National Library of Energy BETA

Sample records for mail completed forms

  1. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  2. OCPR Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OCPR Forms Technology Transfer Reporting Form Mediation Survey Form Agreement to Mediate Form Instructions: Fill out the form and e-mail the completed document to Office of ...

  3. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  4. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  5. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  6. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  7. Complete Set of all Reporting Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Federal Register Notice for Agency Information Collection Extension Office spreadsheet icon PROPOSED REVISED FORMS FOR MONTHLY REPORTING File Excel Version of All Reporting ...

  8. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  9. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  10. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  11. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  12. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  13. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  14. Covariant spectator theory for the electromagnetic three-nucleon form factors: Complete impulse approximation

    SciTech Connect (OSTI)

    Alexandre Pinto, S ergio; Stadler, Alfred; Gross, Franz

    2009-01-01

    We present the first calculations of the electromagnetic form factors of 3He and 3H within the framework of the Covariant Spectator Theory (CST). This first exploratory study concentrates on the sensitivity of the form factors to the strength of the scalar meson-nucleon off-shell coupling, known from previous studies to have a strong influence on the three-body binding energy. Results presented here were obtained using the complete impulse approximation (CIA), which includes contributions of relativistic origin that appear as two-body corrections in a non-relativistic framework, such as ?Z-graphs?, but omits other two and three-body currents. We compare our results to non-relativistic calculations augmented by relativistic corrections of O(v/c)2.

  15. Covariant spectator theory for the electromagnetic three-nucleon form factors: Complete impulse approximation

    SciTech Connect (OSTI)

    Sergio Alexandre Pinto, Alfred Stadler, Franz Gross

    2009-05-01

    We present the first calculations of the electromagnetic form factors of 3He and 3H within the framework of the Covariant Spectator Theory (CST). This first exploratory study concentrates on the sensitivity of the form factors to the strength of the scalar meson-nucleon off-shell coupling, known from previous studies to have a strong influence on the three-body binding energy. Results presented here were obtained using the complete impulse approximation (CIA), which includes contributions of relativistic origin that appear as two-body corrections in a non-relativistic framework, such as #28;Z-graphs#29;, but omits other two and three-body currents. We compare our results to non-relativistic calculations augmented by relativistic corrections of O(v/c)2.

  16. Covariant spectator theory for the electromagnetic three-nucleon form factors: Complete impulse approximation

    SciTech Connect (OSTI)

    Pinto, Sergio Alexandre; Stadler, Alfred; Gross, Franz

    2009-05-15

    We present the first calculations of the electromagnetic form factors of {sup 3}He and {sup 3}H within the framework of the Covariant Spectator Theory (CST). This first exploratory study concentrates on the sensitivity of the form factors to the strength of the scalar meson-nucleon off-shell coupling, known from previous studies to have a strong influence on the three-body binding energy. Results presented here were obtained using the complete impulse approximation (CIA), which includes contributions of relativistic origin that appear as two-body corrections in a nonrelativistic framework, such as 'Z-graphs', but omits other two and three-body currents. We compare our results to nonrelativistic calculations augmented by relativistic corrections of O(v/c){sup 2}.

  17. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  18. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  19. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  20. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  1. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  2. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  3. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  4. Omnidirectional capacitive probe for gauge of having a sensing tip formed as a substantially complete sphere

    DOE Patents [OSTI]

    Jostlein, Hans

    1994-01-01

    A non-contact, omni-directional capacitive probe for use in dimensional gauging includes an electrically conductive spherical sensing tip that forms a capacitor with a workpiece, the capacitance of the capacitor being indicative of the distance between the spherical sensing tip and the workpiece.

  5. SLAC Dosimeter / ID Request Form A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Feb 2009 (updated 13 May 2010) SLAC-I-760-0A07J-006-R010 1 of 2 SLAC Dosimeter / ID Request Form A (For applicants who have completed SLAC Environment, Safety, and Health Training) Sections 1-5 completed by applicant. Section 1: Contact Information Last name: First name: MI: Male Female Birth year (yyyy): Job title: Contact information/mailing address: City: State: Zip code: Country: Dept/Group: Phone number: Mail stop: Users or non-SLAC employees only: List employer, company, or university :

  6. Charge-conjugation symmetric complete impulse approximation for the pion electromagnetic form factor in the covariant spectator theory

    SciTech Connect (OSTI)

    Biernat, Elmar P.; Gross, Franz; Peña, M. T.; Stadler, Alfred

    2015-10-26

    The pion form factor is calculated in the framework of the charge-conjugation invariant covariant spectator theory. This formalism is established in Minkowski space, and the calculation is set up in momentum space. In a previous calculation we included only the leading pole coming from the spectator quark (referred to as the relativistic impulse approximation). In this study we also include the contributions from the poles of the quark which interacts with the photon and average over all poles in both the upper and lower half-planes in order to preserve charge conjugation invariance (referred to as the C-symmetric complete impulse approximation). We find that for small pion mass these contributions are significant at all values of the four-momentum transfer Q2 but, surprisingly, do not alter the shape obtained from the spectator poles alone.

  7. Charge-conjugation symmetric complete impulse approximation for the pion electromagnetic form factor in the covariant spectator theory

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Biernat, Elmar P.; Gross, Franz; Peña, M. T.; Stadler, Alfred

    2015-10-26

    The pion form factor is calculated in the framework of the charge-conjugation invariant covariant spectator theory. This formalism is established in Minkowski space, and the calculation is set up in momentum space. In a previous calculation we included only the leading pole coming from the spectator quark (referred to as the relativistic impulse approximation). In this study we also include the contributions from the poles of the quark which interacts with the photon and average over all poles in both the upper and lower half-planes in order to preserve charge conjugation invariance (referred to as the C-symmetric complete impulse approximation).more » We find that for small pion mass these contributions are significant at all values of the four-momentum transfer Q2 but, surprisingly, do not alter the shape obtained from the spectator poles alone.« less

  8. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  9. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  10. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  11. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  12. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  13. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  14. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  15. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  16. Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    132014 10:58 AM Submitted by Anonymous User This message was created by a Microsoft InfoPath form. The form data may be included as an attachment. Freedom of Information Act...

  17. Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9:27 PM Submitted by Anonymous User This message was created by a Microsoft InfoPath form. The form data may be included as an attachment. Freedom of Information Act (FOIA)...

  18. Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forms and Checklists Download or view forms and checklists used at WNR. IWD Forms 2100 - Integrated Work Document (IWD) Part 1, Activity Specific Information (word version) 2100_con - Integrated Work Document (IWD) Part 1, Activity Specific Information Continuation Page (word version) 2101 - Integrated Work Document (IWD) Part 2, FOD Requirements and Approval for Entry and Area Hazards and Controls, Non-Tenant Activity Form (word version) 2102 - Integrated Work Document (IWD) Part 2, FOD

  19. Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    completed 20 or more years of Reserve or National Guard service but will not receive a pension until age 60.) SF-181 Ethnicity and Race Identification Ethnicity and Race...

  20. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  1. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  2. Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Privacy Act must be signed and, therefore, cannot be submitted : on this form. t Name Richard van Dijk Email , Orga nizati on Mailin g Addre ss city PA State I P Pion e Ex....

  3. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  4. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  5. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  11. LANSCE Training Office Process Improvement Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Training Office Process Improvement Form You recently contacted our training service department. We want to assure that you're satisfied with our service. Please complete this short survey. Your feedback will be used to improve our service. How did you contact the TA-53 Training office for training? In Person Telephone E-Mail Response Time What was the reason for your request? Badge reader access Proctoring Training Report/Status Other______________ The Training Office handled my request

  12. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  13. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  14. SSRL Computer Account Request Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SSRL/LCLS Computer Account Request Form August 2009 Fill in this form and sign the security statement mentioned at the bottom of this page to obtain an account. Your Name: __________________________________________________________ Institution: ___________________________________________________________ Mailing Address: ______________________________________________________ Email Address: _______________________________________________________ Telephone:

  15. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  16. OFFSITE USE FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OFFSITE USE FORM Fill form out in triplicate, send original to Property Control, m/s 85A, give a copy to the Gate Guard and keep a copy for your files. This form needs to be updated once a year. Stanford Linear Accelerator Center Authorization Record Form: Stanford University Removal of Government Property from SLAC PO Box 4349 premises for Official Use Elsewhere (*) Date: To: Property Control, m/s 85A From: Name E Mail Address Group and Mail Stop SLAC Extension This is to notify you that I have

  17. DOE - NNSA/NFO -- Nevada Test Tour Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NTS Tour Forms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Nevada National Security Site Tour Forms Groups and individuals wishing to tour the approximately 1,375-square-mile Nevada National Security Site should complete the Nevada National Security Site Tour Badging Form below and submit it via fax or postal mail to the Nevada Field Office's, Office of Public Affairs, Visit Coordination Staff. Click the document title to view or download the Adobe PDF file marked with this

  18. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  19. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  20. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  1. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  2. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  3. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  4. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  5. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  6. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  7. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  8. Section L - Attachment D - Past-Performance Information Form

    National Nuclear Security Administration (NNSA)

    L, Attachment E, Page 1 SECTION L ATTACHMENT E PAST PERFORMANCE INFORMATION FORM 1. Complete Name of Offeror or Team Member 2. Contract Title and Location 3. Customer Name, Current Address, Telephone Number and E-mail 4. Contract Number and Type of Contract 5. Date of Contract Award 6. Date Work Commenced 7. Date the Work was Completed 8. Initial Contract Price /Estimated Cost and Fee 9. Final Amount Invoiced/Amount Invoiced to Date 10a. Technical Point of Contact (see instruction below) 10b.

  9. Section L - Attachment D - Past-Performance Information Form

    National Nuclear Security Administration (NNSA)

    L, Attachment E, Page 1 SECTION L ATTACHMENT E PAST PERFORMANCE INFORMATION FORM 1. Complete Name of Offeror or Team Member 2. Contract Title and Location 3. Customer Name, Current Address, Telephone Number and E-mail 4. Contract Number and Type of Contract 5. Date of Contract Award 6. Date Work Commenced 7. Date the Work was Completed 8. Initial Contract Price /Estimated Cost and Fee 9. Final Amount Invoiced/Amount Invoiced to Date 10a. Technical Point of Contact (see instruction below) 10b.

  10. Section L - Attachment D - Past-Performance Information Form

    National Nuclear Security Administration (NNSA)

    E, Page 1 SECTION L ATTACHMENT E PAST PERFORMANCE INFORMATION FORM 1. Complete Name of Offeror or Team Member 2. Contract Title and Location 3. Customer Name, Current Address, Telephone Number and E-mail 4. Contract Number and Type of Contract 5. Date of Contract Award 6. Date Work Commenced 7. Date the Work was Completed 8. Initial Contract Price /Estimated Cost and Fee 9. Final Amount Invoiced/Amount Invoiced to Date 10a. Technical Point of Contact (see instruction below) 10b. Contracting

  11. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  12. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  13. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  14. Microsoft Word - beamtime_request_form.dot

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BEAMTIME REQUEST FORM Please forward to Craig Stevens by Fax: 578-6954, or mail to CAMDLSU, 6980 Jefferson Highway, Baton Rouge, LA 70806, Room 107. Project Reference Number...

  15. Instructions For Completing Certified Payroll Report Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    otherwise, you may skip this box. See "Fringe Benefits" below. Payment of not less than time and one-half the basic or regular rate paid is required for overtime under the...

  16. COMPLETE LISTING:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    COMPLETE LISTING: DISPOSITION AUTHORITIES FROZEN UNDER THE EPIDEMIOLOGICAL MORATORIUM MARCH 2008 Listed below are all the disposition authorities which are under the moratorium on the destruction of health related records as of March 2008. All records scheduled under these authorities at Department of Energy (DOE) headquarters and field sites should be preserved past their normal retention periods unless an headquarters organization or a field site has obtained permission to remove records

  17. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complaint Form Complaint Form The Office of Inspector General (OIG) maintains a Hotline to facilitate the reporting of allegations of fraud, waste, abuse, or mismanagement in U.S. Department of Energy (DOE) programs or operations. To submit an allegation to the OIG, complete the form below. Acknowledgement * I acknowledge that I have read the Office of Inspector General Hotline section of the OIG website regarding issues which should be reported to the OIG, complaint processing, anonymity and

  18. Filter Replacement Activities Complete

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Filing Information Filing Information The Office of Hearings and Appeals (OHA) encourages electronic filing of submissions, by e-mail or by telefax. OHA's e-mail address for filing submissions is OHA.filings@hq.doe.gov; the OHA telefax number is (202) 287-1415. Note, however, that because of signature issues, we may ask you to file a signed original of a document. We will send an acknowledgment (by letter or e-mail) upon our receipt of all principal pleadings. If you choose to file by regular

  19. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  20. Benefit Forms

    Broader source: Energy.gov [DOE]

    The employment and benefits forms that you will be asked to complete as part of this orientation program can be numerous. Each, however, serves an important purpose in ensuring proper recording of...

  1. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  2. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  3. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  4. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  5. EEO PRECOMPLAINT COUNSELING INTAKE FORM

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ENERGY EEO PRE-COUNSELING INTAKE PART I. COMPLAINANT CONTACT INFORMATION: 1. NAME: 2. PREFERRED MAILING ADDRESS: 3. HOME PHONE: WORK PHONE: 4. PREFERRED EMAIL: If you are a current DOE employee, please complete the following: 5. DOE OFFICE: 6. OFFICE ADDRESS: 7. JOB TITLE, SERIES, GRADE: PART 2. DISCRIMINATION INFORMATION: Prohibited discrimination includes actions taken based upon your race, sex, color, religion, age (40 and over), national origin, physical and/or mental disability, genetic

  6. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  7. Standard Form 120

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stan Calvert About Us Stan Calvert - Wind Systems Integration Team Lead, Wind & Water Power Program Stan Calvert is the Wind Systems Integration Team Lead for the Wind and Water Power Program. Most Recent Today's Forecast: Improved Wind Predictions July 20

    1 OF STANDARD FORM 120# REV. APRIL 1957 GEN. SERV. ADMIN. FPMR (41 CFR) 101-43.311 PROPERTY REPORT OF EXCESS PERSONAL 1. REPORT NO. 2. DATE MAILED 3. TOTAL COST 4. TYPE (Check one only of  a. ORIGINAL  c. PARTIAL W/D (Also

  8. Nevada Proof of Completion of Work (Water Right) | Open Energy...

    Open Energy Info (EERE)

    Proof of Completion of Work (Water Right) Abstract Required notice of completion of diversion works for establishing a water right. Form Type ApplicationNotice Form Topic Proof...

  9. STEP 1: TO BE COMPLETED BY ALCOHOL TECHNICIAN

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Human Reliability Program (HRP) Alcohol Testing Form (Instructions for completing this form are attached.) STEP 1: TO BE COMPLETED BY ALCOHOL TECHNICIAN A. Employee Name ...

  10. Montana MPDES General Information Form (MDEQ Form 1) | Open Energy...

    Open Energy Info (EERE)

    (MDEQ Form 1) Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: Montana MPDES General Information Form (MDEQ Form 1) Abstract Completion of form allows...

  11. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  12. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  13. Service Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Service Forms Beamtime Request Form Deposition Request Form Exposure Request Form - pdf Fly Cutting Request Form Hot Embossing Request Form Metrology Request Form

  14. Product Information Form

    Broader source: Energy.gov [DOE]

    When planning to present a new product to the EERE Product Governance Team, complete this product information form and email it to ee.communications@ee.doe.gov.

  15. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  16. Electronic Comment Form | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Electronic Comment Form Draft site-wide environmental impact statement for the continued operation of the DOE/NNSA Nevada National Security Site and off-site locations in the State of Nevada. DOE/NNSA will accept comments until December 2, 2011 Name * E-mail (optional) Organization Comment * Leave this field blank Submit

  17. Completeness for sparse potential scattering

    SciTech Connect (OSTI)

    Shen, Zhongwei

    2014-01-15

    The present paper is devoted to the scattering theory of a class of continuum Schrdinger operators with deterministic sparse potentials. We first establish the limiting absorption principle for both modified free resolvents and modified perturbed resolvents. This actually is a weak form of the classical limiting absorption principle. We then prove the existence and completeness of local wave operators, which, in particular, imply the existence of wave operators. Under additional assumptions on the sparse potential, we prove the completeness of wave operators. In the context of continuum Schrdinger operators with sparse potentials, this paper gives the first proof of the completeness of wave operators.

  18. News/Forms/Annual Report/Templates | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News/Forms/Annual Report/Templates News/Forms/Annual Report/Templates Newsletters and Latest Publications Newsletters Forms Annual Report to OMB Templates For Additional Information Contact: Jeffrey Feit phone: 301-903-0471 e-mail: jeffrey.feit@hq.doe.gov

  19. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  20. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  1. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  2. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training...

  3. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  4. CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records CONTACTS FOR INFORMATION MANAGEMENT: Forms & Records Maria Levesque, Director Enterprise Records Management Division (IM-23) Email: Maria.Levesque@hq.doe.gov Troy Manigault, Departmental Records Officer Deidre Wilkerson, Management Analyst Tonya Meadows, Management Analyst Gale Mitchell, Management Analyst Markus Robinson - Contractor Greg Holland - Contractor Andrea Heimbrock - Contractor Records Management Program E-mail:

  5. JLF Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    JLF Forms JLF Target Fab Request JLF Experiment Worksheet JLF-Experimental Team Registration Form JLF-LLNL Participant Registration Form JLF-External Participant Registration Form JLF-Debriefing Form

  6. FermiCulture Subscription Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The FermiCulture email list is used to send email announcements and reminders about upcoming cultural events at Fermilab (e.g., the Fermilab Arts, Film, and Lecture series). This is a private, announcement-only mail list and will never be used for spamming or discussions. Subscribers receive approximately five emails per month. Use the form below to subscribe to (or unsubscribe from) the FermiCulture list. Email address: Name (First Last): Subscribe to email list Unsubscribe from email list Send

  7. Security Review Processing Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Security Review Processing Form Security Review Processing Form Security Review Process - Please review carefully. Security Acknowledge Form - Complete and return immediately. ...

  8. Deactivation Completion and Turnover

    Broader source: Energy.gov [DOE]

    Achieving consensus that deactivation is complete can involve several parties including the deactivation contractor, the Field Office, DOE Headquarters, the post-deactivation contractor, regulators...

  9. Online Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Microfabrication | Safety Online Forms, Guidelines & Policies Questions of How to Get Started? - Click here! User Forms: Beamtime Request Form - pdf CAMD Gas Cylinder Request Form - pdf Compressed Gas Purchase Order - pdf Exposure Request Form - pdf (How To Fill the Exposure Request Form?) Format for Annual User Reports - pdf Microfabrication Project Proposal Form - pdf Synchrotron Project Proposal Form - pdf Registration & Test Application for Facility Access & Radiation Badge - pdf

  10. GUIDANCE TO COMPLETING THE SELF-DIRECTED RBSM INTERVIEW FORM

    Office of Environmental Management (EM)

    Distribution Workshop - Documents GTT 2012 Distribution Workshop - Documents Use the links below to download documents from the GTT's Distribution Workshop, held September 24-26, 2012 PDF icon Agenda PDF icon Roster of Attendees PDF icon Presentation - Welcome and Introduction to the Grid Tech Team, Vision, and Framework - Anjan Bose, DOE PDF icon Presentation - OE's Smart Grid ACtivities in the Distribution System - Patricia Hoffman, DOE PDF icon Presentation - Electricity Distribution Systems

  11. Edison's move has completed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    completed January 8, 2016 by Richard Gerber We're pleased to announce that Edison is once again available to all NERSC users. The move from the NERSC Oakland Scientific Facility...

  12. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  13. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  14. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  15. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  16. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  17. Complete Safety Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Safety Training Print Facility Safety Training Required for ALL Users Users must register with the ALS to obtain an LBNL ID number before they can complete safety training courses. Once registered, choose the non-LDAP login and enter your LBNL ID number to begin. ALS 1001: Safety at the ALS EHS 0470: General Employee Radiation Training (GERT) Special Training Required for Some Users Laser Safety Users working with a Class 3B/4 laser EHS 0302 Macromolecular Crystallography Users

  18. Complete EOS for PBX 9502

    SciTech Connect (OSTI)

    Menikoff, Ralph S

    2009-10-08

    PBX 9502 is an insensitive plastic-bonded explosive based on triamino-trinitrobenzene (TATB). A complete equation of state (EOS) is constructed for unreacted PBX 9502 suitable for reactive burn models, i.e., high pressure regime in which material strength is unimportant. The PBX EOS is composed of two parts: a complete EOS for TATB and a porosity model which allows for variations in the initial PBX density. The TATB EOS is based on a cold curve and a thermal model for lattice vibrations. The heat capacity, and hence thermal model, is determined by the vibrational spectrum from Raman scattering. The cold curve is calibrated to diamond anvil cell data for isothermal compression using a two-piece Keane fitting form. Hugoniot data for PBX 9502 is used as a consistency check.

  19. Franklin Completed Jobs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Completed Jobs Franklin Completed Jobs Select a time period Show jobs that completed after Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 @ 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 : 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46

  20. Fire Protection Account Request Form

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fire Protection System Account Request Form To obtain a user id and password to access the Fire Protection system, please complete the form, save the file and email it to...

  1. Microsoft Word - LANL SCI CLEARANCE REQUEST FORM.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    classified information. Do not use MAC Preview tool to complete this form as the tool causes data corruption issues. Submit completed form and your IGPPS proposal to...

  2. Form W-4 (2015

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Form W-4 (2015) The exceptions do not apply to supplemental wages greater than $1,000,000. Nonwage income. If you'have a large amount of nonwage income, such as interest or dividends, consider making estimated tax payments using Form . 1040-ES, Estimated Tax for Individuals. Otherwise, you may owe additional tax. If you have pension or annuity income, see Pub. 505 to find out if you should adjust your withholding on Form W-4 or W-4P. Purpose. Complete Form W-4 so that your employer can withhold

  3. 2014 Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada

    Office of Legacy Management (LM)

    Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada November 2015 Approved for public release; further dissemination unlimited LMS/SHL/S12297 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: orders@ntis.gov Online Ordering: http://www.ntis.gov/help/ordermethods.aspx Available electronically at

  4. Technology Transfer Reporting Form

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This form is to be completed by the TTO for individual inquiry/case activity during the quarter as required by the Technology Transfer Commercialization Act of 2000. Mouse over definitions and descriptions appear over text/check boxes where appropriate. After completing this form, click on the submit button. *If you have no TTO activity for the quarter, please fill in your name, FY and quarter, lab or facility and check the box "No Quarterly Activity". Initial Ombuds Contact:

  5. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  6. User Financial Account Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2/20/13 User Financial Account Form Establish a user financial account at SLAC to procure gases, chemicals, supplies or services to support your experiment at SLAC's user facilities and to send samples, dewars, or other equipment between SLAC and your institution. To open or renew your SLAC user financial account, complete and submit this form along with a Purchase Order (PO) from your institution. The PO should be made to SLAC National Accelerator Laboratory for the amount of estimated

  7. User Financial Account Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10/21/15 User Financial Account Form Establish a user financial account at SLAC to procure gases, chemicals, supplies or services to support your experiment at SLAC's user facilities or to send samples, dewars, or other equipment between SLAC and your institution. To open or renew your SLAC user financial account, complete and submit this form along with a Purchase Order (PO) from your institution. The PO should be made to SLAC National Accelerator Laboratory for the amount of estimated

  8. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  9. Completion and workover fluid

    SciTech Connect (OSTI)

    Block, J.

    1985-09-17

    An aqueous completion or workover fluid for oil or gas wells having at least two solid components. One component is a hydroxy containing aluminum compound represented by the formula AlO(OH).xH/sub 2/O. The second component is a fluid loss control agent which can be either a cross-linked polyvinyl alcohol or a cross-linked hydroxyalkyl cellulose reaction product. An acid soluble weighting agent can be added for wells having higher down hole pressures. Examples of the weighting agents include iron carbonates, iron oxides, calcium carbonates, dolomite, sodium or calcium chloride, zinc bromide and calcium bromide. After use, the fluid can be displaced from the well with acid, e.g. 15% HCl, and the cake previously deposited on the bore-hole wall is dissolved by the acid so that no damaging residue remains.

  10. ARM - Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send Forms To assist researchers in the conduct of field campaigns or required administrative procedures (such as Baseline Change Requests), we provide a number of...

  11. Completed EISs | Department of Energy

    Energy Savers [EERE]

    CompleteProject List.doc� CompleteProject List.doc� PDF icon CompleteProject List.doc� More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

    Completed EISs Completed EISs Comprehensive EIS list PDF icon Completed EISs More Documents & Publications Environmental Impact Statements and Environmental Assessments Status Chart NEPA Documentation 2013 Annual

  12. JOBAID-COMPLETING AN EXTERNAL TRAINING REQUEST (SF-182)

    Broader source: Energy.gov [DOE]

    The purpsoe of this job aid is to guide users through the step-by-step process of completing an external training request form (SF-182).

  13. Employee In-Processing Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Employee In-Processing Forms Employee In-Processing Forms Editable PDF in-processing forms which can be filled out by new employees prior to their first day of work PDF icon Employee In-Processing Forms Responsible Contacts Ernita Collins SUPERVISORY HUMAN RESOURCES SPECIALIST E-mail ernita.collins@hq.doe.gov Phone 202-586-7020 More Documents & Publications W4, Federal Withholding Tax Form DOE F 1500.7 PSH-13-0035 - In the Matter of Personnel Security Hearing

  14. RRC - Geothermal Production Test Completion or Recompletion Report...

    Open Energy Info (EERE)

    Geothermal Production Test Completion or Recompletion Report and Log Form GT-1 Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: RRC - Geothermal Production...

