. Security seal. [Patent application

    DOE Patents [OSTI]

    Gobeli, G.W.

    1981-11-17

    Security for a package or verifying seal in plastic material is provided by a print seal with unique thermally produced imprints in the plastic. If tampering is attempted, the material is irreparably damaged and thus detectable. The pattern of the imprints, similar to fingerprints are recorded as a positive identification for the seal, and corresponding recordings made to allow comparison. The integrity of the seal is proved by the comparison of imprint identification records made by laser beam projection.

  15. Securing Control Systems Modems

    Energy Savers [EERE]

    Securing America's Clean Energy Future The Office of Energy Efficiency and Renewable Energy (EERE) invests in clean energy technologies that strengthen the economy, reduce dependence on foreign oil, and protect the environment. EERE leverages partnerships with the private sector, state and local governments, DOE national laboratories, and universities to transform the nation's economic engine to one powered by clean energy. EERE Programs 2011 Budget (in $ millions) EERE operates with $1.8

  16. Global Security 2009

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LLNL-PRES-523744 This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344. Lawrence Livermore National Security, LLC DOE OCIO Open Government Technology Summit January 25, 2012 Lawrence Livermore National Laboratory LLNL-PRES-523744 2 1. Conceptualize  Define Problem  Frame Question  Identify Incentives 2. Develop  Develop Messaging  Build Website  Review & Release 3. Engage 

  17. National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nuclear Security Administration Savannah River Site 1 NNSA Budget ($ Millions) By Program Office FY 2015 Enacted FY 2016 Enacted FY 2017 President Request Delta FY Request Weapon Activities 241 242 252 10 Mixed Oxide Fuel Fabrication Facility (MOX) 340 332 270 (62) Defense Nuclear Nonproliferation (DNN) 77 58 91 33 Federal Expenses 4.7 5.2 5.4 .2 Total Budget for NNSA at SRS 662.7 637.2 618.4 (18.8)

  18. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal Opportunity Recruitment Program Plan Certification - Fiscal Year 2011 Please type or print clearly and return this sheet with original signature to: Ms. Carmen Andujar, Manager Recruiting, Examining and Assessment Group Center for Talent and Capacity Policy Strategic Human Resources Policy Attn: FY 2011 FEORP Report U.S. Office of Personnel Management 1900 E Street, NW, Room 6547 Washington, D.C. 20415-9800 A. Name

  19. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal Opportunity Recruitment Program Plan Certification - Fiscal Year 2009 Please type or print clearly and return this sheet with original signature to: Ms. Carmen Andujar, Manager Recruiting, Examining and Assessment Group Center for Talent and Capacity Policy Strategic Human Resources Policy Attn: FY 2009 FEORP Report U.S. Office of Personnel Management 1900 E Street, NW, Room 6547 Washington, D.C. 20415-9800 A. Name

  20. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    15 National Nuclear Security Administration FY 2013 PER Babcock & Wilcox Technical Services Pantex, LLC Performance Evaluation Report NNSA Production Office Pantex Plant Performance Period: October 2012 - September 2013 November 13, 2013 APPROVED FOR PUBLIC RELEASE This document has been approved for release to the public by: Name / Title: Del W. Kellogg, NPO Pantex Classification Officer Date: 01/06/2014 NNSA Production Office, Pantex 11-13-13 Page 2 of 15 IExecutive Summary This

  1. Safety and Security Policy Jobs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Health Safety and Health The DOE Headquarters Safety and Health Program provides information, guidelines, documentation, training, and materials pertaining to many aspects of Safety and Health within the HQ buildings. Question concerning the Headquarters Safety and Health Program can be directed to the Industrial Hygiene and Safety Office on 202-586-1005, or via e-mail to HQSafetyandHealth@hq.doe.gov. Information for Department of Energy Headquarters Personnel The Office of Industrial Hygiene

  2. Jason Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lee Jason Lee jason 1992 Jason R Lee Deputy of Networking and Security NERSC jason@lbl.gov Phone: (510) 486-7342 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Jason holds a MS in Computer Science from San Francisco State University. Jason is currently the Deputy of the Networking and Security Group, this involves handling the day-to-day operations and keeping the network flowing and security blocking. Jason has worked at Berkeley Lab since