  15. EEOC FORM

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Management Directive-715 Fiscal Year 2012 DOE NNSA February 4, 2013 i National Nuclear Security Administration U.S. Department of Energy ANNUAL EEO PROGRAM STATUS REPORT EEO PLAN TO ATTAIN THE ESSENTIAL ELEMENTS OF A MODEL EEO PROGRAM Table of Contents Page FORM 715-01 Part A Department or Agency Identifying Information......................1 FORM 715-01 Part B Total

  16. Form Approved

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OGE Form 450, 5 CFR Part 2634, Subpart I U.S. Office of Government Ethics (January 2007) (Replaces September 2002 edition) Form Approved OMB NO. 3209-0006 CONFIDENTIAL FINANCIAL DISCLOSURE REPORT Executive Branch Why Must I File? The duties and responsibilities of your position require you to file the Confidential Financial Disclosure Report to avoid involvement in a real or apparent conflict of interest. The purpose of this report is to assist employees and their agencies in avoiding conflicts

  17. Report of International Electric Import/Export Data: Form OE...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    International Electric ImportExport Data: Form OE-781R Instructions Report of International Electric ImportExport Data: Form OE-781R Instructions Instructions for completing Form ...

  18. Registration Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Registration Form Registration Form Register for the Fall 2015 Tritium Focus Group Meeting sponsored by LANL. Contacts Mike Rogers (505) 665-2513 Email Chandra Savage Marsden (505) 664-0183 Email First Name: Last Name: Job Title: Company/Organization: Address: City, State, Zip Code: Email: Phone Number: Are you a US citizen? Yes No Do you have a DOE Q Clearance? Yes No Will you be giving a presentation? Yes No Maybe Are you interested in attending the classified session? Yes No Maybe Are you

  19. Apparatus for the concurrent inspection of partially completed welds

    DOE Patents [OSTI]

    Smartt, Herschel B.; Johnson, John A.; Larsen, Eric D.; Bitsoi, Rodney J.; Perrenoud, Ben C.; Miller, Karen S.; Pace, David P.

    2002-01-01

    An apparatus for the concurrent inspection of partially completed welds is described in which is utilized in combination with a moveable welder for forming a partially completed weld, and an ultrasonic generator mounted on a moveable welder in which is reciprocally moveable along a path of travel which is laterally disposed relative to the partially completed weld.

  20. Completed Sites | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Completed Sites Completed Sites Completed Sites The Office of Environmental Management (EM) has been or is currently responsible for cleaning up sites across the United States. These sites were associated with the legacy of the nation's nuclear weapons program and other DOE research and development activities. Many of these sites have been cleaned up and transferred to other entities or to DOE's Legacy Management (LM) Program. Completed Sites Listing

  1. Administrative Forms/Policies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Forms Microfab Project Proposal Form Exit Form After Hours Request Form

  2. CFCNCA Sample Pledge Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CFCNCA Sample Pledge Form CFCNCA Sample Pledge Form This file contains a sample pledge form and instructions for completing a paper donation through the CFC. PDF icon CFCNCA Fall 2012 Sample Pledge Form.pdf More Documents & Publications CFCNCA Sample Pledge Form 2012 CFCNCA Catalog of Caring DOE F 3630.1 Rights and Benefits of Reservists Called to Active Duty

  3. Form EIA-860 Instructions | Open Energy Information

    Open Energy Info (EERE)

    plants with instructions on completing Form EIA-860. The U.S. Energy Information Administration (EIA) requires certain developers of electric generating plants (meeting defined...

  4. Complaint Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Complaint Form Complaint Form The Office of Inspector General (OIG) maintains a Hotline to facilitate the reporting of allegations of fraud, waste, abuse, or mismanagement in U.S. Department of Energy (DOE) programs or operations. To submit an allegation to the OIG, complete the form below. Acknowledgement * I acknowledge that I have read the Office of Inspector General Hotline section of the OIG website regarding issues which should be reported to the OIG, complaint processing, anonymity and

  5. Pure-state informationally complete and 'really' complete measurements

    SciTech Connect (OSTI)

    Finkelstein, J.

    2004-11-01

    I construct a positive-operator-valued measure (POVM) which has 2d rank-1 elements and which is informationally complete for generic pure states in d dimensions, thus confirming a conjecture made by Flammia, Silberfarb, and Caves (e-print quant-ph/0404137). I show that if a rank-1 POVM is required to be informationally complete for all pure states in d dimensions, it must have at least 3d-2 elements. I also show that, in a POVM which is informationally complete for all pure states in d dimensions, for any vector there must be at least 2d-1 POVM elements which do not annihilate that vector.

  6. New Employee Forms | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    check in process, you may print off the forms below and bring the completed forms to the Human Resources Office on your first day of work. New employees or returning employees...

  7. DOCUMENT RELEASE FORM C

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RELEASE FORM C (1) Document Number: RPP-RPT-431 74 (2) Revision Number: (3) Effective Date: 9/30/2009 (4) Document Type: El Digital Image El Hard copy (a) Number of pages (including the DRF) or 107 E PDF E] Video number of digital images (5) Release Type 0 New El Cancel El Page Change El complete Revision (6) Document Title: 2009 Auto-TOR for Tank 241 -T-204 (7) Change/Release Initial Issuance Description: (8) Change Initial Issuance Justification: (9) Associated (a) Structure Location: (c)

  8. Microsoft Word - FORM46001.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (Name, address, phone and E-mail) 13. RECIPIENT TYPE STATE GOV'T INDIAN TRIBAL GOV'T HOSPITAL FOR PROFIT INDIVIDUAL ORGANIZATION LOCAL GOV'T INSTITUTION OF OTHER NONPROFIT C P SP ...

  9. CAIRS Registration Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Registration Form CAIRS Registration Form June 12, 2002 Computerized Accident/Incident Reporting System (CAIRS) User Registration Form Completed registration request should be sent by facsimile to EHSS InfoCenter at (301) 903-9823 PDF icon CAIRS Registration Form More Documents & Publications ORPS User Registration Form Headquarters Facilities Master Security Plan - Chapter 13, Controlled Unclassified Information Fire Protection System Account Request Form

  10. APPENDIX A: Forms and Instructions Form Form R93D-44 Form R93D...

    U.S. Energy Information Administration (EIA) Indexed Site

    and Instructions Form Form R93D-44 Form R93D-03 Form R93D-59 Instructions Form RT94-02 Form RT94-04 Form RT94-0 Form RT94-03 Form RT94-05 Form RT94-06 Instructions Form...

  11. ORPS Facility Registration Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Facility Registration Form ORPS Facility Registration Form June 9, 2014 Add, Change or Delete a Facility for Occurrence Reporting and Processing System Submit completed form to: U.S. Department of Energy AU User Support EMAIL: ORPSsupport@hq.doe.gov PHONE: 800-473-4375 FAX: 301-903-9823 Note: Only one facility per form Type or print all entries TYPE OF CHANGE: Add a Facility (Complete Section 1.A, then go to Section 2) Change a Facility (Complete Section 1.B, then go to Section) Delete a

  12. Well completion and servicing fluid

    SciTech Connect (OSTI)

    Grimsley, R.L.

    1990-09-25

    This patent describes a well completion servicing fluid for controlling formation pressure during completion or servicing of a well. It comprises: an aqueous solution of calcium chloride, a solid weighing agent suspended in the solution and being selected from the group consisting of zinc, zinc oxide, and mixtures thereof; and a viscosifier dissolved in the solution in an amount effective to suspend the weighing agent. The fluid has a density of greater than 15 pounds per gallon and being substantially free of bromide ions and being substantially free of solid material which is not soluble in hydrochloric acid.

  13. Completed NSTX-U. After

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    panel (15 tons) being inserted into the new neutral beam box. New neutral beam box (40 tons) being moved into the NSTX-U test cell. Center stack encased within the vacuum boundary and lowered into the NSTX-U. Completed center stack installed in the NSTX-U. Completed NSTX-U. After Original NSTX prior to the upgrade. Before Building the first quadrant of the center stack magnet. Winding the ohmic heating coil around the center stack. National Spherical Torus Experiment - Upgrade NSTX was a

  14. Administration Building demolition completed under budget

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Building demolition completed under budget Administration Building demolition completed under budget Project activities started in April 2009 and was completed five...

  15. Densified waste form and method for forming

    DOE Patents [OSTI]

    Garino, Terry J.; Nenoff, Tina M.; Sava Gallis, Dorina Florentina

    2015-08-25

    Materials and methods of making densified waste forms for temperature sensitive waste material, such as nuclear waste, formed with low temperature processing using metallic powder that forms the matrix that encapsulates the temperature sensitive waste material. The densified waste form includes a temperature sensitive waste material in a physically densified matrix, the matrix is a compacted metallic powder. The method for forming the densified waste form includes mixing a metallic powder and a temperature sensitive waste material to form a waste form precursor. The waste form precursor is compacted with sufficient pressure to densify the waste precursor and encapsulate the temperature sensitive waste material in a physically densified matrix.

  16. Densified waste form and method for forming

    DOE Patents [OSTI]

    Garino, Terry J.; Nenoff, Tina M.; Sava Gallis, Dorina Florentina

    2016-05-17

    Materials and methods of making densified waste forms for temperature sensitive waste material, such as nuclear waste, formed with low temperature processing using metallic powder that forms the matrix that encapsulates the temperature sensitive waste material. The densified waste form includes a temperature sensitive waste material in a physically densified matrix, the matrix is a compacted metallic powder. The method for forming the densified waste form includes mixing a metallic powder and a temperature sensitive waste material to form a waste form precursor. The waste form precursor is compacted with sufficient pressure to densify the waste precursor and encapsulate the temperature sensitive waste material in a physically densified matrix.

  17. China National Machinery Industry Complete Engineering Corporation...

    Open Energy Info (EERE)

    Industry Complete Engineering Corporation CMCEC Jump to: navigation, search Name: China National Machinery Industry Complete Engineering Corporation (CMCEC) Place: Beijing,...

  18. Subsea completion technology needs advances

    SciTech Connect (OSTI)

    Ledbetter, R.

    1995-09-18

    Subsea technology needs further advances to reduce operational costs before operators will expand the use of subsea well completions in the Gulf of Mexico. They will continue to choose surface completion-oriented systems as long as these are more economical operationally than subsea system. Designs of subsea equipment such as trees, connectors, control pods, umbilicals, and flow lines, must bring about reductions in the cost of both installation and workover compatibility. Remote operated vehicle (ROV) manipulation is one avenue that should be exploited. The bottom line is that significant cooperation between equipment manufacturers and ROV companies is needed to develop advanced ROV technology, and operators should be involved to help guide operational strategies.

  19. Complete liquefaction methods and apparatus

    SciTech Connect (OSTI)

    Turner, Terry D.; Wilding, Bruce M.

    2013-10-15

    A method and apparatus are described to provide complete gas utilization in the liquefaction operation from a source of gas without return of natural gas to the source thereof from the process and apparatus. The mass flow rate of gas input into the system and apparatus may be substantially equal to the mass flow rate of liquefied product output from the system, such as for storage or use.

  20. Subsea completions: Subsea continues strong

    SciTech Connect (OSTI)

    Mohr, H.O.

    1996-02-01

    Comparison of 1995 statistics to the previous three years indicates that the trend for applying subsea completions remains steady at about 80 installations per year. Consistent performance at this high level means industry maintains confidence in the technology. As recently as 1990, there was a low of 36 installations--the all-time high, prior to 1993, had been 66 during 1985. Another positive indicator is the number of identified future subsea completions, i.e., those in progress, or site-specific applications under consideration. This statistic also remains steady, with 1,340 at the end of 1995, and 1,341 and 1,315 at year-end 1994 and 1993. As a comparison, in 1989 and 1990, there were 1,083 and 976 identified. Petrobras is the leading user of subsea completions with 248, three times as many as Shell, the second most active operator. The ten tables of data shown list operating companies making the installations, where they are, what type, water depth, manufacturer and other descriptive features. Preceding discussions cover industry trends and development activity influencing the installations.

  1. U.S. Department of Energy Categorical Exclusion Determination Form

    Energy Savers [EERE]

    X - B5.1 Actions to conserve energy Solar PV on The Blue Barn, it is a 26,000 square foot complex that provides year round recreation to residents and non-residents alike. The EECBG grant will fund 16% of the purposed project. Energy Efficiency and Conservation Block Grant Solar Panel Conversion on The Blue Barn Evesham New Jersey Jan 14, 2010 Print Form for Records Submit via E-mail Billie Newland Digitally signed by Billie Newland DN: cn=Billie Newland, o=Energy Enterprise Solutions, ou,

  2. DOE - NNSA/NFO -- Request Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Forms Click the links below to view the form. Complete the form by filling-out the form fields online and clicking the submit button. Click the document title to view or download the Adobe PDF file marked with this icon ( PDF icon ) [ PDF Help ]. Print the file, fill-it out, and submit it to the address listed on the form. Comments/Feedback Ask a Question / Feedback Rate our website Webmaster Feedback Form Request Exhibits and

  3. Sample Forms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Sample Forms U.S. Department of Energy / U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards System Sample Forms The below completed example forms contain "dummy" data for information purposes. For current up to date blank forms please go to the DOE/NRC forms link located on the NMMSS information page. Sample 740s DOE/NRC Form 740M Sample 742s and 742Cs 742 Example 1 Example 1A Example 2 Example 3 Example 3A Example 4 DOE/NRC Form 742 742C Example 1 Example

  4. Ad Building demolition, recycling completed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOEPatents Actively controlled vibration welding system and method Title: Actively controlled vibration welding system and method A vibration welding system includes a controller, welding horn, an active material element, and anvil assembly. The assembly may include an anvil body connected to a back plate and support member. The element, e.g., a piezoelectric stack or shape memory alloy, is positioned with respect to the assembly. The horn vibrates in a desirable first direction to form a

  5. Declaration of Construction Completion and Verification of Readiness to

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Test | Department of Energy Declaration of Construction Completion and Verification of Readiness to Test Declaration of Construction Completion and Verification of Readiness to Test Salt Waste Processing Facility, Project No. 05-D-405 Pam Marks, FPD, DOE-SR March 2, 2016 File Presentation Key Resources PMCDP EVMS PARS IIe FPD Resource Center PM Newsletter Forms and Templates More Documents & Publications Salt Waste Processing Facility, Construction Turnover to Testing and Commissioning

  6. Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Forms Forms Computer Keyboard Keyboard DOE Forms DOE's forms are developed within the Department and approved by the DOE Forms Manager. The forms provided (below) are designed to serve the needs of two (or more) DOE Headquarters or field organizations. (You must have Adobe Acrobat(R) Reader to view and print the below files. Fillable forms are identified by the "fillable" icon, and require the full version of Adobe Acrobat software.) Forms by Subject Forms by Number Management &

  7. First Name Last Name EMPLOYEE INFORMATION FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    can withhold the correct federal income tax from your pay. Consider completing a new Form W-4 each year and when your personal or financial situation changes. Head of...

  8. Paperwork Reduction Act Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Paperwork Reduction Act Forms Paperwork Reduction Act Forms You may need to fill out one or several of these forms depending on the nature of your survey or usability project. See the Paperwork Reduction Act Web page for more information about the process. Contact the Web Usability Coordinator if you have questions about which forms to complete. File Paperwork Reduction Act Submission: OMB 83-I File Paperwork Reduction Act Supporting Statement Microsoft Office document icon 30-Day Federal

  9. Completed Sites Listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cleanup Sites » Completed Sites » Completed Sites Listing Completed Sites Listing As of fiscal year 2012, EM (and its predecessor organization UMTRA) completed cleanup and closed 91 sites in 24 states. PDF icon Completed Sites Listing More Documents & Publications EM's Cleanup Mission: 16 Sites in 11 States Remaining EA-1406: Final Environmental Assessment Electronic Docket Room (e-Docket Room) Active Sites Active Sites Additional Information Completed Sites

  10. Complete Streets Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Complete Streets Resources Complete Streets Resources While transportation efficiency policies are often implemented under local governments, national and state programs can play...

  11. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  12. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  13. Construction completed, PPPL is set to resume world-class fusion...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    leadership in the quest for fusion systems that can form the basis of commercial fusion power. "This achievement signifies the completion of an extremely successful challenge, ...

  14. Science Brief Submission Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science Brief Submission Form Science Brief Submission Form Print Tuesday, 01 May 2007 00:00 Loading... < Prev

  15. C:\Forms\HQ F 1410.8.cdr

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Notification of Incoming Mail Receipt for Incoming Personal Mail Sender Name: Date Processed: Processed by: (Signature and Date of Person Picking up Mail) Employee Name: Routing Symbol: Room Number: Date Received: HQ F 1410.8 (8-84) HQ F 1410.8 (8-84) Date Contacted: MESSAGE To Sender: Mail must be picked up by: or item will be returned to sender. Part 1 Part 2

  16. Appendix J: Peer reviewer project/program evaluation form

    SciTech Connect (OSTI)

    None, None

    2009-01-18

    This is a sample PEER Review Evaluation Form to be completed by reviewers after presentations and before leaving the review site.

  17. Supplier Information Form Date: New Revision

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supplier Information Form Date: New Revision Interested suppliers may complete and submit a Supplier Information Form to be included into LANS' vendor database. Suppliers are advised that there is no guarantee any solicitations or awards will be sent to Supplier by submitting a Supplier Information Form; however, in the event a solicitation is sent to the Supplier from an LANS Procurement Official, then a more formal quotation/offer may be required. Legal Business Name: D/B/A: (if applicable)

  18. Microsoft Word - JLFTourForm.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jupiter Laser Facility Tour Request Form Host Name/Organization Extension Pager Administrative Support Email Extension Name of Group or Affiliation Tour Date Tour Time Number of Guests Tour Guide Special Needs Purpose of JLF Tour Name (one name per box) Company/Affiliation Country of Citizenship Signature Email completed form to JLF Administrator, Beth Mariotti at mariotti2@llnl.gov or fax to 925-422-6907. Approved by: Approved Date Approval Signature Submit Form to JLF Administrator

  19. Form OE-417

    U.S. Energy Information Administration (EIA) Indexed Site

    Electricity Delivery and Energy Reliability Form OE-417 ELECTRIC EMERGENCY INCIDENT AND DISTURBANCE REPORT Form Approved OMB No. 1901-0288 Approval Expires 03312018 Burden Per...

  20. Page 8, Benefit Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benefits Registration Form - 853 Kb - Allows an employee to enroll or waive health insurance coverage. SF-2817 - Life Insurance Election Form (Federal Employee Group Life...

  1. Successful horizontal completions require an integrated approach

    SciTech Connect (OSTI)

    Richard, B.; Smejkal, K.; Penberthy, W. Jr.

    1997-01-01

    While a perfect well completion may not exist, depleting a hydrocarbon resource at a sustained high rate--without a workover--is the ultimate goal. Unfortunately, many horizontal well completions fail to achieve this due to wellbore damage or loss of reservoir pressure. These conditions manifest themselves in reduced production rates, extended well life and reduced profitability. Standard completion techniques are not always compatible with each other for site specific well applications. The combination of two incompatible technologies or slight changes in a completion procedure may negatively impact productivity. Hence, the most successful horizontal completion results are obtained using a compatible integrated system approach--an approach that carefully combines the best completion tools and processes to deliver an undamaged well completed at the lowest possible cost. After studying the compatibilities of various drill-in fluids, screens, filter cakes and gravel packs, recommended procedures are presented for successfully completing horizontal wells.

  2. Fire Protection System Account Request Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    System Account Request Form Fire Protection System Account Request Form December 2, 2010 ... To obtain a user id and password to access the Fire Protection system, please complete the ...

  3. Form:SampleForm | Open Energy Information

    Open Energy Info (EERE)

    SampleForm Jump to: navigation, search Input the name of a Test Page below. If the resource already exists, you will be able to edit its information. AddEdit a Test Page The text...

  4. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  5. Guidance to Completing the Self-Directed RBSM Interview Form | Department

    Energy Savers [EERE]

    Procedures for Reporting of Obligated Funds for the Energy Efficiency Conservation Block Grant (EECBG) Program | Department of Energy on the Required Period for Grantees to Obligate Funds and the Procedures for Reporting of Obligated Funds for the Energy Efficiency Conservation Block Grant (EECBG) Program Guidance on the Required Period for Grantees to Obligate Funds and the Procedures for Reporting of Obligated Funds for the Energy Efficiency Conservation Block Grant (EECBG) Program This

  6. Forms | Department of Energy

    Energy Savers [EERE]

    Forming the Future Forming the Future This feature article from the April 2014 edition of the Fabricating and Forming Journal (FFJournal) describes how Ford Motor Co.'s sheet metal freeforming technology accelerates prototyping, taking stamping tool costs and lead time out of the equation. Reprinted with permission of FFJournal PDF icon Forming the Future, FFJournal (April 2014) More Documents & Publications RAPID FREEFORM SHEET METAL FORMING: TECHNOLOGY DEVELOPMENT AND SYSTEM VERIFICATION

  7. Subsea completions set for growth, standardization

    SciTech Connect (OSTI)

    Baugh, B.F.

    1988-08-22

    There have been enough subsea completion systems installed to permit categorization of some basic combinations and to permit users to choose from alternative styles. Nevertheless, advances in engineering standards, increasing capabilities, and a growing market will continue to make this an exciting area during the next 10 to 20 years. Fundamentally, subsea completion systems provide the same capabilities as surface completion and injection wells. However, they are of course more complex to accommodate special needs associated with subsea and remote operations. As of the end of 1987, there had been 472 subsea completions installed. A total of 671 future subsea completions have been identified. These completions have been characterized by differences in styles, applications, manufacturer designs, and user preferences. Subsea completions are characterized by many alternatives for construction and operation. As a result, they cannot be simply categorized by as few styles. Identifying these basic combinations gives the reader the capability to envision the alternatives which might suit his or her particular needs.

  8. Direct memory access transfer completion notification

    DOE Patents [OSTI]

    Archer, Charles J. , Blocksome; Michael A. , Parker; Jeffrey J.

    2011-02-15

    Methods, systems, and products are disclosed for DMA transfer completion notification that include: inserting, by an origin DMA on an origin node in an origin injection FIFO, a data descriptor for an application message; inserting, by the origin DMA, a reflection descriptor in the origin injection FIFO, the reflection descriptor specifying a remote get operation for injecting a completion notification descriptor in a reflection injection FIFO on a reflection node; transferring, by the origin DMA to a target node, the message in dependence upon the data descriptor; in response to completing the message transfer, transferring, by the origin DMA to the reflection node, the completion notification descriptor in dependence upon the reflection descriptor; receiving, by the origin DMA from the reflection node, a completion packet; and notifying, by the origin DMA in response to receiving the completion packet, the origin node's processing core that the message transfer is complete.

  9. Direct memory access transfer completion notification

    DOE Patents [OSTI]

    Archer, Charles J.; Blocksome, Michael A.; Parker, Jeffrey J.

    2011-02-15

    DMA transfer completion notification includes: inserting, by an origin DMA engine on an origin node in an injection first-in-first-out (`FIFO`) buffer, a data descriptor for an application message to be transferred to a target node on behalf of an application on the origin node; inserting, by the origin DMA engine, a completion notification descriptor in the injection FIFO buffer after the data descriptor for the message, the completion notification descriptor specifying a packet header for a completion notification packet; transferring, by the origin DMA engine to the target node, the message in dependence upon the data descriptor; sending, by the origin DMA engine, the completion notification packet to a local reception FIFO buffer using a local memory FIFO transfer operation; and notifying, by the origin DMA engine, the application that transfer of the message is complete in response to receiving the completion notification packet in the local reception FIFO buffer.

  10. DOCUMENT RELEASE FORM G5

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOCUMENT RELEASE FORM G5 (1) Document Number: RPP-RPT-431 69 (2) Revision Number: 0 (3) Effective Date: 9/30/2009 (4) Document Type: E] Digital Image l Hard copy (a) Number of pages (including the IDRF) or 125 E PDF ElVideo number of digital images (5) Release Type Z New 0 Cancel El Page Change l complete Revision (6) Document Title: 2009 Auto-TCR for Tank 241 -T-1 11 (7) Change/Release Initial Issuance Description: (8) Change Initial Issuance Justification: (9) Associated (a) Structure

  11. Energy Smart Grocer Program- FY2016 Close-Out Form Customer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Grocer Program- FY2016 Close-Out Form Customer Authorized Representative Name Contact Person Phone If this is a revision, please fully complete the form with the changed...

  12. Direct memory access transfer completion notification

    DOE Patents [OSTI]

    Archer, Charles J.; Blocksome, Michael A.; Parker, Jeffrey J.

    2010-08-17

    Methods, apparatus, and products are disclosed for DMA transfer completion notification that include: inserting, by an origin DMA engine on an origin compute node in an injection FIFO buffer, a data descriptor for an application message to be transferred to a target compute node on behalf of an application on the origin compute node; inserting, by the origin DMA engine, a completion notification descriptor in the injection FIFO buffer after the data descriptor for the message, the completion notification descriptor specifying an address of a completion notification field in application storage for the application; transferring, by the origin DMA engine to the target compute node, the message in dependence upon the data descriptor; and notifying, by the origin DMA engine, the application that the transfer of the message is complete, including performing a local direct put operation to store predesignated notification data at the address of the completion notification field.

  13. Form OE-417

    U.S. Energy Information Administration (EIA) Indexed Site

    | U.S. Department of Energy Electricity Delivery and Energy Reliability Form OE-417|ELECTRIC EMERGENCY INCIDENT AND DISTURBANCE REPORT|Form Approved OMB No. 1901-0288 Approval...

  14. FOIA Request Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOEID Home > FOIA > FOIA Request Form U.S. Department of Energy Idaho (DOE-ID) Operations Office Electronic FOIA Request Form* To make an Electronic FOIA (E-FOIA) request, please...