  3. Craig Lant

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Craig Lant Craig Lant Craig-Lant.jpg Craig Lant Security Analyst Networking, Servers and Security Group CLant@lbl.gov Phone: (510) 423-3373 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Craig has more than 10 years of experience in a variety of computer security positions, with four years at Berkeley Lab and six years with UC Berkeley. His expertise includes firewalls, network intrusion detection systems, detecting compromised systems, and

  4. DOE - NNSA/NFO -- Nevada Test Tour Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NTS Tour Forms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Nevada National Security Site Tour Forms Groups and individuals wishing to tour the approximately 1,375-square-mile Nevada National Security Site should complete the Nevada National Security Site Tour Badging Form below and submit it via fax or postal mail to the Nevada Field Office's, Office of Public Affairs, Visit Coordination Staff. Click the document title to view or download the Adobe PDF file marked with this

  5. Headquarters Facilities Master Security Plan - Chapter 14, Cyber...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4, Cyber Security Headquarters Facilities Master Security Plan - Chapter 14, Cyber Security 2016 Headquarters Facilities Master Security Plan - Chapter 14, Cyber Security HQ cyber ...

  6. Santa | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Santa Santa Even Santa was subjected to security checks

  7. Enhancing Transportation Energy Security through Advanced Combustion...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Transportation Energy Security through Advanced Combustion and Fuels Technologies Enhancing Transportation Energy Security through Advanced Combustion and Fuels Technologies 2005 ...

  8. Perfecting marksmanship: Sandia California Security Police Officers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Perfecting marksmanship: Sandia California Security Police Officers train to improve ... Home NNSA Blog Perfecting marksmanship: Sandia California Security Police Officers ... ...

  9. Presidential Proclamation: Critical Infrastructure Security and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Presidential Proclamation: Critical Infrastructure Security and Resilience Month, 2013 Presidential Proclamation: Critical Infrastructure Security and Resilience Month, 2013 A ...

  10. Microsoft Word - Critical Infrastructure Security and Resilience...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Proclamation -- Critical Infrastructure Security and Resilience Month, 2013 CRITICAL INFRASTRUCTURE SECURITY AND RESILIENCE MONTH, 2013 - - - - - - - BY THE PRESIDENT OF THE ...

  11. Independent Oversight Review, National Nuclear Security Administration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Nuclear Security Administration Production Office - February 2014 Independent Oversight Review, National Nuclear Security Administration Production Office - February 2014 February ...

  12. Office of Security | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security Office of Security Mission The Office of Security maintains the Department of Energy's security integrity through the development and promulgation of safeguards and security policy for the protection of the National Security and other critical assets entrusted to the Department. The Office protects the Department's critical assets and national security by providing security expertise to assist Headquarters and field elements in planning site protection strategies and by coordinating

  13. Chapter_17_Headquarters_Security_Officer_Program

    Office of Environmental Management (EM)

    7 Headquarters Security Officer Program This chapter implements the requirements of HQ Order 472.1, Headquarters Security Officer Program. The goal of the Headquarters Security Officer or HSO Program is to have a knowledgeable security person within each HQ element to answer common security questions, process security documentation on behalf of the element's personnel, arrange for security services provided by AU-40, and serve as the element's security point of contact. In summary, HQ Order

  14. EIA-Voluntary Reporting of Greenhouse Gases Program - Contact

    U.S. Energy Information Administration (EIA) Indexed Site

    Contact Voluntary Reporting of Greenhouse Gases Program Contact For more information on the Voluntary Reporting of Greenhouse Gases Program, contact us via e-mail, phone, fax, or ...

  15. Brandon Fisher | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineering Specialist Senior Brandon Fisher News Atomically Thin Metallic Boron Telephone 630.252.5324 Fax 630.252.4646 E-mail bfisher@anl.gov

  16. Jonathan Logan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Ian McNulty) Jonathan Logan Telephone 630.252.4874 Fax 630.252.5739 E-mail jmlogan

  17. Nancy Dietz-Rago | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Materials Scientist Nancy Dietz-Rago Telephone 630.252.9798 Fax 630.252.5739 E-mail dietz@anl.gov

  18. Tal Heilpern | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Stephen Gray) Tal Heilpern Telephone 630.252.5884 Fax 630.252.4646 E-mail theilpern

  19. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Address: country Phone Number: Fax Number: E-mail: 20111110100931 Evan J. Kaufman Robbins Geller Rudman &38; Dowd LLP 58 South Service Road, Suite 200 Melville, NY 11747...

  20. HAN F OR

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fax Number: E-mail: United States na na Reasonably Describe Records: Description: Industrial Hygiene Chemical Vapor Technical Basis RPP-22491 Revision 1 Optional...

  1. BPA-2015-00051-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Carrie Henderson Email Organiz ation Mailing Address City State Phone FAX Ex. xxx-xxx-xxxx Date Redd: 1082014 Due Date: 1162014 Tracking Number;...

  2. https://www.fossil.energy.gov/app/fergas/ApplicationAction.go

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Code: Phone Number: ext. Fax: E-mail: Report Contact (Monthly Reports) Information: First Name: Last Name: Middle Initial: PositionTitle: Country: Street: City: StateProvince:...

  3. Laurie Eichberger | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executive Secretary Laurie Eichberger Telephone 630.252.7570 Fax 630.252.6866 E-mail eichberger@anl.gov

  4. Dean Carbaugh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Senior Technician Dean Carbaugh Telephone 630.252.4833 Fax 630.252.5739 E-mail dcarbaugh@anl.gov

  5. Deborah O'Rourke | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deborah O'Rourke NST Assistant Division Director Telephone 630.252.3810 Fax 630.252.6866 E-mail dorourke

  6. Joonseok Lee | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fellow (Supervisor, Elena Roshkova) News Piezoelectrically enhanced ferroelectric polymers via nanoscale mechanical annealing Telephone 630.252.7317 Fax 630.252.4646 E-mail...

  7. EM SSAB Local Board Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EM SSAB Local Board Contacts EM SSAB Local Board Contacts EM SSAB Federal Coordinators Hanford Kristen Skopeck Phone: (509) 376-5803 Fax: (509) 376-1563 E-mail: kristen.skopeck@rl.doe.gov Oak Ridge Melyssa Noe Phone: (865) 241-3315 Fax: (865) 241-6932 E-mail: noemp@oro.doe.gov Idaho Robert Pence Phone: (208) 526-6518 Fax: (208) 526-8789 E-mail: pencerl@id.doe.gov Paducah Robert Smith Phone: (270) 441-6821 Fax: (270) 441-6801 E-mail: robert.smith@lex.doe.gov Nevada Kelly Snyder Phone: (702)

  8. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Identification Device User print name Government AgencySponsored Company Visitor's Z Number or ID Number Email Address Phone Number Fax Number Mail Stop and Office Location...

  9. Alper Kinaci | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Maria Chan) Alper Kinaci Telephone 630.252.5378 Fax 630.252.4646 E-mail akinaci

  10. Na onal Security Site?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mul ple Choice (circle the correct answer) 1. How many diff erent animal species can be found at the Nevada Na onal Security Site? a. Less than 500 b. Exactly 1,325 c. More than 1,500 d. Exactly 2,303 2. Nuclear research, development and tes ng caused radioac ve contamina on of: a. Buildings b. Clothes and tools c. Soil and water d. All of the above 3. One method used to check soil for the presence of radioac ve contamina on is: a. Use a black light to see if the soil glows b. Send soil samples

  11. Cyberspace security system

    DOE Patents [OSTI]

    Abercrombie, Robert K; Sheldon, Frederick T; Ferragut, Erik M

    2014-06-24

    A system evaluates reliability, performance and/or safety by automatically assessing the targeted system's requirements. A cost metric quantifies the impact of failures as a function of failure cost per unit of time. The metrics or measurements may render real-time (or near real-time) outcomes by initiating active response against one or more high ranked threats. The system may support or may be executed in many domains including physical domains, cyber security domains, cyber-physical domains, infrastructure domains, etc. or any other domains that are subject to a threat or a loss.

  12. Dye filled security seal

    DOE Patents [OSTI]

    Wilson, Dennis C. W.

    1982-04-27

    A security seal for providing an indication of unauthorized access to a sealed object includes an elongate member to be entwined in the object such that access is denied unless the member is removed. The elongate member has a hollow, pressurizable chamber extending throughout its length that is filled with a permanent dye under greater than atmospheric pressure. Attempts to cut the member and weld it together are revealed when dye flows through a rupture in the chamber wall and stains the outside surface of the member.