  15. 2015 Electricity Form Proposals

    Gasoline and Diesel Fuel Update (EIA)

    (Photovoltaic) Survey Forms November 19, 2015 In early 2016 the U.S. Energy Information ... Details will be provided closer to that date. Proposed changes as of December 2015 Forms ...

  16. Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Forms Forms Engraving To request engraving services submit form DOE F 4250.2 (pdf), Requisition for Supplies Equipment, or Service. Go to Engraving information web page. Staffed Copy Center - Graphics - Photography - Printing To request various services and products from the Printing, Graphics and Photography offices, submit form HQ F 1420.7 (pdf), Request for Print Media Services. Go to Staffed Copy Center web page. Go to Graphics web page. Go to Photography web page. Go to Printing web page.

  17. Hanford Site Cleanup Completion Framework - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Documents Hanford Site Cleanup Completion Framework Documents Documents Hanford Site Cleanup Completion Framework Tri-Party Agreement Freedom of Information and Privacy Act Hanford Site Budget Hanford Site Safety Standards DOE - ORP Contracts/Procurements DOE - RL Contracts/Procurements Integrated Waste Feed Delivery Plan Single-Shell Tank Evaluations Deep Vadose Zone 100-F RI/FS Sitewide Probabilistic Seismic Hazard Analysis Environmental Hanford Site Cleanup Completion Framework Email Email

  18. Method for forming ammonia

    SciTech Connect (OSTI)

    Kong; Peter C.; Pink, Robert J.; Zuck, Larry D.

    2008-08-19

    A method for forming ammonia is disclosed and which includes the steps of forming a plasma; providing a source of metal particles, and supplying the metal particles to the plasma to form metal nitride particles; and providing a substance, and reacting the metal nitride particles with the substance to produce ammonia, and an oxide byproduct.

  19. JOBAID-LAUNCHING AND COMPLETING ASSIGNED SURVEY

    Broader source: Energy.gov [DOE]

    The purpose of this job aid is to guide users through the step-by-step process of launching and completing assigned surverys.

  20.  Westinghouse Completes its AP1000...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Westinghouse Completes its AP1000 Test Stand VERA-CS Coupled Multi-physics ... HPC in the Nuclear Power Industry TVA Test Stand Launched November 2013 Volume 1, ...

  1. Geothermal Well Completion Tests | Open Energy Information

    Open Energy Info (EERE)

    and immediately after drilling activities are completed. Author Hagen Hole Conference Petroleum Engineering Summer School; Dubrovnik, Croatia; 20080609 Published NA, 2008 DOI...

  2. Lab completes first Recovery Act cleanup project

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    waste landfill. "The Recovery Act has been a huge boost to our overall cleanup efforts," said Michael Graham, LANL's associate director of environmental programs. "Completing...

  3. Environmental Remediation program completes legacy mercury cleanup...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stories Legacy slope-side cleanup Environmental Remediation program completes legacy mercury cleanup near Smith's Marketplace Los Alamos National Laboratory performed a ...

  4. Completion practices in deep sour Tuscaloosa wells

    SciTech Connect (OSTI)

    Huntoon, G.G.

    1984-01-01

    Successful development of the Tuscaloosa trend in Louisiana has required unique completion practices to produce the trend's deep sour formations. Amoco's operations in the Tuscaloosa formation are between 16,000 and 21,000 ft (4877 and 6400 m), and a range of pressure environments, high temperatures, and corrosive elements is encountered. Application of proved completion practices and equipment has resulted in several techniques that enhance the safety, longevity, and production capacity of these wells. The design of deep Tuscaloosa completions is assisted by a series of correlations developed to project bottomhole and surface shut-in tubing pressures, temperature gradients, and flow capacities for deep sour wells. This paper discusses material selection, completion practices, completion fluids, wellhead equipment, packer designs, corrosion-inhibition systems, and safety and monitoring equipment used in the Tuscaloosa trend. The design of a wellhead surface installation used to detect equipment failure, to pump kill fluids, and to circulate corrosion inhibitors is reviewed. A case study illustrates the methods used in completing a Tuscaloosa well with surface pressures exceeding 16,000 psi (110.3 MPa). Deep high-pressure sour-gas wells can be completed safely if all the elements of the environment that will affect the mechanical integrity of the wellbore are considered in the completion designs. The development of higher-strength material capable of withstanding SSC is needed if wells are completed in formations deeper than 22,000 ft (6700 m). Further research is necessary on the use of alloy steels and nonferrous metals for sour service. Effective high-temperature corrosion inhibitors for heavy zinc bromide completion fluids must be developed before these brines can be used in the Tuscaloosa. The testing of new inhibitors for use in highpressure sour-gas completions should be continued.

  5. Methods of forming steel

    DOE Patents [OSTI]

    Branagan, Daniel J.; Burch, Joseph V.

    2001-01-01

    In one aspect, the invention encompasses a method of forming a steel. A metallic glass is formed and at least a portion of the glass is converted to a crystalline steel material having a nanocrystalline scale grain size. In another aspect, the invention encompasses another method of forming a steel. A molten alloy is formed and cooled the alloy at a rate which forms a metallic glass. The metallic glass is devitrified to convert the glass to a crystalline steel material having a nanocrystalline scale grain size. In yet another aspect, the invention encompasses another method of forming a steel. A first metallic glass steel substrate is provided, and a molten alloy is formed over the first metallic glass steel substrate to heat and devitrify at least some of the underlying metallic glass of the substrate.

  6. Completion processing for data communications instructions

    DOE Patents [OSTI]

    Blocksome, Michael A.; Kumar, Sameer; Parker, Jeffrey J.

    2014-07-01

    Completion processing of data communications instructions in a distributed computing environment with computers coupled for data communications through communications adapters and an active messaging interface (`AMI`), injecting for data communications instructions into slots in an injection FIFO buffer a transfer descriptor, at least some of the instructions specifying callback functions; injecting a completion descriptor for each instruction that specifies a callback function into an injection FIFO buffer slot having a corresponding slot in a pending callback list; listing in the pending callback list callback functions specified by data communications instructions; processing each descriptor in the injection FIFO buffer, setting a bit in a completion bit mask corresponding to the slot in the FIFO where the completion descriptor was injected; and calling by the AMI any callback functions in the pending callback list as indicated by set bits in the completion bit mask.

  7. L.45 EXHIBIT E PAST PERFORMANCE REFERENCE INFORMATION FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    L.45 EXHIBIT E PAST PERFORMANCE REFERENCE INFORMATION FORM 1. Complete name of Government agency, commercial firm, or other organization 2. Complete address 3. Contract number or other reference and type 4. Date of contract 5. Date work commenced 6. Date work was completed or scheduled to be completed 7. Contract Type and Contract Value 8. Final amount invoiced or amount invoiced to date 9a. Technical point of contact (name, title, company/agency, address, telephone number, fax number, and

  8. SGP Shipment Notification Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PlainsShipment Notification Form SGP Related Links Virtual Tour Facilities and Instruments Central Facility Boundary Facility Extended Facility Intermediate Facility Radiometric...

  9. Research Input Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HighlightsSubmit Form Submit a New Research Highlight Sort Highlights Submitter Title Research Area Working Group Submission Date DOE Progress Reports Notable Research Findings for...

  10. User Financial Account Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22013 User Financial Account Form Establish a user financial account at SLAC to procure gases, chemicals, supplies or services to support your experiment at SLAC's user ...

  11. Coach Compliance Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Coach Compliance Form My team is participating in theNational Renewable Energy Laboratory's Lithium-Ion Battery Car Competition. I have reviewed the following documents with the...

  12. 2013 Electricity Form Proposals

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form EIA-861, "Annual Electric Power Industry Report" The EIA-861 survey has historically collected retail sales, revenue, and a variety of information related to demand response ...

  13. Procurement Forms | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proposal Form National Environmental Policy Act (NEPA) Checklist NEPA Checklist - Instruction and Preparation NREL Request for ACH Banking Information NREL Request for...

  14. Method of forming nanodielectrics

    DOE Patents [OSTI]

    Tuncer, Enis [Knoxville, TN; Polyzos, Georgios [Oak Ridge, TN

    2014-01-07

    A method of making a nanoparticle filled dielectric material. The method includes mixing nanoparticle precursors with a polymer material and reacting the nanoparticle mixed with the polymer material to form nanoparticles dispersed within the polymer material to form a dielectric composite.

  15. Method for forming materials

    DOE Patents [OSTI]

    Tolle, Charles R.; Clark, Denis E.; Smartt, Herschel B.; Miller, Karen S.

    2009-10-06

    A material-forming tool and a method for forming a material are described including a shank portion; a shoulder portion that releasably engages the shank portion; a pin that releasably engages the shoulder portion, wherein the pin defines a passageway; and a source of a material coupled in material flowing relation relative to the pin and wherein the material-forming tool is utilized in methodology that includes providing a first material; providing a second material, and placing the second material into contact with the first material; and locally plastically deforming the first material with the material-forming tool so as mix the first material and second material together to form a resulting material having characteristics different from the respective first and second materials.

  16. EM's Paducah Site Completes Building Removals | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EM's Paducah Site Completes Building Removals EM's Paducah Site Completes Building Removals Addthis

  17. Property:CompletionNotes | Open Energy Information

    Open Energy Info (EERE)

    eset-345kv-transmission-line-project-north B BLM-NV-WN-ES-08-01-1310, NV-020-08-01 + 82: Data reviewed for completion Barren Ridge Renewable Transmission + LADWP Project Website:...

  18. Environmental Management Completed Projects 2005-Present

    Broader source: Energy.gov [DOE]

    This document provides the list of completed EM cleanup projects from various sites across the country from 2005 to present, along with the each project’s performance related to cost, schedule, and...

  19. Definition of Environmental Management (EM) Completion

    Broader source: Energy.gov [DOE]

    The purpose of this memorandum is to provide you with additional clarification on: 1) the specific activities that must be accomplished before an environmental cleanup project is complete; and 2)...

  20. SSRL/LCLS User Account Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    REVISED 08/13/12 CJK SSRL/LCLS User Account Form To open or renew an account, complete and submit this form along with an original Purchase Order (PO) from your institution. The PO should be made to SLAC National Accelerator Laboratory for the amount of estimated expenditures (the suggested minimum is $1,000). Send this form with the Purchase Order to: Jackie Kerlegan SLAC National Accelerator Laboratory User Research Administration, MS 99 2575 Sand Hill Rd. Menlo Park, CA 94025 FAX:

  1. JLab Completes 100th Experiment | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Completes 100th Experiment JLab Completes 100th Experiment The experiment, titled "Quark Propagation through Cold QCD Matter," began its run in December 2003 and wrapped up in early March. It probed Quantum Chromodynamics (QCD), a fundamental theory of particle physics that describes the interactions of quarks and gluons - the basic building blocks of matter. A property of QCD, called confinement, states that no quark can ever be found alone. Instead, quarks combine in pairs or

  2. LANL completes CRADA with Biomagnetics, Inc.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CRADA with Biomagnetics, Inc. completed LANL completes CRADA with Biomagnetics, Inc. The CRADA was created to continue work on developing a commercial product that could detect a specific biomarker in urine that could aid in the diagnosis of tuberculosis infection. September 23, 2011 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable

  3. Lab completes Recovery Act-funded demolition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Recovery Act-funded demolition completed Lab completes Recovery Act-funded demolition The building was the largest of the 24 demolished at LANL's historic Technical Area 21. January 19, 2011 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new materials. Los Alamos National Laboratory sits on top of

  4. First trillion particle cosmological simulation completed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First trillion particle cosmological simulation completed First trillion particle cosmological simulation completed A team of astrophysicists and computer scientists has created high-resolution cyber images of our cosmos. January 8, 2015 Simulation of the cosmic web of the dark matter mass distribution. This region represents about 1/10,000 of the total simulation volume. Simulation of the cosmic web of the dark matter mass distribution. This region represents about 1/10,000 of the total

  5. Lab completes record year for environmental cleanup

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Record year for environmental cleanup Lab completes record year for environmental cleanup Personnel conducted more field investigations and cleanup campaigns than ever and completed a record number of Lab shipments to WIPP. December 16, 2010 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new

  6. Subsea completion data show steady activity levels

    SciTech Connect (OSTI)

    Mohr, H.O. )

    1993-02-01

    Review of subsea completion statistics indicates 45 installations during 1992 - one more than during 1991. The 45 installations are still considerably less than the all-time high of 66 installations in 1985. Petrobras continues to install three times as many subsea completions as Shell, the next most active user. However, as in the past three years, the overall-lower number of installations last year was due to reduced applications by Petrobras. During 1991, that company installed 10 subsea completions, whereas during 1988, for example, it completed 37 installations. It should be noted that reduced activity by petrobras reflects problems with financing and general activity, rather than a lack of confidence in subsea completions. The number of future subsea completions identified for installation during the next 10 years is 1,144 - some 10% more than the 1,014 identified at the end of 1991. The present planned installation figure is an all-time high; the next highest number of installations identified was 1,083 at the end of 1989. These and other statistics are presented in 10 tables. A brief analysis of each is included.

  7. Image forming apparatus

    DOE Patents [OSTI]

    Satoh, Hisao (Hachioji, JP); Haneda, Satoshi (Hachioji, JP); Ikeda, Tadayoshi (Hachioji, JP); Morita, Shizuo (Hachioji, JP); Fukuchi, Masakazu (Hachioji, JP)

    1996-01-01

    In an image forming apparatus having a detachable process cartridge in which an image carrier on which an electrostatic latent image is formed, and a developing unit which develops the electrostatic latent image so that a toner image can be formed, both integrally formed into one unit. There is provided a developer container including a discharge section which can be inserted into a supply opening of the developing unit, and a container in which a predetermined amount of developer is contained, wherein the developer container is provided to the toner supply opening of the developing unit and the developer is supplied into the developing unit housing when a toner stirring screw of the developing unit is rotated.

  8. Compute Reservation Request Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Compute Reservation Request Form Compute Reservation Request Form Users can request a scheduled reservation of machine resources if their jobs have special needs that cannot be accommodated through the regular batch system. A reservation brings some portion of the machine to a specific user or project for an agreed upon duration. Typically this is used for interactive debugging at scale or real time processing linked to some experiment or event. It is not intended to be used to guarantee fast

  9. Snorre subsea completions advance TFL technology

    SciTech Connect (OSTI)

    Gunnarsson, B.; Tonnessen, S.H. )

    1992-12-01

    Well-service operations on subsea completions at Saga Petroleum's Snorre field performed by TFL (through-flowline) methods. These operations will be carried out by an innovative system that advances the state-of-the-art for TFL technology. The initial field development phase for Snorre includes 10 subsea wells mounted no a large template known as the Subsea Production System, or SPS. The 2 [times] 10 well slot arrangement on the SPS allows additional wells to be drilled as needed to replace the original ten. The template is located 6,500 m (21,320 ft) from the Snorre TLP and is connected to it by two 8-in. production lines, one 8-in. water injection line and two 3-in.-ID TFL service lines. The wells will be completed with dual 3 1/2-in. Tubing strings for TFL service operations. This article will overview the Snorre TFL system and discuss completion design.

  10. Subsea completions: A record year in '93

    SciTech Connect (OSTI)

    Mohr, H.O. )

    1994-02-01

    Review of subsea completion statistics for 1993 shows 78 installations--an 18% increase over the previous all-time high of 66 installations during 1985. Risking some dramatics, the 78 installations during '93 represent a 73% increase over the 45 installations during '92. And enthusiasm and positive outlook for continued application of subsea completions is clearly indicated in all major areas of the offshore world. Data suggest that the activity should continue to rise strongly toward the year 2000. At the end of 1993, the number of future subsea completions identified for installation during the next 10 years is 1,315--up 15% from the 1,144 identified at year-end 1992. The next highest number identified was 1,083 at the end of 1989, supporting a positive trend.

  11. Completion processing for data communications instructions

    DOE Patents [OSTI]

    Blocksome, Michael A; Kumar, Sameer; Parker, Jeffrey J

    2014-05-20

    Completion processing of data communications instructions in a distributed computing environment, including receiving, in an active messaging interface (`AMI`) data communications instructions, at least one instruction specifying a callback function; injecting into an injection FIFO buffer of a data communication adapter, an injection descriptor, each slot in the injection FIFO buffer having a corresponding slot in a pending callback list; listing in the pending callback list any callback function specified by an instruction, incrementing a pending callback counter for each listed callback function; transferring payload data as per each injection descriptor, incrementing a transfer counter upon completion of each transfer; determining from counter values whether the pending callback list presently includes callback functions whose data transfers have been completed; calling by the AMI any such callback functions from the pending callback list, decrementing the pending callback counter for each callback function called.

  12. Interim Ventilation System Tie-in Completed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2016 Interim Ventilation System Tie-in Completed Early this week sub-contractors at the Waste Isolation Pilot Plant (WIPP) completed the "tie in" of the new interim ventilation system (IVS) to the ductwork for the existing underground ventilation system. Following a series of operational tests, the IVS is expected to increase airflow in the WIPP underground by approximately 54,000 cubic feet per minute. The tie-in operation consisted of removal of sections of the existing ductwork

  13. CERAMIC WASTE FORM DATA PACKAGE

    SciTech Connect (OSTI)

    Amoroso, J.; Marra, J.

    2014-06-13

    The purpose of this data package is to provide information about simulated crystalline waste forms that can be used to select an appropriate composition for a Cold Crucible Induction Melter (CCIM) proof of principle demonstration. Melt processing, viscosity, electrical conductivity, and thermal analysis information was collected to assess the ability of two potential candidate ceramic compositions to be processed in the Idaho National Laboratory (INL) CCIM and to guide processing parameters for the CCIM operation. Given uncertainties in the CCIM capabilities to reach certain temperatures throughout the system, one waste form designated 'Fe-MP' was designed towards enabling processing and another, designated 'CAF-5%TM-MP' was designed towards optimized microstructure. Melt processing studies confirmed both compositions could be poured from a crucible at 1600{degrees}C although the CAF-5%TM-MP composition froze before pouring was complete due to rapid crystallization (upon cooling). X-ray diffraction measurements confirmed the crystalline nature and phase assemblages of the compositions. The kinetics of melting and crystallization appeared to vary significantly between the compositions. Impedance spectroscopy results indicated the electrical conductivity is acceptable with respect to processing in the CCIM. The success of processing either ceramic composition will depend on the thermal profiles throughout the CCIM. In particular, the working temperature of the pour spout relative to the bulk melter which can approach 1700{degrees}C. The Fe-MP composition is recommended to demonstrate proof of principle for crystalline simulated waste forms considering the current configuration of INL's CCIM. If proposed modifications to the CCIM can maintain a nominal temperature of 1600{degrees}C throughout the melter, drain, and pour spout, then the CAF-5%TM-MP composition should be considered for a proof of principle demonstration.

  14. Realtime Queue Request Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Realtime Queue Request Form Realtime Queue Request Form Cori now support a realtime queue. Users can request a small number of on-demand nodes if their jobs have special needs that cannot be accommodated through the regular batch system. The real-time queue enables immediate access to a set of nodes, for jobs that are under the realtime wallclock limit (currently 6 hours). Typically this is used for real time processing linked to some experiment or event. It is not intended to be used to

  15. ARM - VAP Suggestion Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Suggestion Form Showcase Data ARM Best Estimate Data Products (ARMBE) This is a collection of data products that represents "best estimates" derived from several instruments and/or VAPs. We are interested in your feedback; please contact us. VAP Update Information on new, existing, and future value-added products for July l-September 30, 2015 is now available. Have a VAP idea? Use this form to let us know. Datastream Status Further details on the status of VAPs being processed or

  16. STIMULATION TECHNOLOGIES FOR DEEP WELL COMPLETIONS

    SciTech Connect (OSTI)

    Stephen Wolhart

    2003-06-01

    The Department of Energy (DOE) is sponsoring a Deep Trek Program targeted at improving the economics of drilling and completing deep gas wells. Under the DOE program, Pinnacle Technologies is conducting a project to evaluate the stimulation of deep wells. The objective of the project is to assess U.S. deep well drilling & stimulation activity, review rock mechanics & fracture growth in deep, high pressure/temperature wells and evaluate stimulation technology in several key deep plays. Phase 1 was recently completed and consisted of assessing deep gas well drilling activity (1995-2007) and an industry survey on deep gas well stimulation practices by region. Of the 29,000 oil, gas and dry holes drilled in 2002, about 300 were drilled in the deep well; 25% were dry, 50% were high temperature/high pressure completions and 25% were simply deep completions. South Texas has about 30% of these wells, Oklahoma 20%, Gulf of Mexico Shelf 15% and the Gulf Coast about 15%. The Rockies represent only 2% of deep drilling. Of the 60 operators who drill deep and HTHP wells, the top 20 drill almost 80% of the wells. Six operators drill half the U.S. deep wells. Deep drilling peaked at 425 wells in 1998 and fell to 250 in 1999. Drilling is expected to rise through 2004 after which drilling should cycle down as overall drilling declines.

  17. DOE Completes TRU Waste Cleanup at Bettis

    Broader source: Energy.gov [DOE]

    CARLSBAD, N.M.– The U.S. Department of Energy (DOE) has successfully completed cleanup of all Cold War legacy transuranic (TRU) waste at the Bettis Atomic Power Laboratory (BAPL) near Pittsburgh, Pa., permanently disposing of it at the Waste Isolation Pilot Plant (WIPP).

  18. U.S. Geothermal Announces Successful Completion

    Broader source: Energy.gov [DOE]

    U.S. Geothermal Inc. (“U.S. Geothermal”), a renewable energy company focused on the production of electricity from geothermal energy, announced today that the first full size production well (NHS-1) at the Neal Hot Springs Project was successfully completed on May 23 and an initial flow test confirms the presence of a geothermal reservoir.

  19. DOE Completes Five Recovery Act Projects

    Broader source: Energy.gov [DOE]

    DOE's EM program recently completed five projects at the Oak Ridge site funded through the Recovery Act. The projects included the expansion of two landfills at the Oak Ridge Reservation (ORR) and pre-demolition and demolition projects at ETTP and Y-12.

  20. Forms | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forms Forms Computer Keyboard Keyboard DOE Forms DOE's forms are developed within the Department and approved by the DOE Forms Manager. The forms provided (below) are designed to serve the needs of two (or more) DOE Headquarters or field organizations. (You must have Adobe Acrobat(R) Reader to view and print the below files. Fillable forms are identified by the "fillable" icon, and require the full version of Adobe Acrobat software.) Forms by Subject Forms by Number Management &

  1. DOCUMENT RELEASE FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 (2) Revision Number: 0 (3) Effective Date: 9/28/2009 (4) Document Type: [] Digital Image El Hard copy (a) Number of pages (including the DRF) or 74 0PDF E] Video number of digital images (5) Release Type E New El cancel l Page Change El complete Revision (6) Document Title: 2009 Auto-TCR for Tank 241-13-204 (7) Change/Release Initial Issuance Description: (8) Change Initial Issuance Justification: (9) Associated (a) Structure Location: (c) Building Number: Structure, System, and Component N/A

  2. DOCUMENT RELEASE FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6992 (2) Revision Number: 0 1(3) Effective Date: 9.- -, (4) Document Type: [] Digital Image DHard copy (a) Number of pages (including the DIRF) or Z PDF ~ zVideo number of digital images q- (5) Release Type [DNew E71 Cancel 11 Page Change El Complete Revision (6) Document Title: Analysis of Power Delivery to the WTP to Achieve a Minimum of 70MW (76.4MVA) (7) Change/Release Initial Release of Document Description: (8) Change Initial Release of Document Justification: (9) Associated (a) Structure

  3. Form EIA-457E (2001) -- Household Bottled Gas Usage

    U.S. Energy Information Administration (EIA) Indexed Site

    RoperASW is a well respected survey research firm. You will return your completed forms to ... The government may bring a civil action to prohibit reporting violations which may result ...

  4. Inelastic Scattering Form Factors

    Energy Science and Technology Software Center (OSTI)

    1992-01-01

    ATHENA-IV computes form factors for inelastic scattering calculations, using single-particle wave functions that are eigenstates of motion in either a Woods-Saxon potential well or a harmonic oscillator well. Two-body forces of Gauss, Coulomb, Yukawa, and a sum of cut-off Yukawa radial dependences are available.

  5. Apparatus for forming targets

    DOE Patents [OSTI]

    Woerner, Robert L.

    1980-01-01

    Apparatus and method for cryoinduced uniform deposition of cryogenic materials, such as deuterium-tritium (DT) mixtures, on the inner surface of hollow spherical members, such as inertially imploded targets. By vaporizing and quickly refreezing cryogenic materials contained within a hollow spherical member, a uniform layer of the materials is formed on the inner surface of the spherical member. Heating of the cryogenic material, located within a non-isothermal compact freezing cell, is accomplished by an electrical heat pulse, whereafter the material is quickly frozen forming a uniform layer on the inner surface of the spherical member. The method is not restricted to producing a frozen layer on only the inner surface of the innermost hollow member, but where multiple concentric hollow spheres are involved, such as in multiple shell targets for lasers, electron beams, etc., layers of cryogenic material may also be formed on the inner surface of intermediate or outer spherical members, thus providing the capability of forming targets having multiple concentric layers or shells of frozen DT.

  6. Method for forming targets

    DOE Patents [OSTI]

    Woerner, Robert L.

    1979-01-01

    Method for cryoinduced uniform deposition of cryogenic materials, such as deuterium-tritium (DT) mixtures, on the inner surface of hollow spherical members, such as inertially imploded targets. By vaporizing and quickly refreezing cryogenic materials contained within a hollow spherical member, a uniform layer of the materials is formed on the inner surface of the spherical member. Heating of the cryogenic material, located within a non-isothermal compact freezing cell, is accomplished by an electrical heat pulse, whereafter the material is quickly frozen forming a uniform layer on the inner surface of the spherical member. The method is not restricted to producing a frozen layer on only the inner surface of the innermost hollow member, but where multiple concentric hollow spheres are involved, such as in multiple shell targets for lasers, electron beams, etc., layers of cryogenic material may also be formed on the inner surface of intermediate or outer spherical members, thus providing the capability of forming targets having multiple concentric layers or shells of frozen DT.

  7. Formed photovoltaic module busbars

    SciTech Connect (OSTI)

    Rose, Douglas; Daroczi, Shan; Phu, Thomas

    2015-11-10

    A cell connection piece for a photovoltaic module is disclosed herein. The cell connection piece includes an interconnect bus, a plurality of bus tabs unitarily formed with the interconnect bus, and a terminal bus coupled with the interconnect bus. The plurality of bus tabs extend from the interconnect bus. The terminal bus includes a non-linear portion.

  8. Fermilab Today - Subscription Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Subscription Form Subscribe | Contact Us | Archive | Classifieds | Guidelines | Help Search GO Subscribe to Fermilab Today This page has been moved. You will be automatically redirected to the new page below... http://news.fnal.gov/fermilab-at-work/subscribe-to-our-newsletter/ Last modified 12/14/2009 email Fermilab

  9. Financial Assistance Forms and Information For Applicants and Recipients |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Financial Assistance Forms and Information For Applicants and Recipients Financial Assistance Forms and Information For Applicants and Recipients Please check the financial opportunity notice before completing and submitting any of these forms. Award Form Financial Assistance Reporting Checklist and Instructions, DOE F 4600.2 Includes Research Performance Progress Report (RPPR) Award Terms National Policy Assurances to be Incorporated as Award Terms Standard Intellectual

  10. Project Information Form for Usability Projects | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Form for Usability Projects Project Information Form for Usability Projects For user-centered design projects such as a survey or card sort, complete the user-centered design project information form and send it to the Web Governance Team facilitator. File Project Information Form - Usability More Documents & Publications EERE's Usability and Analysis Techniques Guidebook Web Content Analysis and Inventories: Template and FY 2014 Inventory Templates and Examples - Analysis and

  11. Forms & Documents | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forms & Documents Incremental Budget Request Form FY 2015 Field Work Proposal (FWP) LDRD Budget Template Instructions for LDRD Budget Template Capital Equipment Validation Form...

  12. Coiled tubing enables rapid CO{sub 2} completions

    SciTech Connect (OSTI)

    Payton, R.; Baker, R.; Turner, D.; Bertrand, B.

    1996-08-01

    In the Bravo Dome field of northeastern New Mexico, Amoco has doubled their expected carbon dioxide (CO{sub 2}) production and reduced completion costs by 7.5% using coiled tubing in conjunction with other technologies. Amoco initially expected to produce an average 2.6 MMcfd per well. Instead, six months after completing the 31-well package, the company is producing an average 5.1 MMcfd. Important elements contributing cost and time savings on the project were: Log analysis to select perforations and help prevent water production, and lost circulation; the mobility and flexibility of coiled tubing; using cement for low-cost lost circulation control; using thermoplastic film to prevent proppant flowback; fracture designs optimized for each well; and forming an alliance between Amoco and vendors and developing of mutual trust. Amoco and other producing companies use about 95% of the CO{sub 2} produced at Amoco`s Bravo Dome field for enhanced oil recovery (EOR) projects in the Permian Basin area. Amoco sells 5% of the purest product to companies in the US food industry. While the low price of CO{sub 2}, about one-fourth that of methane, furnished part of the impetus for Amoco to implement the cost-cutting methods at Bravo Dome, the methods can be applied in many completion applications and are discussed in this paper.

  13. Geopressured geothermal drilling and completions technology development needs

    SciTech Connect (OSTI)

    Maish, A.B.

    1981-03-01

    Geopressured geothermal formations found in the Texas and Louisiana gulf coast region and elsewhere have the potential to supply large quantities of energy in the form of natural gas and warm brine (200 to 300/sup 0/F). Advances are needed, however, in hardware technology, well design technology, and drilling and completion practices to enable production and testing of exploratory wells and to enable economic production of the resource should further development be warranted. This report identifies needed technology for drilling and completing geopressured geothermal source and reinjection wells to reduce the cost and to accelerate commercial recovery of this resource. A comprehensive prioritized list of tasks to develop necessary technology has been prepared. Tasks listed in this report address a wide range of technology needs including new diagnostic techniques, control technologies, hardware, instrumentation, operational procedure guidelines and further research to define failure modes and control techniques. Tasks are organized into the functional areas of well design, drilling, casing installation, cementing, completions, logging, brine reinjection and workovers.

  14. Complete genome sequences for the anaerobic, extremely thermophilic...

    Office of Scientific and Technical Information (OSTI)

    Complete genome sequences for the anaerobic, extremely thermophilic plant ... Title: Complete genome sequences for the anaerobic, extremely thermophilic plant ...

  15. DVU Featured Training & Events Form

    Energy Savers [EERE]

    Featured Training & Events Form Please complete this form in its entirety and email to AskTheDvu@hq.doe.gov 1. Course Title: 2. Course Start/End Date: 3. Start/End Time (Time zone required): 4. Registration Link: Website Name and URL Link: 5. CHRIS Course Code & Session Number: If Applicable, Enter 6-Digit CHRIS Course Number 4-Digit CHRIS Session Number 6. Cost: 7. Course Type: (Ex: Live Webinar, Classroom, Online) 8. Course Location: Training Facility Address, Room # City & State

  16. Deepwater completion and tieback -- A case study

    SciTech Connect (OSTI)

    Ghiselin, D.

    1996-10-01

    Major operators are engaged in large-scale integrated projects around the world. Does integration favor the big boys, or can a small independent operator benefit from this approach? Independent partners Hardy Oil and Gas USA and Samedan Oil Corp. looked into integrated project management to successfully design and install subsea completions, subsea pipelines, and platform tiebacks and interfaces to two platforms operated by Texaco and Chevron, respectively. The paper describes the project management approach taken and results of the project.

  17. National Rotor Testbed aerodynamic design complete

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    aerodynamic design complete - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs

  18. Floating Oscillating Water Column Reference Model Completed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Floating Oscillating Water Column Reference Model Completed - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense

  19. WIPP Successfully Completes ISO 14001 Certification

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    28, 2015 WIPP Successfully Completes ISO 14001 Certification The WIPP site successfully demonstrated to independent auditors that the WIPP Environmental Management System (EMS) meets all the requirements of the ISO 14001 standard. After a recent three days of reviewing the 17 elements of ISO 14001, the auditors concluded the EMS program and procedures properly manage the environmental aspects and impacts of WIPP operations to meet the standard's requirements. As a result, the certification of

  20. Formed HIP Can Processing

    SciTech Connect (OSTI)

    Clarke, Kester Diederik

    2015-07-27

    The intent of this report is to document a procedure used at LANL for HIP bonding aluminum cladding to U-10Mo fuel foils using a formed HIP can for the Domestic Reactor Conversion program in the NNSA Office of Material, Management and Minimization, and provide some details that may not have been published elsewhere. The HIP process is based on the procedures that have been used to develop the formed HIP can process, including the baseline process developed at Idaho National Laboratory (INL). The HIP bonding cladding process development is summarized in the listed references. Further iterations with Babcock & Wilcox (B&W) to refine the process to meet production and facility requirements is expected.

  1. NEPA Determination Form

    National Nuclear Security Administration (NNSA)

    LA NEPA COMPLIANCE DETERMINATION FORM PRID - 09P-0059 V2 Page 1 of 8 Project/Activity Title: TA-3 Substation Replacement Project PRID: 09P-0059 V2 Date: February 16, 2016 Purpose: The proposed demolition and replacement of the Los Alamos National Laboratory's (LANL) Technical Area (TA)-3 electrical power substation is needed to provide reliable and efficient electrical distribution systems with sufficient electrical capacity to support the national security missions. The electrical distribution

  2. ENVIRONMENTAL NOTIFICATION FORM

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Document(s) responsive to Item 1 TOC-ENV-NOT-2013-0019 Rev. 0 ENVIRONMENTAL NOTIFICATION FORM Date: 02/15/2013 Notification No.: TOC-ENV-NOT- 2013-0019 Name: D.L. Dyekman Revision No. 0 Section 1. Spills NA M ChemicalName: see section 3 below MSDS No.: n/a Regulated per 40 CFR 302: Yes 0 No 13EPCRA EHS: Yes Z No E3 CAS No.: n/ a Quantity Released: up to 300gal/yr Reportable Quantity (RO):_________ CAS No.: ________Quantity Released: ___________Reportable Quantity (RO):__________ CAS No.:

  3. GlassForm

    Energy Science and Technology Software Center (OSTI)

    2011-09-16

    GlassForm is a software tool for generating preliminary waste glass formulas for a given waste stream. The software is useful because it reduces the number of verification melts required to develop a suitable additive composition. The software includes property models that calculate glass properties of interest from the chemical composition of the waste glass. The software includes property models for glass viscosity, electrical conductivity, glass transition temperature, and leach resistance as measured by the 7-daymore » product consistency test (PCT).« less

  4. Forming the Future

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - - - - Automotive BY NICK WRIGHT, EXECUTIVE EDITOR A computer program generates a tool path for the robots based on a CAD design, turning 2 D sheet metal into a 3 D part. A blue grease is applied before the sheet is held into place with De sta co clamps. The grease protects the metal's surface finish during forming. Styluses above and below the sheet manipulate the metal into shape. FFJournal ® April 2014 As seen in the April 2014 issue of ® A bout 10 miles west of down- town Detroit sprawls

  5. One Bacterial Cell, One Complete Genome

    SciTech Connect (OSTI)

    Woyke, Tanja; Tighe, Damon; Mavrommatis, Konstantinos; Clum, Alicia; Copeland, Alex; Schackwitz, Wendy; Lapidus, Alla; Wu, Dongying; McCutcheon, John P.; McDonald, Bradon R.; Moran, Nancy A.; Bristow, James; Cheng, Jan-Fang

    2010-04-26

    While the bulk of the finished microbial genomes sequenced to date are derived from cultured bacterial and archaeal representatives, the vast majority of microorganisms elude current culturing attempts, severely limiting the ability to recover complete or even partial genomes from these environmental species. Single cell genomics is a novel culture-independent approach, which enables access to the genetic material of an individual cell. No single cell genome has to our knowledge been closed and finished to date. Here we report the completed genome from an uncultured single cell of Candidatus Sulcia muelleri DMIN. Digital PCR on single symbiont cells isolated from the bacteriome of the green sharpshooter Draeculacephala minerva bacteriome allowed us to assess that this bacteria is polyploid with genome copies ranging from approximately 200?900 per cell, making it a most suitable target for single cell finishing efforts. For single cell shotgun sequencing, an individual Sulcia cell was isolated and whole genome amplified by multiple displacement amplification (MDA). Sanger-based finishing methods allowed us to close the genome. To verify the correctness of our single cell genome and exclude MDA-derived artifacts, we independently shotgun sequenced and assembled the Sulcia genome from pooled bacteriomes using a metagenomic approach, yielding a nearly identical genome. Four variations we detected appear to be genuine biological differences between the two samples. Comparison of the single cell genome with bacteriome metagenomic sequence data detected two single nucleotide polymorphisms (SNPs), indicating extremely low genetic diversity within a Sulcia population. This study demonstrates the power of single cell genomics to generate a complete, high quality, non-composite reference genome within an environmental sample, which can be used for population genetic analyzes.

  6. Snorre subsea completions advance TFL technology

    SciTech Connect (OSTI)

    Gunnarsson, B.; Tennessen, S.H. )

    1993-01-01

    This paper reports on 1 of this two-part series overviewed downhole through-flowline (TFL) equipment used with an eccentric Y-block configuration to allow circulation through dual 3 1/2-in. Tubing strings. The subsea completions are in wells located on Saga Petroleum's Subsea Production System template, 6,500 m (21,320 ft) from the Snorre field TLP. This concluding presentation describes the systems control center based on the TLP, from which the remote TFL operations will be conducted. How the system was tested and commissioned before installation is discussed. And basic concepts of Saga's plans for a TFL-operated production logging system are illustrated.

  7. completed-storage | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Storage Projects Completed Natural Gas Storage Projects Click on project number for a more detailed description of the project Project Number Project Name Primary Performer DE-DT0000358 Strategic Petroleum Reserve Northrop Grumman Missions System DE-FC26-03NT41813 Geomechanical Analysis and Design Criteria Terralog Technologies DE-FC26-03NT41779 natural-gas-storage Technology Consortium Pennsylvania State University (PSU) DE-FC26-03NT41743 Improved Deliverability in Gas Storage Fields by

  8. JEA successfully completes world's largest CFB demonstration

    SciTech Connect (OSTI)

    2005-09-30

    JEA (formerly the Jacksonville Electric Authority) has successfully completed an eighth year landmark demonstration project that continues in baseload commercial operation. It scales up atmospheric fluidized-bed technology demonstration to the near-300-MW size, providing important data on a technology that can achieve > 90% SO{sub 2} removal and 60% NOx reduction at relatively high efficiencies and at costs comparable to those of conventional pulverized coal plants. The article recounts the history of the project. Performance tests showed a blend of coal and petcoke were most efficient as a feedstock. 3 figs.

  9. Stimulation Technologies for Deep Well Completions

    SciTech Connect (OSTI)

    Stephen Wolhart

    2005-06-30

    The Department of Energy (DOE) is sponsoring the Deep Trek Program targeted at improving the economics of drilling and completing deep gas wells. Under the DOE program, Pinnacle Technologies conducted a study to evaluate the stimulation of deep wells. The objective of the project was to review U.S. deep well drilling and stimulation activity, review rock mechanics and fracture growth in deep, high-pressure/temperature wells and evaluate stimulation technology in several key deep plays. This report documents results from this project.

  10. Diamond Shamrock nears completion of major expansions

    SciTech Connect (OSTI)

    True, W.R.

    1993-05-24

    With completion later this year of a second refined products line into Colorado, Diamond Shamrock Inc., San Antonio, will have added more than 600 miles of product and crude-oil pipeline on its system and expanded charge and production capacities at its two state-of-the-art refineries, all within 30 months. The projects aim at improving the company's ability to serve markets in the U.S. Southwest and increasing capacities and flexibility at its two refineries. The paper describes these projects under the following headings: new products service; another new line; and refineries, crude pipelines; Three Rivers expansion and Supplies for McKee.

  11. Bipolar pulse forming line

    DOE Patents [OSTI]

    Rhodes, Mark A.

    2008-10-21

    A bipolar pulse forming transmission line module for linear induction accelerators having first, second, third, fourth, and fifth planar conductors which form an interleaved stack with dielectric layers between the conductors. Each conductor has a first end, and a second end adjacent an acceleration axis. The first and second planar conductors are connected to each other at the second ends, the fourth and fifth planar conductors are connected to each other at the second ends, and the first and fifth planar conductors are connected to each other at the first ends via a shorting plate adjacent the first ends. The third planar conductor is electrically connectable to a high voltage source, and an internal switch functions to short a high voltage from the first end of the third planar conductor to the first end of the fourth planar conductor to produce a bipolar pulse at the acceleration axis with a zero net time integral. Improved access to the switch is enabled by an aperture through the shorting plate and the proximity of the aperture to the switch.

  12. Nucleon Electromagnetic Form Factors

    SciTech Connect (OSTI)

    Marc Vanderhaeghen; Charles Perdrisat; Vina Punjabi

    2007-10-01

    There has been much activity in the measurement of the elastic electromagnetic proton and neutron form factors in the last decade, and the quality of the data has greatly improved by performing double polarization experiments, in comparison with previous unpolarized data. Here we review the experimental data base in view of the new results for the proton, and neutron, obtained at JLab, MAMI, and MIT-Bates. The rapid evolution of phenomenological models triggered by these high-precision experiments will be discussed, including the recent progress in the determination of the valence quark generalized parton distributions of the nucleon, as well as the steady rate of improvements made in the lattice QCD calculations.

  13. Fermilab | Fermilab at Work | Web Form | Feedback Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Feedback Form Use the form below to submit a suggestion to senior management. Required fields are marked with an asterisk (*). Suggestion: Name: Email Address: Submit Last modified...

  14. Slant hole completion test. Final report

    SciTech Connect (OSTI)

    Mann, R.L.

    1993-07-01

    One of the Department of Energy`s (DOE) Strategies and Objectives in the Natural Gas Program is to conduct activities to transfer technology from R&D programs to potential users. The Slant Hole Completion Test has achieved exactly this objective. The Slant Hole site is essentially the same as the Multiwell site and is located in the southeastern portion of the Piceance Basin near Rifle, Colorado. The Piceance Basin is typical of the Western low permeability basins that contain thick sequences of sands, silts and coals deposited during the Cretaceous period. These sequences contain vast amounts of natural gas but have proven to be resistant to commercial production because of the low permeability of the host rocks. Using the knowledge gained from the DOE`s earlier Multiwell experiment, the SHCT-1 was drilled to demonstrate that by intersecting the natural fractures found in these ``tight rocks,`` commercial gas production can be obtained.

  15. Engineering task plan TWRS technical baseline completion

    SciTech Connect (OSTI)

    Moore, T.L

    1996-03-08

    The Tank Waste Remediation System (TWRS) includes many activities required to remediate the radioactive waste stored in underground waste storage tanks. These activities include routine monitoring of the waste, facilities maintenance, upgrades to existing equipment, and installation of new equipment necessary to manage, retrieve, process, and dispose of the waste. In order to ensure that these multiple activities are integrated, cost effective, and necessary, a sound technical baseline is required from which all activities can be traced and measured. The process by which this technical baseline is developed will consist of the identification of functions, requirements, architecture, and test (FRAT) methodology. This process must be completed for TWRS to a level that provides the technical basis for all facility/system/component maintenance, upgrades, or new equipment installation.

  16. Direct memory access transfer completion notification

    DOE Patents [OSTI]

    Chen, Dong; Giampapa, Mark E.; Heidelberger, Philip; Kumar, Sameer; Parker, Jeffrey J.; Steinmacher-Burow, Burkhard D.; Vranas, Pavlos

    2010-07-27

    Methods, compute nodes, and computer program products are provided for direct memory access (`DMA`) transfer completion notification. Embodiments include determining, by an origin DMA engine on an origin compute node, whether a data descriptor for an application message to be sent to a target compute node is currently in an injection first-in-first-out (`FIFO`) buffer in dependence upon a sequence number previously associated with the data descriptor, the total number of descriptors currently in the injection FIFO buffer, and the current sequence number for the newest data descriptor stored in the injection FIFO buffer; and notifying a processor core on the origin DMA engine that the message has been sent if the data descriptor for the message is not currently in the injection FIFO buffer.

  17. Form 1 | Open Energy Information

    Open Energy Info (EERE)

    Form 1 Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Permit ApplicationPermit Application: Form 1Legal Abstract Form 1: General Information,...

  18. HDOT Forms | Open Energy Information

    Open Energy Info (EERE)

    HDOT Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: HDOT FormsLegal Abstract The State of Hawaii Forms Central webpage...

  19. ER-12-1 completion report

    SciTech Connect (OSTI)

    Russell, C.E.; Gillespie, D.; Cole, J.C.; Drellack, S.L.

    1996-12-01

    The objective of drillhole ER-12-1 was to determine the hydrogeology of paleozoic carbonate rocks and of the Eleana Formation, a regional aquitard, in an area potentially downgradient from underground nuclear testing conducted in nearby Rainier Mesa. This objective was addressed through the drilling of well ER-12-1 at N886,640.26 E640,538.85 Nevada Central Coordinates. Drilling of the 1094 m (3588 ft) well began on July 19, 1991 and was completed on October 17, 1991. Drilling problems included hole deviation and hole instability that prevented the timely completion of this borehole. Drilling methods used include rotary tri-cone and rotary hammer drilling with conventional and reverse circulation using air/water, air/foam (Davis mix), and bentonite mud. Geologic cuttings and geophysical logs were obtained from the well. The rocks penetrated by the ER-12-1 drillhole are a complex assemblage of Silurian, Devonian, and Mississippian sedimentary rocks that are bounded by numerous faults that show substantial stratigraphic offset. The final 7.3 m (24 ft) of this hole penetrated an unusual intrusive rock of Cretaceous age. The geology of this borehole was substantially different from that expected, with the Tongue Wash Fault encountered at a much shallower depth, paleozoic rocks shuffled out of stratigraphic sequence, and the presence of an altered biotite-rich microporphyritic igneous rock at the bottom of the borehole. Conodont CAI analyses and rock pyrolysis analyses indicate that the carbonate rocks in ER-12-1, as well as the intervening sheets of Eleana siltstone, have been thermally overprinted following movement on the faults that separate them. The probable source of heat for this thermal disturbance is the microporphyritic intrusion encountered at the bottom of the hole, and its age establishes that the major fault activity must have occurred prior to 102.3+0.5 Ma (middle Cretaceous).

  20. DOE Headquarters FOIA Request Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operational Management » Freedom of Information Act » DOE Headquarters FOIA Request Form DOE Headquarters FOIA Request Form To make an Electronic FOIA (E-FOIA) request, please provide the information below. Failure to enter accurate and complete information may render your FOIA request impossible to fulfill. * Requests submitted under the Privacy Act must be signed and, therefore, cannot be submitted on this form. Contact information Name * Organization Address * Fax number Phone number Email

  1. NDEP Forms | Open Energy Information

    Open Energy Info (EERE)

    to library Legal Document- OtherOther: NDEP FormsLegal Abstract The Nevada Division of Environmental Protection (NDEP) provides links various forms, including all necessary...

  2. Radiation Safety Work Control Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiation Safety Work Control Form (see instructions on pg-3) Rev. May 2014 Area: Form : Date: Preliminary Applicability Screen: (a) Will closing the beam line injection stoppers...

  3. Form 200 | Open Energy Information

    Open Energy Info (EERE)

    ApplicationPermit Application: Form 200Legal Abstract Form 200: ApplicationReport for Waste Discharge, current through August 14, 2014. Published NA Year Signed or Took Effect...

  4. New Employee Orientation- Forms Checklist

    Broader source: Energy.gov [DOE]

    Listing of the forms to be issued and collected at a new employee's orientation. Please review the checklist to ensure that you bring all of the needed forms.

  5. Complete LNG Terminal Status Maps | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Complete LNG Terminal Status Maps Complete LNG Terminal Status Maps A series of slides showing the status of various LNG terminals (existing, under construction, proposed, etc.) in...

  6. DOE's New Large Blade Test Facility in Massachusetts Completes...

    Office of Environmental Management (EM)

    DOE's New Large Blade Test Facility in Massachusetts Completes First Commercial Blade Tests DOE's New Large Blade Test Facility in Massachusetts Completes First Commercial Blade ...

  7. Category:Completed Case Study | Open Energy Information

    Open Energy Info (EERE)

    Apps Datasets Community Login | Sign Up Search Category Edit History Category:Completed Case Study Jump to: navigation, search List of geothermal areas that have a completed...

  8. Declaration of Construction Completion and Verification of Readiness...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Declaration of Construction Completion and Verification of Readiness to Test Declaration of Construction Completion and Verification of Readiness to Test Salt Waste Processing ...

  9. Los Alamos Demolition Work Progresses Toward Goal of Completing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Los Alamos Demolition Work Progresses Toward Goal of Completing Cleanup Los Alamos Demolition Work Progresses Toward Goal of Completing Cleanup January 14, 2016 - 12:20pm Addthis ...

  10. Completed Projects | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Completed Projects Project Assessment (OPA) OPA Home About Project Management SC Projects Review Dates (updated April 2016) Project Construction Photos Completed Projects Current ...

  11. FEMP Completes 2000th Renewable Energy Optimization Screening...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP Completes 2000th Renewable Energy Optimization Screening FEMP Completes 2000th Renewable Energy Optimization Screening July 23, 2015 - 12:03pm Addthis REopt models the complex ...

  12. Sandia Energy - Unmanned Aircraft Test Flights Completed at Oliktok...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Unmanned Aircraft Test Flights Completed at Oliktok Point Home Climate News News & Events Monitoring Sensing Sensing & Monitoring Unmanned Aircraft Test Flights Completed at...

  13. Sediment Properties: E-Area Completion Project

    SciTech Connect (OSTI)

    Millings, M.; Bagwell, L.; Amidon, M.; Dixon, K.