  13. Property:Incentive/ContFax | Open Energy Information

    Open Energy Info (EERE)

    Regulations: No.27 - Control of Nitrogen Oxide Emissions (Rhode Island) + 401-222-2017 + Air Quality (Nova Scotia, Canada) + (902) 424-0503 + Air Quality Approvals and Permits...

  14. First Name: Last Name: Title: Telephone: Fax: Email: First Name...

    U.S. Energy Information Administration (EIA) Indexed Site

    NOTICE: This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  15. Y-12 National Security Site | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Y-12 National Security Site NNSA's Y-12 & Pantex partner donates $10,000 for children's hospital Y-12's Site Manager Bill Tindal (right) presents a $10,000 donation to East Tennessee Children's Hospital CEO Keith Goodwin in support of the hospital's capital campaign. NNSA's management and operations partner Consolidated Nuclear Security (CNS) continued its legacy of community giving this... Y-12 National Security Complex Completes W69 Dismantlement NNSA sites prepared for disasters using

  16. office of secure transportation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    office of secure transportation Acquisition and Project Management Office volunteers get up-close look at Office of Secure Transportation exercise Contracting professionals from the NNSA Acquisition & Project Management (APM) Field Program Section (FPS) recently served as role players for Office of Secure Transportation (OST) training exercises in Arkansas and Oklahoma. OST Federal Agents transport U.S. nuclear weapons, components and... General Davis kicks the tires on a Safeguards

  17. Security for Radioactive Sources: Fact Sheet | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration for Radioactive Sources: Fact Sheet March 23, 2012 Radioactive materials are a critical and beneficial component of global medical, industrial, and academic efforts. The possibility that these materials could be used by terrorists is a national security concern. The National Nuclear Security Administration (NNSA), along with international and domestic partners, addresses radiological material security as part of its nuclear nonproliferation mission. US Radioactive Material

  18. Y-12 National Security Complex | National Nuclear Security Administrat...

    National Nuclear Security Administration (NNSA)

    Y-12 National Security Complex Y-12 completes waste removal project two years ahead of ... accidents have increased in recent years, particularly with inclement weather... ...

  19. Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1995-09-28

    Ensures appropriate levels of protection against unauthorized access; theft, diversion, loss of custody, or destruction of nuclear weapons, or weapons components; espionage; loss or theft of classified matter or Government property; and other hostile acts that may cause unacceptable adverse impacts on national security or on the health and safety of Department of Energy (DOE) and contractor employees, the public, or the environment. DOE O 470.1 Extended until 5-11-06 by DOE N 251.63, dated 5-11-05. Chg 1, Safeguards and Security Program, dated 9/28/95, extended by DOE N 251.57, dated 4/28/2004. Change 1, 5/21/96, revises Chapter IV. Cancels: DOE 5630.11B, DOE 5630.13A, DOE 5630.14A, DOE 5630.15, DOE 5630.16A, DOE 5630.17, DOE 5631.1C, DOE 5631.4A, DOE 5634.1B, DOE 5634.3, DOE 5639.3, DOE M 5632.1C-1 in part.

  20. Security classification of information

    SciTech Connect (OSTI)

    Quist, A.S.

    1993-04-01

    This document is the second of a planned four-volume work that comprehensively discusses the security classification of information. The main focus of Volume 2 is on the principles for classification of information. Included herein are descriptions of the two major types of information that governments classify for national security reasons (subjective and objective information), guidance to use when determining whether information under consideration for classification is controlled by the government (a necessary requirement for classification to be effective), information disclosure risks and benefits (the benefits and costs of classification), standards to use when balancing information disclosure risks and benefits, guidance for assigning classification levels (Top Secret, Secret, or Confidential) to classified information, guidance for determining how long information should be classified (classification duration), classification of associations of information, classification of compilations of information, and principles for declassifying and downgrading information. Rules or principles of certain areas of our legal system (e.g., trade secret law) are sometimes mentioned to .provide added support to some of those classification principles.

  1. Secure authenticated video equipment

    SciTech Connect (OSTI)

    Doren, N.E.