    2011-04-29

    To accommodate a future need for additional waste disposal facilities at the Savannah River Site, the Solid Waste Management Division (SWMD) designated nine additional plots for development (Kasraii 2007; SRS 2010); these plots are collectively known as the E Area Completion Project (ECP). Subsurface samples were collected from ECP plots 6, 7, 8 and 9 (Figure 1) for chemical and physical property analyses to support Performance Assessment (PA) and Special Analyses (SA) modeling. This document summarizes the sampling and analysis scheme and the resultant data, and provides interpretations of the data particularly in reference to existing soil property data. Analytical data in this document include: gamma log, cone penetrometer log, grain size (sieve and hydrometer), water retention, saturated hydraulic conductivity (falling head permeameter), porosity, dry bulk density, total organic carbon, x-ray diffraction, and x-ray fluorescence data. SRNL provided technical and safety oversight for the fieldwork, which included completion of eight soil borings, four geophysical logs, and the collection of 522 feet of core and 33 Shelby tubes from ECP plots 6, 7, 8, and 9. Boart Longyear provided sonic drilling and logging services. Two soil borings were completed at each location. The first set of boreholes extended into (but did not fully penetrate) the Warley Hill Formation. These boreholes were continuously cored, then geophysically (gamma ray) logged. The recovered core was split, photographed, and described; one half of the core was archived at SRS's Core Lab facilities, and the remaining half was consumed as necessary for testing at SRS and off-site labs. Core descriptions and geophysical data were used to calculate target elevations for Shelby tube samples, which were obtained from the second set of boreholes. Shelby tubes were shipped to MACTEC Engineering and Consulting Inc. (MACTEC) in Atlanta for physical property testing. SRNL deployed their Site Characterization and Analysis Penetrometer System (SCAPS) cone penetrometer test (CPT) truck at ECP plots 6, 7, 8 and 9 to collect inferred lithology data for the vadose zone. Results from this study are used to make recommendations for future modeling efforts involving the ECP plots. The conceptual model of the ECP hydrogeology differs from the conceptual model of the current ELLWF disposal area in that for the ECP plots, the topography (ground surface) is generally lower in elevation; The Upland and top of Tobacco Road lithostratigraphic units are missing (eroded); The water table occurs lower in elevation (i.e., it occurs in lower stratigraphic units); and the Tan Clay Confining Zone (TCCZ) often occurs within the vadose zone (rather than in the saturated zone). Due to the difference in the hydrogeology between the current ELLWF location and the ECP plots, different vadose zone properties are recommended for the ECP plots versus the properties recommended by Phifer et al. (2006) for the current disposal units. Results from this study do not invalidate or conflict with the current PA's use of the Upper and Lower Vadose Zone properties as described by Phifer et al. (2006) for the current ELLWF disposal units. The following modeling recommendations are made for future modeling of the ECP plots where vadose zone properties are required: (1) If a single vadose zone property is preferred, the properties described by Phifer et al. (2006) for the Upper Vadose Zone encompass the general physical properties of the combined sands and clays in the ECP vadose zone sediments despite the differences in hydrostratigraphic units. (2) If a dual zone system is preferred, a combination of the Lower Zone properties and the Clay properties described by Phifer et al. (2006) are appropriate for modeling the physical properties of the ECP vadose zone. The Clay properties would be assigned to the Tan Clay Confining Zone (TCCZ) and any other significant clay layers, while the Lower Zone properties would be assigned for the remainder of the vadose zone. No immediate updates or changes are recommended for

  14. Entiat 4Mile WELLs Completion Report, 2006.

    SciTech Connect (OSTI)

    Malinowksi, Richard

    2007-01-01

    The Entiat 4-mile Wells (Entiat 4-mile) project is located in the Entiat subbasin and will benefit Upper Columbia steelhead, spring Chinook and bull trout. The goal of this project is to prevent juvenile fish from being diverted into an out-of-stream irrigation system and to eliminate impacts due to the annual maintenance of an instream pushup dam. The objectives include eliminating a surface irrigation diversion and replacing it with two wells, which will provide Bonneville Power Administration (BPA) and the Bureau of Reclamation (Reclamation) with a Federal Columbia River Power System (FCRPS) BiOp metric credit of one. Wells were chosen over a new fish screen based on biological benefits and costs. Long-term biological benefits are provided by completely eliminating the surface diversion and the potential for fish entrainment in a fish screen. Construction costs for a new fish screen were estimated at $150,000, which does not include other costs associated with implementing and maintaining a fish screening project. Construction costs for a well were estimated at $20,000 each. The diversion consisted of a pushup dam that diverted water into an off-channel pond. Water was then pumped into a pressurized system for irrigation. There are 3 different irrigators who used water from this surface diversion, and each has multiple water right claims totaling approximately 5 cfs. Current use was estimated at 300 gallons per minute (approximately 0.641 cfs). Some irrigated acreage was taken out of orchard production less than 5 years ago. Therefore, approximately 6.8 acre-feet will be put into the State of Washington Trust Water Right program. No water will be set aside for conservation savings. The construction of the two irrigation wells for three landowners was completed in September 2006. The Lower Well (Tippen/Wick) will produce up to 175 gpm while the Upper Well (Griffith) will produce up to 275 gpm during the irrigation season. The eight inch diameter wells were developed to a depth of 75 feet and 85 feet, respectively, and will be pumped with Submersible Turbine pumps. The irrigation wells have been fitted with new electric boxes and Siemens flowmeters (MAG8000).

  15. Price/Cost Proposal Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Proposal shall be completed and signed by an authorized official for your organization. ... welding, minor fabrication, etc.), raw materials, standard commercial items, ...

  16. STEP Utility Data Release Form

    Broader source: Energy.gov [DOE]

    STEP Utility Data Release Form, from the Tool Kit Framework: Small Town University Energy Program (STEP).

  17. Benefits Forms & Required Notices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benefits Forms & Required Notices Benefits Forms & Required Notices A comprehensive benefits package with plan options for health care and retirement to take care of our employees today and tomorrow. Contacts Benefits Office (505) 667-1806 Email Benefits Forms & Required Notices Forms Benefits Enrollment Form, 1751a (pdf) Declaration of Domestic Partnership, 1925a (pdf) Declaration of Legal Ward as Eligible Dependent, 3028 (pdf) Declaration that Enrolled Dependent Meets IRS

  18. Site Transition Process Upon Cleanup Completion | Department of Energy

    Energy Savers [EERE]

    Process Upon Cleanup Completion Site Transition Process Upon Cleanup Completion Site Transition Process Upon Cleanup Completion PDF icon Site Transition Process Upon Cleanup Completion More Documents & Publications Recommendation 198: Establish a site transition process Recommendation 218: Develop a Fact Sheet on Site Transition at On-going Mission Sites EM SSAB Conference Calls - January 27, 2011

  19. Project Registration Number Assignments (Completed) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Completed) Project Registration Number Assignments (Completed) As of: May 2016 Provides a table of Project Registration Number Assignments (Completed) PDF icon Project Registration Number Assignments (Completed) More Documents & Publications All Active DOE Technical Standards Document Project Registration Number Assignments (Active

  20. SAND_ModelFormUQ.dvi

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    P5.02 Jim Stewart SNL Completed: 6/30/12 CASL-8-2012-0080-000 CASL-U-2012-0080-000 SANDIA REPORT SAND2012-xxxx Unlimited Release Printed June 2012 Propagation of Model Form Uncertainty for Thermal Hydraulics using RANS Turbulence Models in Drekar Michael S. Eldred and Timothy M. Wildey Prepared by Sandia National Laboratories Albuquerque, New Mexico 87185 and Livermore, California 94550 Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a

  1. 309 Facility deactivation and decommisioning Criteria Completion Check Lists

    SciTech Connect (OSTI)

    Cornwell, B.C.

    1996-02-01

    To facilitate and track completion of the 309 Facility turnover criteria completion an Applicability Matrix and Criteria Completion Check Lists were prepared. The applicability matrix documents the required turnover criteria for a given area in the facility or scope of work. The applicable criteria is selected for 16 different areas. For each area a completion checklist is provided to document completion of a requirement by WHC and the Environmental Restoration Contractor.

  2. Report of International Electric Import/Export Data: Form OE-781R

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Instructions | Department of Energy International Electric Import/Export Data: Form OE-781R Instructions Report of International Electric Import/Export Data: Form OE-781R Instructions Instructions for completing Form OE-781-R: Report of International Electrical Export/Import Data. Form OE-781-R has been developed as an optional form to collect information required by the terms and conditions placed in Presidential permits and electricity export authorizations. PDF icon Form OE-781R

  3. Paperclips Etc. Special Order Form

    Broader source: Energy.gov (indexed) [DOE]

    PSS-02.2 (March 7, 2011) Replaces PSS-02.1 PAPERCLIPS Etc. SPECIAL Orders Form This form is used to order supplies that are not readily available in the DOE HQ self-service supply...

  4. SSRL Computer Account Request Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SSRLLCLS Computer Account Request Form August 2009 Fill in this form and sign the security statement mentioned at the bottom of this page to obtain an account. Your Name:...

  5. HHS SMALL BUSINESS REVIEW FORM

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Form 4220.2 (Revised March 14 2013) Office of Small and Disadvantaged Business Utilization DOE F 4220.2 - Small Business Review Form (03142013) OSDBU Control Number: ...

  6. ESA Forms | Open Energy Information

    Open Energy Info (EERE)

    navigation, search OpenEI Reference LibraryAdd to library Web Site: ESA Forms Abstract Fish and Wildlife Service Fish and Wildlife Permit Application Forms Author U.S. Fish and...

  7. CSLB Forms | Open Energy Information

    Open Energy Info (EERE)

    Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: CSLB FormsLegal Abstract The Colorado State Land Board (CSLB) provides various...

  8. ADOT Forms | Open Energy Information

    Open Energy Info (EERE)

    Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: ADOT FormsLegal Abstract The Arizona Department of Transportation provides...

  9. NDSL Forms | Open Energy Information

    Open Energy Info (EERE)

    NDSL Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: NDSL FormsLegal Abstract The Nevada Division of State Lands provides...

  10. CSLC Forms | Open Energy Information

    Open Energy Info (EERE)

    Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: CSLC FormsLegal Abstract The California State Lands Commission (CSLC) provides...

  11. WSDNR Forms | Open Energy Information

    Open Energy Info (EERE)

    Forms Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: WSDNR FormsLegal Abstract The Washington State Department of Natural Resources...

  12. Document Certification and Transmittal Form

    Broader source: Energy.gov [DOE]

    Use this form to submit a NEPA document to the Office of NEPA Policy and Compliance for website posting.

  13. Prioritization Tool Measurement Input Form

    Broader source: Energy.gov [DOE]

    BTO encourages stakeholders to recommend updates and improvements to the Prioritization Tool by using the below Measure Input Form.

  14. Hawaii Well Abandonment Report Form (DLNR Form WAR) | Open Energy...

    Open Energy Info (EERE)

    Notice Form Topic Well Abandonment Report Organization State of Hawaii Commission on Water Resource Management Published Publisher Not Provided, 012008 DOI Not Provided Check...

  15. Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    must exist at the time the request is submitted. Orga nizati Pillsbury Winthrop Shaw Pi on Mailin g 909 Fannin Suite 2000 Addre 55 City Houston Enter description: 1. All...

  16. Forms

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Former Worker Medical Screening Program Former Worker Medical Screening Program The Former Worker Medical Screening Program (FWP) provides ongoing medical screening examinations, at no cost, to all former DOE Federal, contractor, and subcontractor workers who may be at risk for occupational diseases. The FWP is supported by the U.S. Department of Energy's (DOE) Office of Environment, Health, Safety and Security (EHSS) and reflects our commitment to the health and safety of all DOE workers - past

  17. DOE Completes Cleanup at New York, California Sites | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Completes Cleanup at New York, California Sites DOE Completes Cleanup at New York, California Sites July 1, 2011 - 12:00am Addthis WASHINGTON, D.C. - Last month, the U.S....

  18. NNSA Completes B61 Warhead Refurbishment | National Nuclear Security...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo Gallery Jobs Apply for Our Jobs Our Jobs Working at NNSA Blog Home About Us Our History NNSA Timeline NNSA Completes B61 Warhead Refurbishment NNSA Completes B61...

  19. EM Completes Project to Maintain Water Quality of Spent Nuclear...

    Energy Savers [EERE]

    Completes Project to Maintain Water Quality of Spent Nuclear Fuel Basin at Idaho Site EM Completes Project to Maintain Water Quality of Spent Nuclear Fuel Basin at Idaho Site ...

  20. Completing Salt Waste Processing Facility is an EM Priority and...

    Office of Environmental Management (EM)

    Completing Salt Waste Processing Facility is an EM Priority and Key to SRS Cleanup Progress Completing Salt Waste Processing Facility is an EM Priority and Key to SRS Cleanup ...

  1. NMSLO Affidavit of Completion of ROW Construction | Open Energy...

    Open Energy Info (EERE)

    NMSLO Affidavit of Completion of ROW Construction Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: NMSLO Affidavit of Completion of...

  2. Second Panel of Disposal Rooms Completed in WIPP Underground

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Second Panel of Disposal Rooms Completed in WIPP Underground CARLSBAD, N.M., October 13, ... Crews working in two shifts completed mining Panel 2 weeks ahead of schedule and under ...

  3. Method for forming polymerized microfluidic devices (Patent) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Method for forming polymerized microfluidic devices Citation Details In-Document Search Title: Method for forming polymerized microfluidic devices Methods for making a microfluidic device according to embodiments of the present invention include defining.about.cavity. Polymer precursor solution is positioned in the cavity, and exposed to light to begin the polymerization process and define a microchannel. In some embodiments, after the polymerization process is partially complete, a

  4. U.S. Department of Energy Categorical Exclusion Determination Form

    Energy Savers [EERE]

    (This form will be locked for editing upon signature) U.S. Department of Energy Categorical Exclusion Determination Form Proposed Action Title: Program or Field Office: Location(s) (City/County/State): Proposed Action Description: Categorical Exclusion(s) Applied: For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, including the full text of each categorical exclusion, see Subpart D of 10 CFR Part 1021. Regulatory Requirements in 10 CFR

  5. Method for forming polymerized microfluidic devices (Patent) | DOEPatents

    Office of Scientific and Technical Information (OSTI)

    Method for forming polymerized microfluidic devices Title: Method for forming polymerized microfluidic devices Methods for making a microfluidic device according to embodiments of the present invention include defining.about.cavity. Polymer precursor solution is positioned in the cavity, and exposed to light to begin the polymerization process and define a microchannel. In some embodiments, after the polymerization process is partially complete, a solvent rinse is performed, or fresh polymer

  6. NNSA Completes Major Computing Upgrade for Faster Predictions at National

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Completes B61 Warhead Refurbishment NNSA Completes B61 Warhead Refurbishment Washington, DC NNSA completed a six-year effort to deliver the first refurbished B61 nuclear bomb. This program will extend the life of the B61 Mod-7 and Mod-11 strategic bombs in the U.S. nuclear weapons stockpile Atmospheric Release Advisory Center | National Nuclear Security Administration

    Completes Major Computing Upgrade for Faster Predictions at National Atmospheric Release Advisory

  7. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  8. Electronic Registration Form - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Us Hanford Site Wide Programs Health & Safety Exposition Electronic Registration Form About Us Charging Your Time Committee Members Contact Us Electronic Registration Form Exhibitor and Vendor Information EXPO 2016 Sponsors EXPO Award Criteria How to Get to TRAC Special Events What is EXPO Why Should I Participate in EXPO Electronic Registration Form Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size * Fields marked with an asterisk are required. Exhibit

  9. Seal for fluid forming tools

    DOE Patents [OSTI]

    Golovashchenko, Sergey Fedorovich; Bonnen, John Joseph Francis

    2012-03-20

    An electro-hydraulic forming tool for forming a sheet metal blank in a one-sided die has first and second rigid rings that engage opposite sides of a sheet metal blank. The rigid rings are contained within slots on a die portion and a hydraulic force applicator portion of the forming tool. The seals are either resiliently biased by an elastomeric member or inherently resiliently biased into contact with the blank.

  10. System for forming janus particles

    DOE Patents [OSTI]

    Hong, Liang; Jiang, Shan; Granick, Steve

    2011-01-25

    The invention is a method of forming Janus particles, that includes forming an emulsion that contains initial particles, a first liquid, and a second liquid; solidifying the first liquid to form a solid that contains at least a portion of the initial particles on a surface of the solid; and treating the exposed particle sides with a first surface modifying agent, to form the Janus particles. Each of the initial particles on the surface has an exposed particle side and a blocked particle side.

  11. SNL Information Repository subscription form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2015 SANDIA NATIONAL LABORATORIES HAZARDOUS WASTE INFORMATION REPOSITORY INDEX Subscription form for hard copy notices of updates Name: Address: City: State: Zip: Please check each...

  12. Structure of the Complete 70S Ribosome at 3.7 Å Resolution

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the Complete 70S Ribosome at 3.7 Å Resolution Print Ribosomes are RNA-based protein factories found in all living cells, responsible for translating the genetic information encoded in messenger RNA (mRNA) into proteins. The first x-ray structures of the complete 70S ribosome were determined in 1999 at 7.8 Å and in 2001 at 5.5 Å, using diffraction data collected at ALS Beamline 5.0.2. These structures showed how the ribosomal RNA and the more than 50 ribosomal proteins are organized to form

  13. Microsoft Word - CAMD Equipment PrePurchase Form.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Equipment Pre-purchase Form (Attach to purchase order) Requestor's Name______________________________________________________________ Requestor's Phone Number_______________________________________________________ Requestor's Initials/Supervisor's initials_____________________________________________ Has designated space been identified? Yes No Will any facility modifications be required? Yes No If yes, describe below Modifications to be completed

  14. Technology Transfer Reporting Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Transfer Reporting Form Technology Transfer Reporting Form PDF icon Technology Transfer Reporting Form More Documents & Publications Technology Partnership Ombudsman - Roles,...

  15. Method of forming ceramic bricks

    DOE Patents [OSTI]

    Poeppel, R.B.; Claar, T.D.; Silkowski, P.

    1987-04-22

    A method for forming free standing ceramic bricks for use as tritium breeder material is disclosed. Aqueous solutions of sodium carbonate and potassium carbonate are mixed with an organic hydrocolloid dispersion and powdered lithium carbonate, spray dried, and ceramic bricks formed by molding in a die and firing.

  16. Method of forming ceramic bricks

    DOE Patents [OSTI]

    Poeppel, Roger B. (Glen Ellyn, IL); Claar, Terry D. (Newark, DE); Silkowski, Peter (Urbana, IL)

    1988-01-01

    A method for forming free standing ceramic bricks for use as tritium breeder material is disclosed. Aqueous solutions of sodium carbonate and potassium carbonate are mixed with an organic hydrocolloid dispersion and powdered lithium carbonate, spray dried, and ceramic bricks formed by molding in a die and firing.

  17. Fermilab | Tevatron | Guest Book | Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guest Book - Form Share your Tevatron-related memories, comments and stories by using our submission form below: Submitted comments are restricted to 200 words and comments will be moderated for inappropriate content. Name: Institution: Email: Memory, comment or story: Words remaining: 200 Submit

  18. Oregon Modification Application Geothermal Wells Form | Open...

    Open Energy Info (EERE)

    Modification Application Geothermal Wells Form Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: Oregon Modification Application Geothermal Wells Form Form...

  19. TEPP - Exercise Evaluation Forms | Department of Energy

    Office of Environmental Management (EM)

    TEPP - Exercise Evaluation Forms TEPP - Exercise Evaluation Forms Hazardous Materials Exercise Evaluation Forms PDF icon Exercise Evaluation Forms More Documents & Publications...

  20. Chiral corrections to hyperon axial form factors

    SciTech Connect (OSTI)

    Jiang Fujiun; Tiburzi, B. C.

    2008-05-01

    We study the complete set of flavor-changing hyperon axial-current matrix elements at small momentum transfer. Using partially quenched heavy baryon chiral perturbation theory, we derive the chiral and momentum behavior of the axial and induced pseudoscalar form factors. The meson pole contributions to the latter posses a striking signal for chiral physics. We argue that the study of hyperon axial matrix elements enables a systematic lattice investigation of the efficacy of three-flavor chiral expansions in the baryon sector. This can be achieved by considering chiral corrections to SU(3) symmetry predictions, and their partially quenched generalizations. In particular, despite the presence of eight unknown low-energy constants, we are able to make next-to-leading order symmetry breaking predictions for two linear combinations of axial charges.

  1. Process to form mesostructured films

    DOE Patents [OSTI]

    Brinker, C.J.; Anderson, M.T.; Ganguli, R.; Lu, Y.F.

    1999-01-12

    This invention comprises a method to form a family of supported films with pore size in the approximate range 0.8-20 nm exhibiting highly ordered microstructures and porosity derived from an ordered micellar or liquid-crystalline organic-inorganic precursor structure that forms during film deposition. Optically transparent, 100-500-nm thick films exhibiting a unique range of microstructures and uni-modal pore sizes are formed in seconds in a continuous coating operation. Applications of these films include sensors, membranes, low dielectric constant interlayers, anti-reflective coatings, and optical hosts. 12 figs.

  2. Process to form mesostructured films

    DOE Patents [OSTI]

    Brinker, C. Jeffrey; Anderson, Mark T.; Ganguli, Rahul; Lu, Yunfeng

    1999-01-01

    This invention comprises a method to form a family of supported films film with pore size in the approximate range 0.8-20 nm exhibiting highly ordered microstructures and porosity derived from an ordered micellar or liquid-crystalline organic-inorganic precursor structure that forms during film deposition. Optically transparent, 100-500-nm thick films exhibiting a unique range of microstructures and uni-modal pore sizes are formed in seconds in a continuous coating operation. Applications of these films include sensors, membranes, low dielectric constant interlayers, anti-reflective coatings, and optical hosts.

  3. Habitat Projects Completed within the Asotin Creek Watershed, 1998 Completion Report.

    SciTech Connect (OSTI)

    Johnson, Bradley J.

    1999-11-01

    The Asotin Creek Model Watershed Program (ACMWP) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The Asotin Creek watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington. Snake River spring chinook salmon, summer steelhead and bull trout, which are listed under the Endangered Species Act (ESA), are present in the watershed. The ACMWP began coordinating habitat projects in 1995. Approximately two hundred forty-six projects have been implemented through the ACMWP as of 1998. Fifty-nine of these projects were funded in part through Bonneville Power Administration's 1998 Columbia Basin Fish and Wildlife Program. These projects used a variety of methods to enhance and protect watershed conditions. In-stream work for fish habitat included construction of hard structures (e.g. vortex rock weirs), meander reconstruction, placement of large woody debris (LWD) and whole trees and improvements to off-channel rearing habitat; one hundred thirty-nine pools were created with these structures. Three miles of stream benefited from riparian improvements such as fencing, vegetative plantings, and noxious weed control. Two alternative water developments were completed, providing off-stream-watering sources for livestock. 20,500 ft of upland terrace construction, seven sediment basin construction, one hundred eighty-seven acres of grass seeding, eight hundred fifty acres of direct seeding and eighteen sediment basin cleanouts were implemented to reduce sediment production and delivery to streams in the watershed.

  4. Method for the concurrent ultrasonic inspection of partially completed welds

    DOE Patents [OSTI]

    Johnson, John A. (Idaho Falls, ID); Larsen, Eric D. (Idaho Falls, ID); Miller, Karen S. (Idaho Falls, ID); Smartt, Herschel B. (Idaho Falls, ID); McJunkin, Timothy R. (Idaho Falls, ID)

    2002-01-01

    A method for the concurrent ultrasonic inspection of partially completed welds is disclosed and which includes providing a pair of transducers which are individually positioned on the opposite sides of a partially completed weld to be inspected; moving the transducers along the length of and laterally inwardly and outwardly relative to the partially completed weld; pulsing the respective transducers to produce an ultrasonic signal which passes through or is reflected from the partially completed weld; receiving from the respective transducers ultrasonic signals which pass through or are reflected from the partially completed welds; and analyzing the ultrasonic signal which has passed through or is reflected from the partially completed weld to determine the presence of any weld defects.

  5. Multizone subsea completions in the Dai Hung field, Vietnam

    SciTech Connect (OSTI)

    Lay, K.R.

    1996-09-01

    The early production phase of the Dai Hung field development resulted in the drilling and completion of five subsea wells. Because of the complex nature of the reservoirs, selective multizone completions were installed for effective reservoir data acquisition and reservoir management. The downhole completion designs used equipment that was primarily of existing proven design and downhole equipment installation was successfully achieved in a single trip. Ongoing reservoir management will be aided by the use of a subsea wireline system to facilitate data acquisition.

  6. Brief: Multizone subsea completions in the Dai Hung field, Vietnam

    SciTech Connect (OSTI)

    Lay, K.R.

    1996-04-01

    The early production phase of the Dai Hung field development involved drilling and completion of five subsea wells. Owing to the complex nature of the reservoirs, selective multizone completions were installed for effective reservoir data acquisition and reservoir management. Downhole completion designs used equipment that was primarily of existing proven design, and downhole equipment was installed in a single trip. Ongoing reservoir management will be aided by use of a subsea wireline system to facilitate data acquisition.

  7. Complete LNG Terminal Status Maps | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Complete LNG Terminal Status Maps Complete LNG Terminal Status Maps A series of slides showing the status of various LNG terminals (existing, under construction, proposed, etc.) in North America. PDF icon Complete LNG Terminal Status Map as of December 2012 More Documents & Publications Summary of LNG Export Applications of the Lower 48 States EA-1942: Finding of No Significant Impact ORDER NO. 3413: Jordan Cove LNG

  8. completed_env_projects | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Solutions Completed Projects All Completed Enviromental Solutions Projects Are Listed Below by Category Produced Water | Federal Lands Access | Regulatory Streamlining | Oil Refining Completed Produced Water Management Projects Project Number Project Name Primary Performer DE-NT0005227 Membrane Technology for Produced Water at Lea County, NM Lea County Government, Lovington, NM DE-FE0000833 An Integrated Water Treatment Technology Solution for Sustainable Water Resource Management

  9. completed_ep_projects | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Completed Exploration and Production Projects All Completed E&P Projects Are Listed Below by Category Exploration Technologies | Reservoir Characterization | Advanced Drilling | Deep Formations Improved Recovery | Tech Transfer | Natural Gas Processing | Low Perm Sandstones | Liquefied Natural Gas | Arctic Resources Completed Exploration Technologies Projects Project Number Project Name Primary Performer DE-FG26-05NT42494 Mapping Alternations caused by Hydrocarbon Microseepages in Patrick

  10. Los Alamos County Completes Abiquiu Hydropower Project, Bringing New Clean

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Resources to New Mexico | Department of Energy County Completes Abiquiu Hydropower Project, Bringing New Clean Energy Resources to New Mexico Los Alamos County Completes Abiquiu Hydropower Project, Bringing New Clean Energy Resources to New Mexico April 21, 2011 - 12:00am Addthis WASHINGTON, D.C. - U.S. Energy Secretary Steven Chu issued the following statement on the completion and startup today of the Abiquiu Hydropower Project in New Mexico - the first hydropower project funded by

  11. High power laser workover and completion tools and systems

    SciTech Connect (OSTI)

    Zediker, Mark S; Rinzler, Charles C; Faircloth, Brian O; Koblick, Yeshaya; Moxley, Joel F

    2014-10-28

    Workover and completion systems, devices and methods for utilizing 10 kW or more laser energy transmitted deep into the earth with the suppression of associated nonlinear phenomena. Systems and devices for the laser workover and completion of a borehole in the earth. These systems and devices can deliver high power laser energy down a deep borehole, while maintaining the high power to perform laser workover and completion operations in such boreholes deep within the earth.

  12. Innovative Drivetrain Testing for Wind Turbines Nears Completion |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Drivetrain Testing for Wind Turbines Nears Completion Innovative Drivetrain Testing for Wind Turbines Nears Completion March 24, 2016 - 10:14am Addthis NREL researchers are completing testing of a next-generation drivetrain, shown here undergoing rigorous tests at the National Wind Technology Center’s 2.5-megawatt dynamometer. NREL’s testing validates the technology prior to commercialization. Shown here are NREL senior engineer and project lead Jonathan Keller

  13. SRS Recovery Act Completes Major Lower Three Runs Project Cleanup |

    Energy Savers [EERE]

    Department of Energy Recovery Act Completes Major Lower Three Runs Project Cleanup SRS Recovery Act Completes Major Lower Three Runs Project Cleanup American Recovery and Reinvestment Act can now claim that 85 percent of the Savannah River Site (SRS) has been cleaned up with the recent completion of the Lower Three Runs (stream) Project. Twenty miles long, Lower Three Runs leaves the main body of the 310-square mile site and runs through parts of Barnwell and Allendale Counties until it

  14. Department of Energy Announces Completion of World's Largest Laser |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Completion of World's Largest Laser Department of Energy Announces Completion of World's Largest Laser March 31, 2009 - 12:00am Addthis WASHINGTON, DC - The Department of Energy today announced that the National Nuclear Security Administration (NNSA) has certified the completion of the historic effort to build the world's largest laser. Housed at the Department of Energy's Lawrence Livermore National Laboratory, the National Ignition Facility (NIF) is expected to allow

  15. Secretary Bodman Celebrates Clean Up Completion of Three Former Weapons

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Research and Production Sites in Ohio | Department of Energy Clean Up Completion of Three Former Weapons Research and Production Sites in Ohio Secretary Bodman Celebrates Clean Up Completion of Three Former Weapons Research and Production Sites in Ohio January 19, 2007 - 9:59am Addthis Over 1,100 Acres in Fernald, Columbus and Ashtabula Restored CROSBY TOWNSHIP, OH - U.S. Secretary of Energy Samuel W. Bodman today certified that environmental cleanup is complete at three former weapons

  16. Secretary Chu Announces Completion of Critical Energy Conservation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appliance Standards | Department of Energy Completion of Critical Energy Conservation Appliance Standards Secretary Chu Announces Completion of Critical Energy Conservation Appliance Standards September 1, 2009 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu announced today that the Department of Energy has completed energy efficiency standards for a critical group of appliances that will together save up to 1.1 billion metric tons of carbon dioxide once in effect. In

  17. Princeton Plasma Physics Laboratory achieves milestone, completing first

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    part of heart of fusion experiment | Princeton Plasma Physics Lab Princeton Plasma Physics Laboratory achieves milestone, completing first part of heart of fusion experiment By John Greenwald March 22, 2013 Tweet Widget Google Plus One Share on Facebook The completed first section of the NSTX-U center stack. (Photo by Elle Starkman, PPPL Office of Communications) The completed first section of the NSTX-U center stack. Gallery: Related Images: Engineers and technicians at the U.S. Department

  18. Energy Department Completes Cool Roof Installation on DC Headquarters

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building to Save Money by Saving Energy | Department of Energy Completes Cool Roof Installation on DC Headquarters Building to Save Money by Saving Energy Energy Department Completes Cool Roof Installation on DC Headquarters Building to Save Money by Saving Energy December 14, 2010 - 12:00am Addthis Washington - Secretary Steven Chu today announced the completion of a new cool roof installation on the Department of Energy's Headquarters West Building. There was no incremental cost to adding

  19. Hampton University Scientists Complete Historic Experiment | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientists Complete Historic Experiment Hampton University Scientists Complete Historic Experiment Two experiments recently completed at the Department of Energy's (DOE) Thomas Jefferson National Accelerator Facility (Jefferson Lab) will put scientists one step closer toward understanding the world we live in. The experiments used Jefferson Lab's high energy accelerator and experimental equipment to produce kaons [pronounced Ka- onz], subatomic particles made of quarks, that have puzzled

  20. AMO Announces Successful Completion of Industrial-Scale Combined Heat,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Hydrogen, and Power System | Department of Energy Announces Successful Completion of Industrial-Scale Combined Heat, Hydrogen, and Power System AMO Announces Successful Completion of Industrial-Scale Combined Heat, Hydrogen, and Power System May 20, 2015 - 9:00am Addthis Photo Courtesy of FuelCell Energy, Danbury, CT Photo Courtesy of FuelCell Energy, Danbury, CT AMO recently joined with FuelCell Energy of Danbury, CT to celebrate the completion of their successful partnership project at

  1. NMOSE Forms | Open Energy Information

    Open Energy Info (EERE)

    library Legal Document- Permit ApplicationPermit Application: NMOSE FormsLegal Published NA Year Signed or Took Effect 2012 Legal Citation Not provided DOI Not Provided Check for...

  2. Employee In-Processing Forms

    Broader source: Energy.gov [DOE]

    The employment forms found in this section collect important and necessary information about you that will be used to verify your identity and eligibility for Federal Employment, capture all...

  3. Triggered pore-forming agents

    DOE Patents [OSTI]

    Bayley, Hagan; Walker, Barbara J.; Chang, Chung-yu; Niblack, Brett; Panchal, Rekha

    1998-01-01

    An inactive pore-forming agent which is activated to lytic function by a condition such as pH, light, heat, reducing potential, or metal ion concentration, or substance such as a protease, at the surface of a cell.

  4. EIA-412 Form and Instructions

    Gasoline and Diesel Fuel Update (EIA)

    METHOD OF FILING RESPONSE Submit your data electronically over the Internet using our web-based form. Log on to https:elecidc.eia.doe.gov Web-based Survey Information EIA uses ...

  5. FAQs for Survey Forms 914

    Gasoline and Diesel Fuel Update (EIA)

    ... May the oil or gas volumes be submitted separately? Where are oil sales submitted (web or ... If you're using the web form there are comments you can select from the drop down list or ...

  6. Process for forming planarized films

    DOE Patents [OSTI]

    Pang, Stella W.; Horn, Mark W.

    1991-01-01

    A planarization process and apparatus which employs plasma-enhanced chemical vapor deposition (PECVD) to form plarnarization films of dielectric or conductive carbonaceous material on step-like substrates.

  7. Methods of forming hardened surfaces

    DOE Patents [OSTI]

    Branagan, Daniel J. (Iona, ID)

    2004-07-27

    The invention encompasses a method of forming a metallic coating. A metallic glass coating is formed over a metallic substrate. After formation of the coating, at least a portion of the metallic glass can be converted into a crystalline material having a nanocrystalline grain size. The invention also encompasses metallic coatings comprising metallic glass. Additionally, the invention encompasses metallic coatings comprising crystalline metallic material, with at least some of the crystalline metallic material having a nanocrystalline grain size.

  8. Method for forming metal contacts

    DOE Patents [OSTI]

    Reddington, Erik; Sutter, Thomas C; Bu, Lujia; Cannon, Alexandra; Habas, Susan E; Curtis, Calvin J; Miedaner, Alexander; Ginley, David S; Van Hest, Marinus Franciscus Antonius Maria

    2013-09-17

    Methods of forming metal contacts with metal inks in the manufacture of photovoltaic devices are disclosed. The metal inks are selectively deposited on semiconductor coatings by inkjet and aerosol apparatus. The composite is heated to selective temperatures where the metal inks burn through the coating to form an electrical contact with the semiconductor. Metal layers are then deposited on the electrical contacts by light induced or light assisted plating.

  9. Radiation Safety Work Control Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiation Safety Work Control Form (see instructions on pg-3) Rev. May 2014 Area: Form #: Date: Preliminary Applicability Screen: (a) Will closing the beam line injection stoppers mitigate the radiological hazards introduced by the proposed work? Yes No (b) Can the closed state of the beam line injection stoppers be assured during the proposed work (ie., work does NOT involve injection stoppers or associated HPS)? Yes No If the answers to both questions are yes, the work can be performed safely

  10. Chevron, GE form Technology Alliance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chevron, GE form Technology Alliance Chevron, GE form Technology Alliance The Chevron GE Technology Alliance will develop and commercialize valuable technologies to solve critical needs for the oil and gas industry. February 3, 2014 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new materials. Los

  11. Certification of Completion of Level-2 Milestone 405: Deploy...

    Office of Scientific and Technical Information (OSTI)

    Next-Generation Data Management and Analysis Environment Citation Details In-Document Search Title: Certification of Completion of Level-2 Milestone 405: Deploy Next-Generation ...

  12. Sandia Energy - SPIDERS Completed Its Phase 1 Operational Demonstratio...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Grid Integration News & Events Research & Capabilities SMART Grid Energy Assurance Microgrid SPIDERS Completed Its Phase 1 Operational Demonstration in Late January Previous...

  13. Westinghouse Completes its AP1000® Test Stand

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Completes its AP1000 Test Stand Last June, CASL launched its first Virtual Environment for Reactor Applications (VERA) Test Stand on the Westinghouse engineering computer ...

  14. Major Milestone: PPPL completes first quadrant of the heart of...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    preparations and close teamwork. (Photo by Elle Starkman, PPPL Office of Communications) Mission accomplished: The completed first section of the NSTX-U center stack capped months...

  15. Raft River Geothermal Exploratory Hole No. 1 (RRGE-1). Completion...

    Open Energy Info (EERE)

    report Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Raft River Geothermal Exploratory Hole No. 1 (RRGE-1). Completion report Abstract GEOTHERMAL...

  16. Certification of Completion of Level-2 Milestone 405: Deploy...

    Office of Scientific and Technical Information (OSTI)

    Data Management and Analysis Environment Citation Details In-Document Search Title: Certification of Completion of Level-2 Milestone 405: Deploy Next-Generation Data Management and ...

  17. NNSA Applauds Y-12 for Completing Potable Water Project Ahead...

    National Nuclear Security Administration (NNSA)

    Applauds Y-12 for Completing Potable Water Project Ahead of Schedule and Under Budget | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission...

  18. Transition for Pantex and Y-12 Contract Completed | National...

    National Nuclear Security Administration (NNSA)

    Transition for Pantex and Y-12 Contract Completed | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

  19. Microsoft Word - Completion of an Evalution of Impact of Loss...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Completion of an Evaluation of the Impact of the Loss of Two Hydrogen and Methane Monitoring Sampling Lines Dear Mr. Bearzi: As required under Permit Condition...

  20. Going completely renewable: is it possible (let alone desirable)?

    SciTech Connect (OSTI)

    Sovacool, Benjamin K.; Watts, Charmaine

    2009-05-15

    With the right mix of leadership and policy, a completely renewable electricity sector for New Zealand and the United States is feasible, achievable, and desirable. (author)

  1. Completed Projects Table 2015-08-21.xlsx

    Office of Environmental Management (EM)

    Completed Projects 2005-Present Approved Actual Soil and Water Remediation Soil and Water Remediation ANLE-0030 a 28 30 2007 2007 Yes Yes Yes Nuclear Facility Deactivation and...

  2. Coiled tubing completions: An economic discussion of procedures

    SciTech Connect (OSTI)

    Courville, P.W.; Clark, T.R.

    1995-11-01

    The introduction of 2- to 3 {1/2}-in. coiled tubing (CT) sizes provides economical alternative completion opportunities for both new and existing wells. Smaller diameters of CT can also be incorporated into completion designs on existing tubular completions for rigless workovers. This paper will discuss the evaluation method for CT completions in relatively low bottom-hole pressure wells in a non-hostile environment. It will concentrate on two major methods of artificial lift: (1) the use of electric submersible pumps (ESPs) on new wells or (2) the use of gas lift methods to extend the production life of existing wells.

  3. Goodyear Tire Plant Gains Traction on Energy Savings After Completing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Goodyear Tire Plant Gains Traction on Energy Savings After Completing Save Energy Now Assessment (May 2008) More Documents & Publications Terra Nitrogen Company, L.P.: ...

  4. Project Completion/Closeout Guide - DOE Directives, Delegations...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6A, Project CompletionCloseout Guide by Brian Huizenga Functional areas: Program Management, Program Planning and Management, Project Management The guide provides nonmandatory...

  5. Supplier Information Form | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supplier Information Form PDF icon SB_SIF_form_Rev_0110

  6. LBNL Affiliate Forms - 88-Inch Cyclotron

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Users‎ > ‎ LBNL Affiliate Forms Affiliate Forms (click here to open pdf)

  7. Construction completed, PPPL is set to resume world-class fusion research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    later this fall | Princeton Plasma Physics Lab Construction completed, PPPL is set to resume world-class fusion research later this fall By John Greenwald October 6, 2015 Tweet Widget Google Plus One Share on Facebook Staffers who worked on the National Spherical Torus Experiment-Upgrade. (Photo by Elle Starkman/Office of Communications) Staffers who worked on the National Spherical Torus Experiment-Upgrade. Gallery: Technicians inspect the new center stack that forms the heart of the

  8. Paperwork Reduction Act Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Form Paperwork Reduction Act Form Collection Discontinuation Form PDF icon Paperwork Reduction Act Form More Documents & Publications OMB83 D Discontinuance Form OMB 83 C Paperwork Reduction Act Submission (OMB 83-I)

  9. Utah Antidegradation Review Form | Open Energy Information

    Open Energy Info (EERE)

    Utah Antidegradation Review Form Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: Utah Antidegradation Review Form Form Type ApplicationNotice Form Topic...

  10. Transition for Pantex and Y-12 Contract Completed | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Transition for Pantex and Y-12 Contract Completed July 01, 2014 The National Nuclear Security Administration Production Office and Consolidated Nuclear Security have completed one of the largest and most complex contract transitions in the history of the U.S. Department of Energy. File 2014-07-01

  11. Uranium Processing Facility Site Readiness Subproject Completed on Time and

    National Nuclear Security Administration (NNSA)

    Under Budget | National Nuclear Security Administration Uranium Processing Facility Site Readiness Subproject Completed on Time and Under Budget March 13, 2015 The Uranium Processing Facility (UPF) project celebrates its first major milestone with the completion of site readiness work, delivered on time and under budget. File 2015-03-13

  12. Specialized equipment enabled completions with large coiled tubing

    SciTech Connect (OSTI)

    Taylor, R.W.; Conrad, B.

    1996-02-19

    Specialized equipment enabled successful well completions in Oman with large 3{1/2}-inch coiled tubing. Conventional drilling or completion rigs were not needed. Although the use of 3{1/2}-inch coiled tubing to complete wells is relatively new, it is gaining widespread industry application. One Middle East operating company felt that if downhole completion equipment could be successfully run using coiled tubing, greater cost efficiency, both in initial deployment and in maintenance, could be derived. The paper lists some of the technical considerations for these assumptions. The long-term advantages regarding production and well maintenance cannot yet be determined, but experience in Oman has confirmed the belief that large coiled tubing completions can be technically achieved.

  13. Apparatus for the concurrent ultrasonic inspection of partially completed welds

    DOE Patents [OSTI]

    Johnson, John A.

    2000-01-01

    An apparatus for the concurrent nondestructive evaluation of partially completed welds is described and which is used in combination with an automated welder and which includes an ultrasonic signal generator mounted on the welder and which generates an ultrasonic signal which is directed toward one side of the partially completed welds; an ultrasonic signal receiver mounted on the automated welder for detecting ultrasonic signals which are transmitted by the ultrasonic signal generator and which are reflected or diffracted from one side of the partially completed weld or which passes through a given region of the partially completed weld; and an analysis assembly coupled with the ultrasonic signal receiver and which processes the ultrasonic signals received by the ultrasonic signal receiver to identify welding flaws in the partially completed weld.

  14. Methods of forming boron nitride

    DOE Patents [OSTI]

    Trowbridge, Tammy L; Wertsching, Alan K; Pinhero, Patrick J; Crandall, David L

    2015-03-03

    A method of forming a boron nitride. The method comprises contacting a metal article with a monomeric boron-nitrogen compound and converting the monomeric boron-nitrogen compound to a boron nitride. The boron nitride is formed on the same or a different metal article. The monomeric boron-nitrogen compound is borazine, cycloborazane, trimethylcycloborazane, polyborazylene, B-vinylborazine, poly(B-vinylborazine), or combinations thereof. The monomeric boron-nitrogen compound is polymerized to form the boron nitride by exposure to a temperature greater than approximately 100.degree. C. The boron nitride is amorphous boron nitride, hexagonal boron nitride, rhombohedral boron nitride, turbostratic boron nitride, wurzite boron nitride, combinations thereof, or boron nitride and carbon. A method of conditioning a ballistic weapon and a metal article coated with the monomeric boron-nitrogen compound are also disclosed.

  15. PROCESS OF FORMING POWDERED MATERIAL

    DOE Patents [OSTI]

    Glatter, J.; Schaner, B.E.

    1961-07-14

    A process of forming high-density compacts of a powdered ceramic material is described by agglomerating the powdered ceramic material with a heat- decompossble binder, adding a heat-decompossble lubricant to the agglomerated material, placing a quantity of the material into a die cavity, pressing the material to form a compact, pretreating the compacts in a nonoxidizing atmosphere to remove the binder and lubricant, and sintering the compacts. When this process is used for making nuclear reactor fuel elements, the ceramic material is an oxide powder of a fissionsble material and after forming, the compacts are placed in a cladding tube which is closed at its ends by vapor tight end caps, so that the sintered compacts are held in close contact with each other and with the interior wall of the cladding tube.

  16. Method of forming structural heliostat

    DOE Patents [OSTI]

    Anderson, Alfred J.

    1984-06-26

    In forming a heliostat having a main support structure and pivoting and tilting motors and gears and a mirror module for reflecting solar energy onto a collector, the improvement characterized by a method of forming the mirror module in which the mirror is laid upon a solid rigid supporting bed in one or more sections, with or without focusing; a mirror backing sheet is applied by first applying respective thin layers of silicone grease and, thereafter, progressively rolling application to eliminate air bubbles; followed by affixing of a substrate assembly to the mirror backing sheet to form a mirror module that does not curve because of thermally induced stresses and differential thermal expansion or contraction effects. The silicone grease also serves to dampen fluttering of the mirror and protect the mirror backside against adverse effects of the weather. Also disclosed are specific details of preferred embodiments.

  17. Microsoft Word - FORM46002.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Frequency No. of Copies Addressees 4. Reporting Requirements: MANAGEMENT REPORTING Progress Report Special Status Report SCIENTIFIC/TECHNICAL REPORTING (Reports/Products must be submitted with appropriate DOE F 241. The 241 forms are available at www.osti.gov/elink.) Report/Product Form Final Scientific/Technical Report DOE F 241.3 Conference papers/proceedings* DOE F 241.3 Software/Manual DOE F 241.4 Other (see special instructions) DOE F 241.3 * Scientific and technical conferences only

  18. Department of Energy Completes Demolition of K-33 Building- Largest Completed Demo Project in Oak Ridge History

    Broader source: Energy.gov [DOE]

    OAK RIDGE, Tenn. - The U.S. Department of Energy’s Oak Ridge Environmental Management (EM) program recently completed its largest demolition project to date. The removal of K-33, a former gaseous diffusion uranium enrichment facility spanning 32-acres, was completed several months ahead of schedule. The American Recovery and Reinvestment Act funded the $51 million project.

  19. DOE Form 1332.7

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7# COST PLAN OMB Control No. (12-85) 1910-1400 1. TITLE 2. IDENTIFICATION NUMBER 3. PARTICIPANT NAME AND ADDRESS 4. COST PLAN DATE 5. START DATE 6. COMPLETION DATE 7. 8. 9. Plan 10. Actual 11. 12. 13. Sub- 14. Element Reporting Prior Prior sequent Total Code Element Fiscal Fiscal Fiscal Year Year Years CURRENT FISCAL YEAR FUTURE FISCAL YEARS Total 15. TOTAL 16. DOLLARS EXPRESSED IN: 17. SIGNATURE OF PARTICIPANT'S PROJECT MANAGER AND DATE 18. SIGNATURE OF PARTICIPANT'S AUTHORIZED FINANCIAL

  20. HHS SMALL BUSINESS REVIEW FORM

    Energy Savers [EERE]

    Form 4220.2 (Revised January 2014) Office of Small and Disadvantaged Business Utilization Small Business Review OSDBU Control Number: _______________________________________Date Received: ______________________________ A. Project Information 1. Requisition Number: ________________________ Acquisition Instrument Proposed/Contract Type: [ ] Contract No (Mod): ______________________ [ ] Departmental IDIQ No: ___________________ [ ] GSA Schedule: _________________________ [ ] GWAC Contract:

  1. ExRep_form.indd

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Report Submit all experiment reports using this fillable pdf form and upload the saved file using the LANSCE proposals Websi After logging in, click the "Upload Experiment Report" link in the proposal actions view table. Local contact Flight path/instrument Proposal number Title Authors and Affiliations Experiment report

  2. Triggered pore-forming agents

    DOE Patents [OSTI]

    Bayley, H.; Walker, B.J.; Chang, C.Y.; Niblack, B.; Panchal, R.

    1998-07-07

    An inactive pore-forming agent is revealed which is activated to lytic function by a condition such as pH, light, heat, reducing potential, or metal ion concentration, or substance such as a protease, at the surface of a cell. 30 figs.

  3. Technetium Immobilization Forms Literature Survey

    SciTech Connect (OSTI)

    Westsik, Joseph H.; Cantrell, Kirk J.; Serne, R. Jeffrey; Qafoku, Nikolla

    2014-05-01

    Of the many radionuclides and contaminants in the tank wastes stored at the Hanford site, technetium-99 (99Tc) is one of the most challenging to effectively immobilize in a waste form for ultimate disposal. Within the Hanford Tank Waste Treatment and Immobilization Plant (WTP), the Tc will partition between both the high-level waste (HLW) and low-activity waste (LAW) fractions of the tank waste. The HLW fraction will be converted to a glass waste form in the HLW vitrification facility and the LAW fraction will be converted to another glass waste form in the LAW vitrification facility. In both vitrification facilities, the Tc is incorporated into the glass waste form but a significant fraction of the Tc volatilizes at the high glass-melting temperatures and is captured in the off-gas treatment systems at both facilities. The aqueous off-gas condensate solution containing the volatilized Tc is recycled and is added to the LAW glass melter feed. This recycle process is effective in increasing the loading of Tc in the LAW glass but it also disproportionally increases the sulfur and halides in the LAW melter feed which increases both the amount of LAW glass and either the duration of the LAW vitrification mission or the required supplemental LAW treatment capacity.

  4. Spin-forming Project Report

    SciTech Connect (OSTI)

    Switzner, Nathan; Henry, Dick

    2009-03-20

    In a second development order, spin-forming equipment was again evaluated using the test shape, a hemispherical shell. In this second development order, pure vanadium and alloy titanium (Ti-6Al-4V) were spin-formed, as well as additional copper and 21-6-9 stainless. In the first development order the following materials had been spin-formed: copper (alloy C11000 ETP), 6061 aluminum, 304L stainless steel, 21-6-9 stainless steel, and tantalum-2.5% tungsten. Significant challenges included properly adjusting the rotations-per-minute (RPM), cracking at un-beveled edges and laser marks, redressing of notches, surface cracking, non-uniform temperature evolution in the titanium, and cracking of the tailstock. Lessons learned were that 300 RPM worked better than 600 RPM for most materials (at the feed rate of 800 mm/min); beveling the edges to lower the stress reduces edge cracking; notches, laser marks, or edge defects in the preform doom the process to cracking and failure; coolant is required for vanadium spin-forming; increasing the number of passes to nine or more eliminates surface cracking for vanadium; titanium develops a hot zone in front of the rollers; and the tailstock should be redesigned to eliminate the cylindrical stress concentrator in the center.

  5. Process for forming sulfuric acid

    DOE Patents [OSTI]

    Lu, Wen-Tong P.

    1981-01-01

    An improved electrode is disclosed for the anode in a sulfur cycle hydrogen generation process where sulfur dioxie is oxidized to form sulfuric acid at the anode. The active compound in the electrode is palladium, palladium oxide, an alloy of palladium, or a mixture thereof. The active compound may be deposited on a porous, stable, conductive substrate.

  6. Case studies from Oman for coiled tubing deployed completion techniques

    SciTech Connect (OSTI)

    Taylor, R.W.; Conrad, B.

    1996-09-01

    Although the use of ultra-large coiled tubing to complete wells is relatively new, it is gaining widespread industry application. This paper will detail the equipment necessary to perform an operation of this type and will present information from several case studies in Oman in which an operator has successfully deployed completion equipment on 3-1/2-inch-OD coiled tubing. In addition to a discussion of the equipment required to perform the necessary operations, the trial parameters that were established by this operator will be given. The information presented has been selected to allow an initial evaluation to be made of coiled tubing completions in general and will help to determine whether this method can prove to be less expensive than traditional rig-based completions. The topics presented have been chosen to provide the reader with a thorough understanding of the techniques and preparation needed to execute a coiled tubing completion. The summary of experiences will conclude that this innovative completion technique can be a viable method for completing wells. Although long-term advantages regarding production and well maintenance cannot yet be determined, the operator`s experiences to date have confirmed his initial belief that use of coiled tubing in ultra-large continuous-pipe applications can be cost effective.