    1993-07-01

    In the verification technology arena, there is a pressing need for surveillance and monitoring equipment that produces authentic, verifiable records of observed activities. Such a record provides the inspecting party with confidence that observed activities occurred as recorded, without undetected tampering or spoofing having taken place. The secure authenticated video equipment (SAVE) system provides an authenticated series of video images of an observed activity. Being self-contained and portable, it can be installed as a stand-alone surveillance system or used in conjunction with existing monitoring equipment in a non-invasive manner. Security is provided by a tamper-proof camera enclosure containing a private, electronic authentication key. Video data is transferred communication link consisting of a coaxial cable, fiber-optic link or other similar media. A video review station, located remotely from the camera, receives, validates, displays and stores the incoming data. Video data is validated within the review station using a public key, a copy of which is held by authorized panics. This scheme allows the holder of the public key to verify the authenticity of the recorded video data but precludes undetectable modification of the data generated by the tamper-protected private authentication key.

  2. Electronic security device

    DOE Patents [OSTI]

    Eschbach, E.A.; LeBlanc, E.J.; Griffin, J.W.

    1992-03-17

    The present invention relates to a security device having a control box containing an electronic system and a communications loop over which the system transmits a signal. The device is constructed so that the communications loop can extend from the control box across the boundary of a portal such as a door into a sealed enclosure into which access is restricted whereby the loop must be damaged or moved in order for an entry to be made into the enclosure. The device is adapted for detecting unauthorized entries into such enclosures such as rooms or containers and for recording the time at which such entries occur for later reference. Additionally, the device detects attempts to tamper or interfere with the operation of the device itself and records the time at which such events take place. In the preferred embodiment, the security device includes a microprocessor-based electronic system and a detection module capable of registering changes in the voltage and phase of the signal transmitted over the loop. 11 figs.

  3. Electronic security device

    DOE Patents [OSTI]

    Eschbach, Eugene A.; LeBlanc, Edward J.; Griffin, Jeffrey W.

    1992-01-01

    The present invention relates to a security device having a control box (12) containing an electronic system (50) and a communications loop (14) over which the system transmits a signal. The device is constructed so that the communications loop can extend from the control box across the boundary of a portal such as a door into a sealed enclosure into which access is restricted whereby the loop must be damaged or moved in order for an entry to be made into the enclosure. The device is adapted for detecting unauthorized entries into such enclosures such as rooms or containers and for recording the time at which such entries occur for later reference. Additionally, the device detects attempts to tamper or interfere with the operation of the device itself and records the time at which such events take place. In the preferred embodiment, the security device includes a microprocessor-based electronic system (50) and a detection module (72) capable of registering changes in the voltage and phase of the signal transmitted over the loop.

  4. LBNL SecureMessaging

    Energy Science and Technology Software Center (OSTI)

    2003-03-17

    The LBNLSecureMessaging application enables collaboration among colocated or geograhically dispersed users by supporting secure synchronous and asynchronous communication. This application is the graphical user interface client that is meant to be used in conjunction with servers (LBNL's PCCEServer and a customized IRC server) to allow group and one-to-one conversations via text-based instant messaging. Conversations may be private (by invitation only) or public (open to any member of a collaboratory group_ and they may be permanentmore » and on-going or temporary and ad hoc. Users may leave notes for other people who are online or offline. By providing presence and awareness information, collaborators can easily locate each other and rendezvous. Written in Java/Swing, this application is cross-platform. To gain access to functionality, users have to be registered with an authorization server (PCCEServer) that maintains an access control list. Thus a collaboration group is comprised of a set of PCCE-registered users. Registered users can log in via either X.509 certificate or a username and password combination. PKI and SSL are used to authenticate servers and clients and to encrypt messages sent over the network. The LBNLSecureMessaging application offers instant messaging capabilities in a secure environment that provides data integrity, privacyk authorization, and authentication.« less

  5. kcp | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home kcp Kansas City National Security Campus volunteers help students with FIRST Robotics The FIRST Robotics competition in Kansas City, March 10-12, resembled a medieval battlefield as nearly 50 high school teams battled robot against robot to scale the opponent's defenses and capture their tower and flag. For the past 10 years, Kansas City National Security Campus employees have... Under Secretary Klotz packs last crate at Kansas City Plant DOE Under Secretary for Nuclear Security and NNSA

  6. Nevada | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Nevada Ambassador Ensher visits Y-12 and NNSS Ambassador Henry S. Ensher, the top U.S. diplomat at the United States Mission to International Organizations in Vienna, Austria, recently visited two facilities to understand NNSA's mission better: the Y-12 National Security Complex and the Nevada National Security Site (NNSS). At Y-12, he... Department of Energy's chief risk officer visits Nevada National Security Site Earlier this month, Associate Deputy Secretary John MacWilliams visited the