  7. Course Form | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Course Form Course Form Students may take courses selected by PARCI-CARES, and receive points toward the certificate. By signing this form, the student acknowledges that heshe...

  8. Opinion of Counsel Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Opinion of Counsel Form Opinion of Counsel Form For use with natural gas authorization filings PDF icon Opinion of Counsel Form - Natural Gas Regulation More Documents & ...

  9. Inspection apparatus for evaluating a partially completed weld

    DOE Patents [OSTI]

    Smartt, Herschel B.; Larsen, Eric D.; Johnson, Jonn A.

    2001-01-01

    An inspection apparatus for evaluating a partially completed weld is described and which is utilized in combination with an automated movable welder which moves across a supporting surface, and wherein the inspection apparatus includes a coupling member mounted on the welder; a frame member mounted on the coupling member; an ultrasonic sensor mounted on the frame member and disposed in ultrasonic sound transmitting relation relative to the partially completed weld; and a drive assembly for adjusting the position of the ultrasonic sensor relative to the partially completed weld.

  10. Calabi-Yau metrics for quotients and complete intersections

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Braun, Volker; Brelidze, Tamaz; Douglas, Michael R.; Ovrut, Burt A.

    2008-05-22

    We extend previous computations of Calabi-Yau metrics on projective hypersurfaces to free quotients, complete intersections, and free quotients of complete intersections. In particular, we construct these metrics on generic quintics, four-generation quotients of the quintic, Schoen Calabi-Yau complete intersections and the quotient of a Schoen manifold with Z₃ x Z₃ fundamental group that was previously used to construct a heterotic standard model. Various numerical investigations into the dependence of Donaldson's algorithm on the integration scheme, as well as on the Kähler and complex structure moduli, are also performed.

  11. Microsoft Word - SSRL_LCLS_User_Shipping_Request_Form_hazmat_1-25-2011

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hazardous Material) Will this be shipped to a location outside of the U.S.? No ___ Yes ___ If yes, user must complete Power of Attorney and certify concurrence with terms and conditions. Confirm with Cathy Knotts or Lisa Dunn that this has been completed. _______ * HAZARDOUS MATERIALS MUST BE DECLARED AND MUST BE APPROVED BY ES&H REPRESENTATIVE. (see reverse side of this form) * A Separate form must be submitted for each hazmat declared. * It can take several days to process shipping

  12. Device for temporarily closing duct-formers in well completion apparatus

    SciTech Connect (OSTI)

    Zandmer, H.M.; Zandmer, S.M.

    1981-08-25

    A duct-forming device is disclosed for use in a well completion apparatus of the kind, wherein a bore hole casing is positioned in a bore hole and duct-forming devices of alkali- and acid resistant metal-such as steel-are secured at spaced levels to the casing in alignment with holes machined in the casing wall. In accordance with the invention, a closure device is arranged within the duct-forming device which permits flow of predetermined amounts of liquid, such as acid, from the interior of the casing through the duct-forming device and into the producing formation, while gradually being moved by the liquid into a position in which such fluid flow is prevented. After the fluid flow has been stopped by the closure device and when the formation pressure exceeds the pressure within the duct-forming device and the casing, fluid from the formation then forces the closure device toward and into the casing space to permit thereafter free flow of formation fluid into the duct-forming device and the casing or of pressurized treatment liquid from the casing into the formation. The inventive arrangement permits inter alia the establishment of a sufficient and substantially uniform feeding rate of treatment liquid, such as acid, from the casing into the producing formation through all the duct-formers in preparation for subsequent acidification or other treatments, such as sand fracking.

  13. EM's Office of River Protection Completes Waste Retrieval in...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    "The completion of waste retrieval from another tank is a reflection of the dedicated workforce at the tank farms," said Chris Kemp, deputy federal project director for Tank Farms ...

  14. NNSA celebrates completion of UPF project on time, under budget...

    National Nuclear Security Administration (NNSA)

    readiness subproject at Y-12. The project was completed 20 million under budget, on schedule and work was achieved with more than 600 days without a recordable accident or injury. ...

  15. NNSA Completes its Critical Radar Arming and Fuzing Test for...

    National Nuclear Security Administration (NNSA)

    and Fuzing Test for the W88 ALT 370 September 25, 2014 WASHINGTON, D.C. - The National Nuclear Security Administration (NNSA) recently completed an important test for the W88 ...

  16. Property:NEPA Completion Notes | Open Energy Information

    Open Energy Info (EERE)

    eset-345kv-transmission-line-project-north B BLM-NV-WN-ES-08-01-1310, NV-020-08-01 + 82: Data reviewed for completion Barren Ridge Renewable Transmission + LADWP Project Website:...

  17. NNSA Successfully Completes W87 Refurbishment | National Nuclear...

    National Nuclear Security Administration (NNSA)

    NNSA announced the successful completion at the Pantex Plant outside of Amarillo, Texas, of efforts to refurbish the W87 nuclear warhead and extend its life by 30 years. This marks ...

  18. DOE Completes $17 Million Loan Guarantee for New York Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    17 Million Loan Guarantee for New York Energy Storage System with Recovery Act Funds DOE Completes 17 Million Loan Guarantee for New York Energy Storage System with Recovery Act ...

  19. Raft River Geothermal Exploratory Hole No. 2, RRGE-2. Completion...

    Open Energy Info (EERE)

    report Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Raft River Geothermal Exploratory Hole No. 2, RRGE-2. Completion report Abstract The Raft...

  20. DOE, Washington Closure complete recycling project at Hanford

    Broader source: Energy.gov [DOE]

    RICHLAND, Wash. – The U.S. Department of Energy (DOE) recently teamed with contractor Washington Closure Hanford to complete a major recycling effort during cleanup of the Hanford Site in southeastern Washington State.

  1. SRS Commemorates P & R Reactor Area Completions - SRS Closes...

    Office of Environmental Management (EM)

    Commemorates P & R Reactor Area Completions - SRS Closes the Door on Past Cold War Operations and Opens the Door for Future Missions through Enterprise SRS SRS Commemorates P & R ...

  2. Microsoft Word - HABAdv#226_Central Plateau Completion.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (509) 942-1926 HAB Consensus Advice 226 Subject: Central Plateau Cleanup Completion Strategy Adopted: February 5, 2010 Page 1 February 5, 2010 David Brockman, Manager U.S....

  3. U.S. Geothermal Announces Successful Completion of First Well...

    Open Energy Info (EERE)

    Hot Springs Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: U.S. Geothermal Announces Successful Completion of First Well at Neal Hot Springs Abstract...

  4. U.S. Geothermal Completes Second Successful Production Well at...

    Open Energy Info (EERE)

    Project Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: U.S. Geothermal Completes Second Successful Production Well at Neal Hot Springs Project...

  5. Complete genome sequence of Pedobacter heparinus type strain...

    Office of Scientific and Technical Information (OSTI)

    available data about this species are based on a sole strain that was isolated from dry soil. Here we describe the features of this organism, together with the complete genome...

  6. Completed Recovery Act Project Gives Y-12 New Look

    Broader source: Energy.gov [DOE]

    Y-12 completes Biolody Complex demolition project three months ahead of schedule. The $26.5 million project removed four of the seven buildings from the complex, and it helped modernize the site through much-needed footprint reduction.

  7. Los Alamos County Completes Abiquiu Hydropower Project, Bringing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New Clean Energy Resources to New Mexico Los Alamos County Completes Abiquiu Hydropower Project, Bringing New Clean Energy Resources to New Mexico April 21, 2011 - 12:00am Addthis ...

  8. Project Reach Completes Photographic Work in Room 7, Panel 7

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photographic Work in Room 7, Panel 7 Photographic work in support of the Accident Investigation Board (AIB) has been completed in Room 7 Panel 7, the location of the February ...

  9. Recovery Act Workers Complete Environmental Cleanup of Coal Ash Basin

    Broader source: Energy.gov [DOE]

    The Savannah River Site (SRS) recently cleaned up a 17-acre basin containing coal ash residues from Cold War operations. The American Recovery and Reinvestment Act project was safely completed at a...

  10. Energy Secretary Announces Completion of W62 Dismantlement Program...

    National Nuclear Security Administration (NNSA)

    Energy Secretary Announces Completion of W62 Dismantlement Program August 12, 2010 WASHINGTON, D.C. - U.S. Secretary of Energy Steven Chu announced that the Department of Energy's ...

  11. Hanford Waste Vitrification Plant Project Waste Form Qualification Program Plan

    SciTech Connect (OSTI)

    Randklev, E.H.

    1993-06-01

    The US Department of Energy has created a waste acceptance process to help guide the overall program for the disposal of high-level nuclear waste in a federal repository. This Waste Form Qualification Program Plan describes the hierarchy of strategies used by the Hanford Waste Vitrification Plant Project to satisfy the waste form qualification obligations of that waste acceptance process. A description of the functional relationship of the participants contributing to completing this objective is provided. The major activities, products, providers, and associated scheduling for implementing the strategies also are presented.

  12. Forms | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forms Forms The following are the official Y-12 forms needed by the public. Forms are provided in one or more of three formats: PDF fillable, Word, and HTML. Select a category to...

  13. Program Evaluation: EERE Planned and Completed Evaluations | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Evaluation » Information Resources » Program Evaluation: EERE Planned and Completed Evaluations Program Evaluation: EERE Planned and Completed Evaluations This section provides a list of past and planned evaluation reports for the U.S. Department of Energy's (DOE) Office of Energy Efficiency and Renewable Energy (EERE). Many of the listed reports are available as downloads. The table below tells you which offices have reports accessible as downloads. A checked box in the table -

  14. Waste Treatment Facility Passes Federal Inspection, Completes Final

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Milestone, Begins Startup | Department of Energy Treatment Facility Passes Federal Inspection, Completes Final Milestone, Begins Startup Waste Treatment Facility Passes Federal Inspection, Completes Final Milestone, Begins Startup April 23, 2012 - 12:00pm Addthis Media Contact Erik Simpson, 208-390-9464 Danielle Miller, 208-526-5709 The Idaho site today initiated the controlled, phased startup of a new waste treatment facility scheduled to begin treating 900,000 gallons of radioactive liquid

  15. Workers Complete Demolition at Historic Los Alamos Site | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Workers Complete Demolition at Historic Los Alamos Site Workers Complete Demolition at Historic Los Alamos Site October 7, 2015 - 3:00pm Addthis Workers demolish a former radiologically contaminated warehouse at a historic Los Alamos site. Workers demolish a former radiologically contaminated warehouse at a historic Los Alamos site. The Environmental Management Los Alamos Field Office Federal Integrated Project Team gathers in front of the building known as 21-286 before its

  16. Specificity and completion time distributions of biochemical processes

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: Specificity and completion time distributions of biochemical processes Citation Details In-Document Search Title: Specificity and completion time distributions of biochemical processes In order to produce specific complex structures from a large set of similar biochemical building blocks, many biochemical systems require high sensitivity to small molecular differences. The first and most common mqdel used to explain this high specificity

  17. Specificity and completion time distributions of biochemical processes

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: Specificity and completion time distributions of biochemical processes Citation Details In-Document Search Title: Specificity and completion time distributions of biochemical processes × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information

  18. Brookhaven Lab Completes Decommissioning of Graphite Research Reactor:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reactor core and associated structures successfully removed; waste shipped offsite for disposal | Department of Energy Brookhaven Lab Completes Decommissioning of Graphite Research Reactor: Reactor core and associated structures successfully removed; waste shipped offsite for disposal Brookhaven Lab Completes Decommissioning of Graphite Research Reactor: Reactor core and associated structures successfully removed; waste shipped offsite for disposal September 1, 2012 - 12:00pm Addthis The

  19. Nuclear Materials Safeguards and Security Upgrade Project Completed Under

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Budget | National Nuclear Security Administration Nuclear Materials Safeguards and Security Upgrade Project Completed Under Budget April 03, 2014 WASHINGTON, D.C. - The National Nuclear Security Administration's (NNSA) Nuclear Materials Safeguards and Security Upgrade Project (NMSSUP) was recently completed approximately $1 million under its original budget of $245 million. NMSSUP upgrades security at Los Alamos National Laboratory's (LANL) Technical Area-55, a facility that houses

  20. Jefferson Lab accelerator upgrade completed: Initial operations set to

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    begin while experimental equipment upgrades continue | Jefferson Lab accelerator upgrade completed: Initial operations set to begin while experimental equipment upgrades continue Jefferson Lab accelerator upgrade completed: Initial operations set to begin while experimental equipment upgrades continue areial Aerial of Jefferson Lab NEWPORT NEWS, VA, August 12, 2014 - The Department of Energy's Thomas Jefferson National Accelerator Facility ("Jefferson Lab") has just received formal

  1. LANL completes excavation of 1940s waste disposal site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LANL completes excavation LANL completes excavation of 1940s waste disposal site The excavation removed about 43,000 cubic yards of contaminated debris and soil from the six-acre site. September 22, 2011 Workers sample contents of LANL's Material Disposal Area B (MDA-B) before excavation Workers sample contents of LANL's Material Disposal Area B (MDA-B) before excavation. Contact Colleen Curran Communications Office (505) 664-0344 Email LOS ALAMOS, New Mexico, September 22, 2011-Los Alamos

  2. LANL completes high-priority flood and erosion control work

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lab completes priority erosion controls LANL completes high-priority flood and erosion control work Crews installed 600 feet of water diversion barriers and removed more than 1,200 cubic yards of sediment in anticipation of flash flooding. July 11, 2011 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics

  3. Successful River Corridor Contractor Completes Extra Work Scope, Saving DOE

    Energy Savers [EERE]

    $300 Million | Department of Energy Successful River Corridor Contractor Completes Extra Work Scope, Saving DOE $300 Million Successful River Corridor Contractor Completes Extra Work Scope, Saving DOE $300 Million December 17, 2015 - 12:35pm Addthis A recent photo of the N Reactor in its cocooned state looks sharply different than it did in 2005. A recent photo of the N Reactor in its cocooned state looks sharply different than it did in 2005. RICHLAND, Wash. - The River Corridor Closure

  4. Research Portfolio Report Ultra-Deepwater: Drilling and Completion Operations

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ultra-Deepwater: Drilling and Completion Operations Cover images: Photograph of the North Star Imaging M-5000 industrial CT scanner (left) and 3-D renderings of a (10.4 mm) 3 digital subsection of 10% foam quality cement sample (right). Research Portfolio Report Ultra-Deepwater: Drilling and Completion Operations DOE/NETL-2015/1697 Prepared by: Kathy Bruner, Jennifer Funk, and Christine Rueter KeyLogic Systems, Inc. National Energy Technology Laboratory (NETL) Contact: James Ammer

  5. NNSA, LANL Complete DARHT Improvements With Successful Multi-frame

    National Nuclear Security Administration (NNSA)

    Hydrodynamic Test | National Nuclear Security Administration NNSA, LANL Complete DARHT Improvements With Successful Multi-frame Hydrodynamic Test August 10, 2010 WASHINGTON, D.C. - The National Nuclear Security Administration (NNSA) announced today that Los Alamos National Laboratory's (LANL) Dual Axis Radiographic Hydrodynamic Test (DARHT) facility has completed another successful two axis, multi-frame hydrodynamic test following a period of facility maintenance and several key facility and

  6. Nuclear Materials Safeguards and Security Upgrade Project Completed Under

    National Nuclear Security Administration (NNSA)

    Budget | National Nuclear Security Administration Nuclear Materials Safeguards and Security Upgrade Project Completed Under Budget April 03, 2014 WASHINGTON, D.C. - The National Nuclear Security Administration's (NNSA) Nuclear Materials Safeguards and Security Upgrade Project (NMSSUP) was recently completed approximately $1 million under its original budget of $245 million. NMSSUP upgrades security at Los Alamos National Laboratory's (LANL) Technical Area-55, a facility that houses

  7. Sandia completes major overhaul of key nuclear weapons test facilities |

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration Home / Blog Sandia completes major overhaul of key nuclear weapons test facilities Tuesday, May 13, 2014 - 2:46pm Sandia National Laboratories recently completed the renovation of five large-scale test facilities that are crucial to ensuring the safety and reliability of the nation's nuclear weapons systems. The work supports Sandia's ongoing nuclear stockpile modernization work on the B61-12 and W88 Alt, assessments of current stockpile systems, and

  8. Security Improvements Project Completed Ahead of Schedule, $20 Million

    National Nuclear Security Administration (NNSA)

    Under Budget | National Nuclear Security Administration Security Improvements Project Completed Ahead of Schedule, $20 Million Under Budget April 07, 2014 WASHINGTON, D.C. - The National Nuclear Security Administration's (NNSA) Security Improvements Project (SIP) was recently completed ahead of schedule and approximately $20 million under its original budget of $72 million. SIP upgraded security at Y-12 by replacing existing alarm stations and access control systems with Argus, a

  9. Certification of Completion of Level-2 Milestone 405: Deploy

    Office of Scientific and Technical Information (OSTI)

    Next-Generation Data Management and Analysis Environment (Technical Report) | SciTech Connect Technical Report: Certification of Completion of Level-2 Milestone 405: Deploy Next-Generation Data Management and Analysis Environment Citation Details In-Document Search Title: Certification of Completion of Level-2 Milestone 405: Deploy Next-Generation Data Management and Analysis Environment This summary report describes data management and visualization activities in the Advanced Simulation and

  10. Kansas City Completes Innovative Business Incubator | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kansas City Completes Innovative Business Incubator Kansas City Completes Innovative Business Incubator The logo for EnergyWorks KC. The Blue Hills Business Center and Contractor Incubator is now open! This Kansas City, Missouri, center has been a collaborative effort between EnergyWorks KC, Greater Kansas City Local Initiatives Support Corporation, Blue Hills Community Services, and the Green Impact Zone. The partners helped transform this once abandoned building on a brownfield site in the

  11. EM's Richland Operations Office Completes Chromium Cleanup along Columbia

    Office of Environmental Management (EM)

    Paducah Site Completes Building Removals EM's Paducah Site Completes Building Removals June 29, 2015 - 12:00pm Addthis Once the building was down, heavy equipment operators began “top-down” shearing to safely remove the remaining structure. Demolition debris was then downsized and loaded into rail cars for shipment off site. Once the building was down, heavy equipment operators began "top-down" shearing to safely remove the remaining structure. Demolition debris was then

  12. NNSA's Asset Management Program Completes First Pilot | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration NNSA's Asset Management Program Completes First Pilot December 22, 2015 Asset Management Program implementation team. The National Nuclear Security Administration (NNSA) today announced completion of a $520k pilot to replace a roof, as well as heating, ventilation and cooling (HVAC) system for the Core Library and Data Center at Mercury, Nevada (http://nevada.usgs.gov/mercury/). The library was established as a repository for geologic, hydrologic, and geophysical data

  13. Uranium Processing Facility Site Readiness Subproject Completed on Time and

    National Nuclear Security Administration (NNSA)

    Under Budget | National Nuclear Security Administration Uranium Processing Facility Site Readiness Subproject Completed on Time and Under Budget March 13, 2015 WASHINGTON, D.C.--The Uranium Processing Facility (UPF) project celebrates its first major milestone with the completion of site readiness work, delivered on time and under budget. "UPF is essential to our Nation's uranium mission," said John Eschenberg, UPF Federal Project Director. "Site readiness work sets the

  14. Governor to Join Jefferson Lab in Celebrating Completion of Accelerator

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Upgrade Construction | Jefferson Lab Governor to Join Jefferson Lab in Celebrating Completion of Accelerator Upgrade Construction Governor to Join Jefferson Lab in Celebrating Completion of Accelerator Upgrade Construction CEBAF Race Track This aerial photo shows the outline of the racetrack-shaped CEBAF accelerator at Jefferson Lab in Newport News, Va. NEWPORT NEWS, VA, Sept. 25, 2014 - The Governor of Virginia, Terry McAuliffe, will be the guest speaker at the U.S. Department of Energy's

  15. WIPP Completes State of the Art Emergency Operations Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Participants use the new EOC during a recent emergency response drill. The new state-of-the-art EOC improves WIPP's emergency management capabilities. WIPP UPDATE: October 15, 2015 WIPP Completes State of the Art Emergency Operations Center The Waste Isolation Pilot Plant (WIPP) continues to make improvements to the facility's overall emergency response capabilities. Construction was recently completed on a 4,000 square foot, state of the art Emergency Operations Center (EOC). The Skeen-Whitlock

  16. Agencies complete comprehensive investigation for radioactive and hazardous

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    waste landfill Printer-friendly icon Printer-Friendly June 29, 2007 Agencies complete comprehensive investigation for radioactive and hazardous waste landfill; agree to extend document submittal milestone The U.S. Department of Energy (DOE), Idaho Department of Environmental Quality (IDEQ), and U.S. Environmental Protection Agency (EPA) have completed a CERCLA (Superfund) Remedial Investigation and Baseline Risk Assessment and Feasibility Study of a radioactive and hazardous waste landfill

  17. VULCAN celebrates completion and develops future plans (Journal Article) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect VULCAN celebrates completion and develops future plans Citation Details In-Document Search Title: VULCAN celebrates completion and develops future plans No abstract prepared. Authors: Ekkebus, Allen E [1] + Show Author Affiliations ORNL Publication Date: 2010-01-01 OSTI Identifier: 988719 DOE Contract Number: DE-AC05-00OR22725 Resource Type: Journal Article Resource Relation: Journal Name: Neutron News; Journal Volume: 21; Journal Issue: 3 Research Org: Oak Ridge National

  18. Method of forming a joint

    DOE Patents [OSTI]

    Butt, Darryl Paul; Cutler, Raymond Ashton; Rynders, Steven Walton; Carolan, Michael Francis

    2006-08-22

    A method of joining at least two sintered bodies to form a composite structure, including providing a first multicomponent metallic oxide having a perovskitic or fluorite crystal structure; providing a second sintered body including a second multicomponent metallic oxide having a crystal structure of the same type as the first; and providing at an interface a joint material containing at least one metal oxide containing at least one metal identically contained in at least one of the first and second multicomponent metallic oxides. The joint material is free of cations of Si, Ge, Sn, Pb, P and Te and has a melting point below the sintering temperatures of both sintered bodies. The joint material is heated to a temperature above the melting point of the metal oxide(s) and below the sintering temperatures of the sintered bodies to form the joint. Structures containing such joints are also disclosed.

  19. Unsplit bipolar pulse forming line

    DOE Patents [OSTI]

    Rhodes, Mark A.

    2011-05-24

    A bipolar pulse forming transmission line module and system for linear induction accelerators having first, second, third, and fourth planar conductors which form a sequentially arranged interleaved stack having opposing first and second ends, with dielectric layers between the conductors. The first and second planar conductors are connected to each other at the first end, and the first and fourth planar conductors are connected to each other at the second end via a shorting plate. The third planar conductor is electrically connectable to a high voltage source, and an internal switch functions to short at the first end a high voltage from the third planar conductor to the fourth planar conductor to produce a bipolar pulse at the acceleration axis with a zero net time integral. Improved access to the switch is enabled by an aperture through the shorting plate and the proximity of the aperture to the switch.

  20. Method of forming calthrate ice

    DOE Patents [OSTI]

    Hino, T.; Gorski, A.J.

    1985-09-30

    A method of forming clathrate ice in a supercooled water-based liquid contained in a vessel is disclosed. Initially, an oscillator device is located in the liquid in the vessel. The oscillator device is then oscillated ultransonically so that small crystals are formed in the liquid. Thes small crystals serve as seed crystals for ice formation in the liquid and thereby prevent supercooling of the liquid. Preferably, the oscillating device is controlled by a thermostat which initiates operation of the oscillator device when the temperature of the liquid is lowered to the freezing point. Thereafter, the operation of the oscillator device is terminated when ice is sensed in the liquid by an ice sensor.

  1. Method of forming clathrate ice

    DOE Patents [OSTI]

    Hino, Toshiyuki (Tokyo, JP); Gorski, Anthony J. (Lemont, IL)

    1987-01-01

    A method of forming clathrate ice in a supercooled water-based liquid contained in a vessel is disclosed. Initially, an oscillator device is located in the liquid in the vessel. The oscillator device is then oscillated ultrasonically so that small crystals are formed in the liquid. These small crystals serve as seed crystals for ice formation in the liquid and thereby prevent supercooling of the liquid. Preferably, the oscillating device is controlled by a thermostat which initiates operation of the oscillator device when the temperature of the liquid is lowered to the freezing point. Thereafter, the operation of the oscillator device is terminated when ice is sensed in the liquid by an ice sensor.

  2. PURPOSE FORM INSTRUCTIONS Item Description

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PURPOSE FORM INSTRUCTIONS Item Description 1 Enter inclusive dates of current reporting period. 2 Enter the official contract title. 3 Enter the official contract number. 4 Enter the name and address of each subcontractor. Subcontractors are to be grouped by state. 5 Enter ZIP code plus the 4-digit ZIP code extension. 6 Enter the subcontractor's business type (i.e. Academia, Industry, National Lab, Non-Profit Organization, State, or Other). 7 Enter the subcontractor's business classification

  3. DOE Form 1332.4

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 DOE F 243.2 Records Scheduling Request PDF icon DOE F 243 2 Records Scheduling Request Form (1).pdf More Documents & Publications DOE F 243.5 Electronic Recordkeeping System Questionnaire DOE F 243.5 Electronic Recordkeeping System Questionnaire Records Management Handbook Energy

    5 Electronic Recordkeeping System Questionnaire DOE F 243.5 Electronic Recordkeeping System Questionnaire PDF icon DOE F 243.5 Electronic Recordkeeping System Questionnaire.pdf More Documents &

  4. Chevron, GE form Technology Alliance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chevron, GE form Technology Alliance February 3, 2014 HOUSTON, TX, Feb. 3, 2014-Chevron Energy Technology Company and GE Oil & Gas announced today the creation of the Chevron GE Technology Alliance, which will develop and commercialize valuable technologies to solve critical needs for the oil and gas industry. The Alliance builds upon a current collaboration on flow analysis technology for oil and gas wells. It will leverage research and development from GE's newest Global Research Center,

  5. Rib forming tool for tubing

    DOE Patents [OSTI]

    Rowley, James P.; Lewandowski, Edward F.; Groh, Edward F.