  7. cdns | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    cdns Design Basis Threat NNSA has taken aggressive action to improve the security of its nuclear weapons material (often referred to as special nuclear material, or SNM) and nuclear weapons in its custody. One major challenge has been, and remains, ensuring that SNM is well protected, while at the same time,... Information Security Information security deals with requirements for the protection and control of information and matter required to be classified or controlled by statutes,

  8. contracts | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    contracts NNSA Demonstrates its Commitment to Small Business The National Nuclear Security Administration (NNSA) recently selected three small businesses for its new Information Technology (IT) Infrastructure and Cyber Security Support Blanket Purchase Agreement. The contract covers a wide spectrum of IT and Cyber Security support for NNSA's Office of... NNSA Makes Up to $200 Million in Awards to Five Small Business Teams for Enterprise-Wide Management, Organizational and Administrative Support

  9. Principal Associate Director - Global Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Principal Associate Director - Global Security As Principal Associate Director for Global Security, Terry Wallace leads Laboratory programs with special focus on developing and applying the scientific and engineering capabilities to address complex national and global security threats. Contact Operator Los Alamos National Laboratory (505) 667-5061 Wallace's expertise is forensic seismology, a highly specialized discipline focusing on detection and quantification of nuclear tests. Terry C.

  10. Center for Control System Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Control System Security Critical Infrastructure is at Risk As America's infrastructures have become more complex and interconnected, their operation and control has become more complicated as well. Automated control systems have been widely deployed to operate these infrastructures, and coupled with the networks they use to transfer data are a security vulnerability for the infrastructures they control. The Center for Control System Security at Sandia National Laboratories works with several

  11. Budget | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Budget Full details of the President's FY17 budget for NNSA are available here. National Nuclear Security Administration Highlights FY'17 Budget Request Budget Request Reflects Commitment to Maintain a Safe, Secure, and Effective Nuclear Deterrent; Prevent, Counter, and Respond to Global Nuclear Dangers; and Effectively Power the Nuclear Navy Feb. 9, 2016 (WASHINGTON) - The U.S. Department of Energy's (DOE) National Nuclear Security Administration (NNSA) today released details of its portion of

  12. Cyber Security for Electric Infrastructure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cyber Security for Electric Infrastructure - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management

  13. Mission | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Mission Mission Statement "Enhancing and ensuring the future of the Nuclear Security Enterprise through effective nuclear production operations" Mission Execute effective contract management and oversight to safely and securely maintain the nuclear weapon stockpile for the Nuclear Security Enterprise; provide enriched uranium for naval, research, and isotope production reactors, and support nonproliferation activities to reduce the global nuclear threat. Vision Make the world safer by

  14. transportation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    transportation Pantex Plant's Calvin Nelson honored as Analyst of the Year for Transportation Security Pantex's Calvin Nelson was recently awarded the 2015 Analyst of the Year for Transportation Security by the Department of Energy's Nuclear Materials Information Program. The award, for which Nelson is the first-ever Pantex recipient, recognizes outstanding analytic support to the NMIP. All... Office of Secure Transportation Celebrates 40th Anniversary On Thursday morning, Dec. 17, NNSA's Office

  15. Fax and Evaluation Letter: Fax transmits the following letter: Post-Cleanup Evaluation for the Southeast Drainage, February 12, 1999.

    Office of Legacy Management (LM)

  16. Security Cases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to administrative review citing as security concerns the individual's diagnosis of alcohol abuse and his alcohol-related arrests. After conducting a hearing, convened at the...

  17. Security Cases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of the individual to address concerns about his falsification of information and alcohol use. The individual's behavior raised security concerns under Criteria F, H and L....

  18. Australia | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Australia | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  19. testmenu | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    testmenu | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  20. Facility Security Officer Contractor Toolcart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Flowdown of Requirements Program Planning and Management DOE O 470.4B, Admin Chg 1, dated 2/15/13, Safeguards and Security Program. This order cancels DOE M 470.4-1, Chg 2, dated 10/20/10, Safeguards and Security Program Planning and Management Physical Security DOE NAP 70.2, Chg 1, dated 7/20/11, Physical Protection DOE O 470.3B, dated 8/12/08, Graded Security Protection (GSP) Policy. This policy is not available on the Directives Portal. Contact farateam@sandia.gov if you require access to

  1. DNDO | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Department of Energy National Nuclear Security Administration (NNSA) helicopter may be seen flying at low altitudes around the California Bay Area from September 1 - 6, 2015. The

  2. NSTec | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  3. Savannah | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  4. green | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  5. HSEMC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Blog Home HSEMC HSEMC Homeland Security and ... of Emergency Management assists the NNSA and Department of Energy sites in ... the NNSA Emergency Management System (EMS). ...

  6. fleet | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    fleet | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  7. VPP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    VPP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  8. ors | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ors | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  9. emt | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    emt | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  10. cielo | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cielo | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  11. IT | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    IT | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  12. OSIO | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    OSIO | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  13. OCPC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    OCPC | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  14. performance | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    performance | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  15. oversight | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    oversight | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  16. policy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    policy | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  17. sites | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    sites | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  18. AMP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    AMP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  19. fors | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    fors | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  20. airport | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    airport | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  1. Uzbekistan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Uzbekistan | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  2. removal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    removal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. foal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    foal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  4. Romania | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Romania | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  5. Korea | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Korea | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  6. ap | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ap | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  7. UPF | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    UPF | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  8. exports | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    exports | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  9. eota | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    eota | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  10. dhs | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    dhs | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  11. governance | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    governance | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  12. CFR | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    CFR | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  13. exportation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    exportation | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  14. nr | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nr | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  15. cyber | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    cyber | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  16. NMIP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NMIP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  17. forrestal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    forrestal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  18. associates | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    associates | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  19. tajikistan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    tajikistan | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  20. IND | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    IND | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  1. Links | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Links | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  2. noc | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    noc | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. energy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    energy | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS ... Apply for Our Jobs Our Jobs Working at NNSA Blog Home energy energy Researchers 3D print ...

  4. Newsletters | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the nuclear security enterprise. Online archives are available back to 2003. NNSA publishes a monthly newsletter featuring current events and activities across the nuclear ...

  5. Jamaica | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Jamaica Jamaica NNSA Removes U.S.-Origin HEU from Jamaica, Makes the Caribbean HEU Free WASHINGTON, D.C. - The Department of Energy's National Nuclear Security Administration...

  6. SSAC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    SSAC NNSA and IAEA Hold the 20th International Training Course on Nuclear Material Accounting and Control Washington, D.C. - The National Nuclear Security Administration (NNSA)...

  7. ONAC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ONAC NNSA and IAEA Hold the 20th International Training Course on Nuclear Material Accounting and Control Washington, D.C. - The National Nuclear Security Administration (NNSA)...

  8. Engineering | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA uses modern tools and capabilities in the engineering sciences field which are needed to ensure the safety, security, reliability and performance of the current and future ...

  9. Security Cases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a Local Security Office (LSO) cited a DOE psychiatrist's diagnoses of Post-Traumatic Stress Disorder and Delusional Disorder. The Administrative Judge found that the individual...

  10. Weapons | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    and Russia all with the goal of reducing nuclear weapons in both countries and, ultimately, lowering the global nuclear proliferation risk and increasing international security. ...

  11. counterproliferation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Security Administration (NNSA) released its report on NNSA's efforts to prevent nuclear proliferation and terrorism, Prevent, Counter, and Respond-A Strategic Plan to Reduce Global

  12. grant | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The Department of Energy's National Nuclear Security Administration ( NNSA Hosts Cybersecurity Consortium Members Following White House Announcement of 25 Million in Grants to...

  13. sliderphotos | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    sliderphotos | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  14. Security Cases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    alleged that the individual's admission that he had taken one of his dog's prescription pain pills (Tramadol) constituted illegal drug use which raised significant security...

  15. ITC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ITC | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  16. Security Awareness Reminders | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Awareness Reminders Security Awareness Reminders & Tips for the Jefferson Lab Community We continue to see in the news, reports informing the public of a general increase in threats and acts of violence in the United States and elsewhere in the world. At this time, there are no known threats to the Department of Energy or Jefferson Lab. But, this doesn't mean we can be complacent. On any given day Lab security is only as good as we are in following our security procedures. We

  17. internships | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    internships | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  18. dnn | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, Shaping the future of nuclear...

  19. gms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, NNSA Provides Tajikistan Specialized...

  20. radiation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, NNSA to Conduct Aerial Radiological...