    1976-01-01

    Three cylindrical rollers are rotatably mounted equidistant from the center of a hollow tool head on radii spaced 120.degree. apart. Each roller has a thin flange; the three flanges lie in a single plane to form an internal circumferential rib in a rotating tubular workpiece. The tool head has two complementary parts with two rollers in one part of the head and one roller in the other part; the two parts are joined by a hinge. A second hinge, located so the rollers are between the two hinges, connects one of the parts to a tool bar mounted in a lathe tool holder. The axes of rotation of both hinges and all three rollers are parallel. A hole exposing equal portions of the three roller flanges is located in the center of the tool head. The two hinges permit the tool head to be opened and rotated slightly downward, taking the roller flanges out of the path of the workpiece which is supported on both ends and rotated by the lathe. The parts of the tool head are then closed on the workpiece so that the flanges are applied to the workpiece and form the rib. The tool is then relocated for forming of the next rib.

  6. U.S. Department of Energy Categorical Exclusion Determination Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Categorical Exclusion Determination Form Proposed Action Title: Program or Field Office: Location(s) (City/County/State): Proposed Action Description: Categorical Exclusion(s) Applied: For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, including the full text of each categorical exclusion, see Subpart D of 10 CFR Part 1021. Regulatory Requirements in 10 CFR 1021.410(b): (See full text in regulation) The proposal fits within a class of actions

  7. U.S. Department of Energy Categorical Exclusion Determination Form

    National Nuclear Security Administration (NNSA)

    Categorical Exclusion Determination Form Proposed Action Title: Program or Field Office: Location(s) (City/County/State): Proposed Action Description: Categorical Exclusion(s) Applied: For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, including the full text of each categorical exclusion, see Subpart D of 10 CFR Part 1021. Regulatory Requirements in 10 CFR 1021.410(b): (See full text in regulation) The proposal fits within a class of actions

  8. FINAL MECHANICAL EXAMINATION FORM PS-6 Pressure System Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MECHANICAL EXAMINATION FORM PS-6 Pressure System Number: Pressure System Name: Design Authority: CHECK IF COMPLETE, N/A IF NOT APPLICABLE: Materials, components and products meet specifications and the requirements of engineering design Applicable procedures for assembly, glue bonding, etc. Assembly of threaded, bolted and other joints conforms to Code and engineering design Alignment, supports and/or cold spring meet engineering design Dimensional checks of components and materials meet Code

  9. DOE Emergency Special Needs Self-Identification Form

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Emergency Evacuation Employee Self-Identification Form In light of recent events, and to ensure the safety and security of DOE Headquarters' employees, the Engineering and Facilities Management Services Group is conducting a survey to identify those individuals who will require assistance when exiting the building during a site evacuation. Completion of this survey is voluntary. Any information provided will be kept confidential and shared only with those having assistance responsibilities under

  10. National Nuclear Security Administration Categorical Exclusion Determination Form

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration Categorical Exclusion Determination Form NEPA ID#: Proposed Action Title: Program or Field Office: Location(s) (City/County/State): Proposed Action Description: Categorical Exclusion(s) Applied: For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, including the full text of each categorical exclusion, see Subpart D of 10 CFR Part 1021. Regulatory Requirements in 10 CFR 1021.410(b): (See full text in

  11. Appendix B Landfill Inspection Forms and Survey Data

    Office of Legacy Management (LM)

    B Landfill Inspection Forms and Survey Data This page intentionally left blank This page intentionally left blank Original Landfill January 2012 Monthly Inspection-Attachment 1 The monthly inspection of the OLF was completed on January 30. The Rocky Flats Site only received .15 inches of precipitation during the month of January. The cover was dry at the time of the inspection. The slump in the East Perimeter Channel (EPC) remained unchanged. Berm locations that were re-graded during the OLF

  12. Department of Energy Completes Five Recovery Act Projects- Moves Closer to Completing Recovery Act Funded Work at Oak Ridge Site

    Broader source: Energy.gov [DOE]

    OAK RIDGE, Tenn. - The U.S. Department of Energy’s (DOE) Environmental Management (EM) program recently completed five projects at the Oak Ridge site funded through the American Recovery and Reinvestment Act.

  13. FORMING PROTECTIVE FILMS ON METAL

    DOE Patents [OSTI]

    Gurinsky, D.H.; Kammerer, O.F.; Sadofsky, J.; Weeks, J.R.

    1958-12-16

    Methods are described of inhibiting the corrosion of ferrous metal by contact with heavy liquid metals such as bismuth and gallium at temperatures above 500 icient laborato C generally by bringing nltrogen and either the metal zirconium, hafnium, or titanium into reactlve contact with the ferrous metal to form a thin adherent layer of the nitride of the metal and thereafter maintaining a fractional percentage of the metal absorbed in the heavy liquid metal in contact with the ferrous metal container. The general purpose for uslng such high boiling liquid metals in ferrous contalners would be as heat transfer agents in liquid-metal-fueled nuclear reactors.

  14. Complete genome sequence of Beutenbergia cavernae type strain (HKI 0122T)

    SciTech Connect (OSTI)

    Land, Miriam; Pukall, Rudiger; Abt, Birte; Goker, Markus; Rohde, Manfred; Glavina Del Rio, Tijana; Tice, Hope; Copeland, Alex; Cheng, Jan-Fang; Lucas, Susan; Chen, Feng; Nolan, Matt; Bruce, David; Goodwin, Lynne; Pitluck, Sam; Ivanova, Natalia; Mavrommatis, Konstantinos; Ovchinnikova, Galina; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Hauser, Loren; Chang, Yun-Juan; Jefferies, Cynthia C.; Saunders, Elizabeth; Brettin, Thomas; Detter, John C.; Han, Cliff; Chain, Patrick; Bristow, James; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C.; Klenk, Hans-Peter; Lapidus, Alla

    2009-05-20

    Beutenbergia cavernae (Groth et al. 1999) is the type species of the genus and is of phylogenetic interest because of its isolated location in the actinobacterial suborder Micrococcineae. B. cavernae HKI 0122T is a Gram-positive, non-motile, non-spore-forming bacterium isolated from a cave in Guangxi (China). B. cavernae grows best under aerobic conditions and shows a rod-coccus growth cycle. Its cell wall peptidoglycan contains the diagnostic L-lysine - L-glutamate interpeptide bridge. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first completed genome sequence from the poorly populated micrococcineal family Beutenbergiaceae, and this 4,669,183 bp long single replicon genome with its 4225 protein-coding and 53 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  15. Complete genome sequence of Coraliomargarita akajimensis type strain (04OKA010-24T)

    SciTech Connect (OSTI)

    Mavromatis, Konstantinos; Abt, Birte; Brambilla, Evelyne; Lapidus, Alla; Copeland, Alex; Desphande, Shweta; Nolan, Matt; Lucas, Susan; Tice, Hope; Cheng, Jan-Fang; Han, Cliff; Detter, John C.; Woyke, Tanja; Goodwin, Lynne; Pitluck, Sam; Held, Brittany; Brettin, Thomas; Tapia, Roxanne; Ivanova, Natalia; Mikhailova, Natalia; Pati, Amrita; Liolios, Konstantinos; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Hauser, Loren; Chang, Yun-Juan; Jeffries, Cynthia D.; Rohde, Manfred; Gö ker, Markus; Bristow, James; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Klenk, Hans-Peter; Kyrpides, Nikos C.

    2010-06-25

    Coraliomargarita akajimensis Yoon et al. 2007 the type species of the genus Coraliomargarita. C. akajimensis is an obligately aerobic, Gram-negative, non-spore-forming, non-motile, spherical bacterium which was isolated from seawater surrounding the hard coral Galaxea fascicularis. C. akajimensis organism is of special interest because of its phylogenetic position in a genomically purely studied area in the bacterial diversity. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of a member of the family Puniceicoccaceae. The 3,750,771 bp long genome with its 3,137 protein-coding and 55 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  16. Subjective surfaces: a geometric model for boundary completion

    SciTech Connect (OSTI)

    Sarti, Alessandro; Malladi, Ravi; Sethian, J.A.

    2000-06-01

    We present a geometric model and a computational method for segmentation of images with missing boundaries. In many situations, the human visual system fills in missing gaps in edges and boundaries, building and completing information that is not present. Boundary completion presents a considerable challenge in computer vision, since most algorithms attempt to exploit existing data. A large body of work concerns completion models, which postulate how to construct missing data; these models are often trained and specific to particular images. In this paper, we take the following, alternative perspective: we consider a reference point within an image as given, and then develop an algorithm which tries to build missing information on the basis of the given point of view and the available information as boundary data to the algorithm. Starting from this point of view, a surface is constructed. It is then evolved with the mean curvature flow in the metric induced by the image until a piecewise constant solution is reached. We test the computational model on modal completion, amodal completion, texture, photo and medical images. We extend the geometric model and the algorithm to 3D in order to extract shapes from low signal/noise ratio medical volumes. Results in 3D echocardiography and 3D fetal echography are presented.

  17. Integrally formed radio frequency quadrupole

    DOE Patents [OSTI]

    Abbott, Steven R.

    1989-01-01

    An improved radio frequency quadrupole (10) is provided having an elongate housing (11) with an elongate central axis (12) and top, bottom and two side walls (13a-d) symmetrically disposed about the axis, and vanes (14a-d) formed integrally with the walls (13a-d), the vanes (14a-d) each having a cross-section at right angles to the central axis (12) which tapers inwardly toward the axis to form electrode tips (15a-d) spaced from each other by predetermined distances. Each of the four walls (13a-d), and the vanes (14a-d) integral therewith, is a separate structural element having a central lengthwise plane (16) passing through the tip of the vane, the walls (13a-d) having flat mounting surfaces (17, 18) at right angles to and parallel to the control plane (16), respectively, which are butted together to position the walls and vane tips relative to each other.

  18. Complete genome sequence of Cellulomonas flavigena type strain (134T)

    SciTech Connect (OSTI)

    Abt, Birte; Foster, Brian; Lapidus, Alla L.; Clum, Alicia; Sun, Hui; Pukall, Rudiger; Lucas, Susan; Glavina Del Rio, Tijana; Nolan, Matt; Tice, Hope; Cheng, Jan-Fang; Pitluck, Sam; Liolios, Konstantinos; Ivanova, N; Mavromatis, K; Ovchinnikova, Galina; Pati, Amrita; Goodwin, Lynne A.; Chen, Amy; Palaniappan, Krishna; Land, Miriam L; Hauser, Loren John; Chang, Yun-Juan; Jeffries, Cynthia; Rohde, Manfred; Goker, Markus; Woyke, Tanja; Bristow, James; Eisen, Jonathan; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter

    2010-01-01

    Cellulomonas flavigena (Kellerman and McBeth 1912) Bergey et al. 1923 is the type species of the genus Cellulomonas of the actinobacterial family Cellulomonadaceae. Members of the genus Cellulomonas are of special interest for their ability to degrade cellulose and hemicellulose, particularly with regard to the use of biomass as an alternative energy source. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of a member of the genus Cellulomonas, and next to the human pathogen Tropheryma whipplei the second complete genome sequence within the actinobacterial family Cellulomonadaceae. The 4,123,179 bp long single replicon genome with its 3,735 protein-coding and 53 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  19. K-25 West Wing Demolition Completed | Department of Energy

    Energy Savers [EERE]

    West Wing Demolition Completed K-25 West Wing Demolition Completed January 28, 2010 - 12:00pm Addthis OAK RIDGE, Tenn. - Thirteen months after demolition began, the final unit of the K-25 Building West Wing was taken down on January 20. Demolition of the 844,000 square foot structure began on December 16, 2008. A significant amount of debris remains to be size-reduced and shipped to the Environmental Management Waste Management Facility (EMWMF) in Oak Ridge, but demolition of the wing is

  20. Celebrating the Completion of the World's Largest Concentrating Solar Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Plant | Department of Energy the Completion of the World's Largest Concentrating Solar Power Plant Celebrating the Completion of the World's Largest Concentrating Solar Power Plant February 13, 2014 - 9:21am Addthis Aerial view, Ivanpah 1 of 5 Aerial view, Ivanpah An aerial view of the Ivanpah Solar Power Facility at sunrise, with left to right Tower 1, 2 and 3. Image: Gilles Mingasson/Getty Images for Bechtel Harnessing the Power of the Sun 2 of 5 Harnessing the Power of the Sun The top of

  1. Evaluate disposable sample chips and complete the (Technical Report) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Evaluate disposable sample chips and complete the Citation Details In-Document Search Title: Evaluate disposable sample chips and complete the Letter Report detailing plastic sample chip design Authors: Julia Tripp Publication Date: 2013-04-01 OSTI Identifier: 1091352 Report Number(s): INL/EXT-13-28796 DOE Contract Number: DE-AC07-05ID14517 Resource Type: Technical Report Research Org: Idaho National Laboratory (INL) Sponsoring Org: DOE - NE Country of Publication: United

  2. Evaluate disposable sample chips and complete the (Technical Report) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Evaluate disposable sample chips and complete the Citation Details In-Document Search Title: Evaluate disposable sample chips and complete the × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this document is also

  3. Idaho Cleanup Project grows its workforce to complete ARRA work

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Idaho Cleanup Project grows its workforce to complete ARRA work CWI President and CEO John Fulton greets newly hired ICP employees at a June orientation session in Idaho Falls. Over a hundred new faces have already joined the Idaho Cleanup Project (ICP) workforce, both in offices and at work sites across DOE's Idaho Site. The ICP is ramping up its workforce to complete new work scope assigned to the ICP under the American Recovery and Reinvestment Act (ARRA). As of June 27, 143 new workers have

  4. Idaho Workers Complete Last of Transuranic Waste Transfers Funded by

    Office of Environmental Management (EM)

    the Risk along the Columbia River | Department of Energy Highly Radioactive Sludge Removal Complete: Historic Cleanup Effort Reduces the Risk along the Columbia River Highly Radioactive Sludge Removal Complete: Historic Cleanup Effort Reduces the Risk along the Columbia River September 13, 2012 - 12:00pm Addthis Media Contacts Cameron Salony, DOE Cameron.Salony@rl.doe.gov 509-376-0402 Dee Millikin, CH2M HILL Plateau Remediation Company Dee_Millikin@rl.gov 509-376-1297 RICHLAND, WASH. - The

  5. DOE Completes Large-Scale Carbon Sequestration Project Awards | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Large-Scale Carbon Sequestration Project Awards DOE Completes Large-Scale Carbon Sequestration Project Awards November 17, 2008 - 4:58pm Addthis Regional Partner to Demonstrate Safe and Permanent Storage of 2 Million Tons of CO2 at Wyoming Site WASHINGTON, DC - Completing a series of awards through its Regional Carbon Sequestration Partnership Program, the U.S. Department of Energy (DOE) today awarded $66.9 million to the Big Sky Regional Carbon Sequestration Partnership for the

  6. Complete genome sequence of Gordonia bronchialis type strain (3410T)

    SciTech Connect (OSTI)

    Ivanova, N; Sikorski, Johannes; Jando, Marlen; Lapidus, Alla L.; Nolan, Matt; Glavina Del Rio, Tijana; Tice, Hope; Copeland, A; Cheng, Jan-Fang; Chen, Feng; Bruce, David; Goodwin, Lynne A.; Pitluck, Sam; Mavromatis, K; Ovchinnikova, Galina; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam L; Hauser, Loren John; Chang, Yun-Juan; Jeffries, Cynthia; Chain, Patrick S. G.; Saunders, Elizabeth H; Han, Cliff; Detter, J C; Brettin, Thomas S; Rohde, Manfred; Goker, Markus; Bristow, James; Eisen, Jonathan; Markowitz, Victor; Hugenholtz, Philip; Klenk, Hans-Peter; Kyrpides, Nikos C

    2010-01-01

    Gordonia bronchialis Tsukamura 1971 is the type species of the genus. G. bronchialis is a human-pathogenic organism that has been isolated from a large variety of human tissues. Here we describe the features of this organism, together with the complete genome sequence and annotation. This is the first completed genome sequence of the family Gordoniaceae. The 5,290,012 bp long genome with its 4,944 protein-coding and 55 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  7. NSC completes last part to facilitate relocation | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Blog NSC completes last part to facilitate relocation Wednesday, May 28, 2014 - 4:04pm This month, employees at the National Security Campus in Kansas City, Mo., are celebrating the completion of the last "build ahead" part needed to maintain their 99.9 percent on-time delivery record during one of the nation's largest industrial moves. More than 275 unique part numbers encompassing 20,000 components were built in advance to ensure uninterrupted deliveries

  8. Y-12 National Security Complex Completes W69 Dismantlement | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration fieldoffices / Welcome to the NNSA Production Office / NPO News Releases Y-12 National Security Complex Completes W69 Dismantlement February 26, 2016 Click here for a larger image OAK RIDGE, Tenn. -- Dismantlement of W69 canned subassemblies (CSAs) has been completed at the Y-12 National Security Complex. The W69 was the warhead for the short-range attack missile (SRAM) and was retired from the U.S. nuclear stockpile in 1992. The last W69 weapon was dismantled

  9. 2010sr27[cooling_tower_complete].doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Friday, September 17, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov K Cooling Tower Project Reaches Completion Aiken, S.C. - One of the most visual milestones of cleanup projects underway within the Department of Energy's Office of Environmental Management was the demolition of the K-Reactor Cooling Tower at the Savannah River Site (SRS). Now, this American Recovery and Reinvestment Act project has been completed one month ahead of schedule, with debris

  10. EM's Los Alamos TRU Waste Campaign Heads Toward Completion | Department

    Office of Environmental Management (EM)

    Mercury-Contaminated Soil | Department of Energy Site Completes Canyon-Side Cleanup of Mercury-Contaminated Soil EM's Los Alamos Site Completes Canyon-Side Cleanup of Mercury-Contaminated Soil July 28, 2015 - 12:00pm Addthis A spider excavator extracts mercury-contaminated soil. A spider excavator extracts mercury-contaminated soil. Workers position a crane above the project site. Workers position a crane above the project site. A waste container is loaded for off-site disposal. A waste

  11. F Reactor Area Cleanup Complete | Department of Energy

    Office of Environmental Management (EM)

    F Reactor Area Cleanup Complete F Reactor Area Cleanup Complete September 19, 2012 - 12:00pm Addthis Media Contact Cameron Hardy, DOE Cameron.Hardy@rl.doe.gov 509-376-5365 RICHLAND, Wash. - U.S. Department of Energy (DOE) contractors have cleaned up the F Reactor Area, the first reactor area at the Hanford Site in southeastern Washington state to be fully remediated. While six of Hanford's nine plutonium production reactors have been sealed up, or cocooned, the F Reactor Area is the first to

  12. Complete genome sequence of Acidimicrobium ferrooxidans type strain (ICPT)

    SciTech Connect (OSTI)

    Clum, Alicia; Nolan, Matt; Lang, Elke; Glavina Del Rio, Tijana; Tice, Hope; Copeland, Alex; Cheng, Jan-Fang; Lucas, Susan; Chen, Feng; Bruce, David; Goodwin, Lynne; Pitluck, Sam; Ivanova, Natalia; Mavrommatis, Konstantinos; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Goker, Markus; Spring, Stefan; Land, Miriam; Hauser, Loren; Chang, Yun-Juan; Jefferies, Cynthia C.; Chain, Patrick; Bristow, James; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C.; Klenk, Hans-Peter; Lapidus, Alla

    2009-05-20

    Acidimicrobium ferrooxidans (Clark and Norris 1996) is the sole and type species of the genus, which until recently was the only genus within the actinobacterial family Acidimicrobiaceae and in the order Acidomicrobiales. Rapid oxidation of iron pyrite during autotrophic growth in the absence of an enhanced CO2 concentration is characteristic for A. ferrooxidans. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of the order Acidomicrobiales, and the 2,158,157 bp long single replicon genome with its 2038 protein coding and 54 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  13. Miscellaneous Waste-Form FEPs

    SciTech Connect (OSTI)

    A. Schenker

    2000-12-08

    The US DOE must provide a reasonable assurance that the performance objectives for the Yucca Mountain Project (YMP) potential radioactive-waste repository can be achieved for a 10,000-year post-closure period. The guidance that mandates this direction is under the provisions of 10 CFR Part 63 and the US Department of Energy's ''Revised Interim Guidance Pending Issuance of New US Nuclear Regulatory Commission (NRC) Regulations (Revision 01, July 22, 1999), for Yucca Mountain, Nevada'' (Dyer 1999 and herein referred to as DOE's Interim Guidance). This assurance must be demonstrated in the form of a performance assessment that: (1) identifies the features, events, and processes (FEPs) that might affect the performance of the potential geologic repository; (2) examines the effects of such FEPs on the performance of the potential geologic repository; (3) estimates the expected annual dose to a specified receptor group; and (4) provides the technical basis for inclusion or exclusion of specific FEPs.

  14. Alumina forming iron base superalloy

    DOE Patents [OSTI]

    Yamamoto, Yukinori; Muralidharan, Govindarajan; Brady, Michael P.

    2014-08-26

    An austenitic stainless steel alloy, consists essentially of, in weight percent 2.5 to 4 Al; 25 to 35 Ni; 12 to 19 Cr; at least 1, up to 4 total of at least one element selected from the group consisting of Nb and Ta; 0.5 to 3 Ti; less than 0.5 V; 0.1 to 1 of at least on element selected from the group consisting of Zr and Hf; 0.03 to 0.2 C; 0.005 to 0.1 B; and base Fe. The weight percent Fe is greater than the weight percent Ni. The alloy forms an external continuous scale including alumina, and contains coherent precipitates of .gamma.'-Ni.sub.3Al, and a stable essentially single phase FCC austenitic matrix microstructure. The austenitic matrix is essentially delta-ferrite-free and essentially BCC-phase-free.

  15. Low-level radioactive waste form qualification testing

    SciTech Connect (OSTI)

    Sohal, M.S.; Akers, D.W.

    1998-06-01

    This report summarizes activities that have already been completed as well as yet to be performed by the Idaho National Engineering and Environmental Laboratory (INEEL) to develop a plan to quantify the behavior of radioactive low-level waste forms. It briefly describes the status of various tasks, including DOE approval of the proposed work, several regulatory and environmental related documents, tests to qualify the waste form, preliminary schedule, and approximate cost. It is anticipated that INEEL and Brookhaven National Laboratory will perform the majority of the tests. For some tests, services of other testing organizations may be used. It should take approximately nine months to provide the final report on the results of tests on a waste form prepared for qualification. It is anticipated that the overall cost of the waste quantifying service is approximately $150,000. The following tests are planned: compression, thermal cycling, irradiation, biodegradation, leaching, immersion, free-standing liquid tests, and full-scale testing.

  16. Voluntary Self-Identification of Disability Form CC-305 OMB Control Number 1250-0005

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Voluntary Self-Identification of Disability Form CC-305 OMB Control Number 1250-0005 Expires 1/31/2017 Page 1 of 2 Why are you being asked to complete this form? Because we do business with the government, we must reach out to, hire, and provide equal opportunity to qualified people with disabilities. i To help us measure how well we are doing, we are asking you to tell us if you have a disability or if you ever had a disability. Completing this form is voluntary, but we hope that you will

  17. University of Regina researchers complete milestone in major international

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    physics project at JLab (University of Regina) | Jefferson Lab researchers complete milestone in major international physics project at JLab (University of Regina) External Link: http://www.uregina.ca/external/communications/releases/current/nr-03232012.html By jlab_admin on Fri, 2012-03-23

  18. EM’s Paducah Site Completes Building Removals

    Broader source: Energy.gov [DOE]

    PADUCAH, Ky. – EM recently completed demolition of the last of 32 inactive facilities to be removed as part of the cleanup scope that existed before commercial uranium enrichment operations ended at the Paducah Gaseous Diffusion Plant and the plant facilities were returned to DOE.

  19. Complete genome sequences for the anaerobic, extremely thermophilic plant

    Office of Scientific and Technical Information (OSTI)

    biomass-degrading bacteria Caldicellulosiruptor hydrothermalis, Caldicellulosiruptor kristjanssonii, Caldicellulosiruptor kronotskyensis, Caldicellulosiruptor owensenis, and Caldicellulosiruptor lactoaceticus (Journal Article) | SciTech Connect Complete genome sequences for the anaerobic, extremely thermophilic plant biomass-degrading bacteria Caldicellulosiruptor hydrothermalis, Caldicellulosiruptor kristjanssonii, Caldicellulosiruptor kronotskyensis, Caldicellulosiruptor owensenis, and

  20. Reduce completion fluid costs with on-site brine tests

    SciTech Connect (OSTI)

    Thomas, D.C.; Darlington, R.K.; Kinney, W.R.; Lowell, J.L.

    1982-09-01

    A newly developed field kit makes on-site brine completion fluid testing practical. Simple titration procedures are used to analyze brine for calcium, zinc, chloride and bromide with an accuracy and repeatability that compares favorably with expensive laboratory techniques. This article describes the field testing theory and details analytical procedures used.