Powered by Deep Web Technologies
Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism  

NLE Websites -- All DOE Office Websites (Extended Search)

Unexpected Angular Dependence of Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Print Wednesday, 29 August 2007 00:00 Using spectroscopic information for magnetometry and magnetic microscopy obviously requires detailed theoretical understanding of spectral shape and magnitude of dichroism signals. A research team at ALS Beamline 4.0.2 has now shown unambiguously that, contrary to common belief, spectral shape and magnitude of x-ray magnetic linear dichroism (XMLD) are not only determined by the relative orientation of magnetic moments and x-ray polarization, but their orientation relative to the crystallographic axes must be taken into account for accurate interpretation of XMLD data. Magnetism and X Rays


Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism  

NLE Websites -- All DOE Office Websites (Extended Search)

Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Print Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Print Using spectroscopic information for magnetometry and magnetic microscopy obviously requires detailed theoretical understanding of spectral shape and magnitude of dichroism signals. A research team at ALS Beamline 4.0.2 has now shown unambiguously that, contrary to common belief, spectral shape and magnitude of x-ray magnetic linear dichroism (XMLD) are not only determined by the relative orientation of magnetic moments and x-ray polarization, but their orientation relative to the crystallographic axes must be taken into account for accurate interpretation of XMLD data. Magnetism and X Rays The ancient Greeks and also the Chinese knew about strange and rare stones with the power to attract iron. Moreover, when freely suspended these objects pointed north-south. Throughout the past, we have used this phenomenon-magnetism-for navigation and more recently for power production and digital information storage, all while trying to explore and understand its origins. In 1986 researchers at a facility similar to the ALS observed for the first time that the absorption of x rays depends not only on the composition of a material-that is, if it contains iron, nickel, or other elements-but also on its magnetism. The effect is unique in that it allows us to distinguish which atomic species magnetism originates from and provides information about their local atomic environment-for example, whether a magnetic species is surrounded by 4 or 6 oxygen atoms. A research team at the ALS has now shown that the relationship between magnetic order and absorption of x rays is even more complex and exciting than has been assumed for the past 20 years, leading to a reassessment of previous results.


Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism  

NLE Websites -- All DOE Office Websites (Extended Search)

Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Print Unexpected Angular Dependence of X-Ray Magnetic Linear Dichroism Print Using spectroscopic information for magnetometry and magnetic microscopy obviously requires detailed theoretical understanding of spectral shape and magnitude of dichroism signals. A research team at ALS Beamline 4.0.2 has now shown unambiguously that, contrary to common belief, spectral shape and magnitude of x-ray magnetic linear dichroism (XMLD) are not only determined by the relative orientation of magnetic moments and x-ray polarization, but their orientation relative to the crystallographic axes must be taken into account for accurate interpretation of XMLD data. Magnetism and X Rays The ancient Greeks and also the Chinese knew about strange and rare stones with the power to attract iron. Moreover, when freely suspended these objects pointed north-south. Throughout the past, we have used this phenomenon-magnetism-for navigation and more recently for power production and digital information storage, all while trying to explore and understand its origins. In 1986 researchers at a facility similar to the ALS observed for the first time that the absorption of x rays depends not only on the composition of a material-that is, if it contains iron, nickel, or other elements-but also on its magnetism. The effect is unique in that it allows us to distinguish which atomic species magnetism originates from and provides information about their local atomic environment-for example, whether a magnetic species is surrounded by 4 or 6 oxygen atoms. A research team at the ALS has now shown that the relationship between magnetic order and absorption of x rays is even more complex and exciting than has been assumed for the past 20 years, leading to a reassessment of previous results.


Experimental study of linear magnetic dichroism in photoionization satellite transitions of atomic rubidium  

SciTech Connect

Laser orientation in the initial state has been used to study the properties of satellite transitions in inner-shell photoionization of rubidium atoms. The linear magnetic dichroism in the angular distribution (LMDAD) has been utilized to probe the continuum waves of orbital angular momentum conserving monopole, and angular momentum changing conjugate satellites, accompanying the 4p ionization of atomic Rb. We show experimentally that LMDAD of both types of satellite transitions is nonzero and that LMDAD of monopole satellites, measured as a function of photon energy, mimics the LMDAD of direct photoionization, whereas the LMDAD of conjugate transitions deviates drastically from that trend. The results indicate that conjugate transitions cannot be described theoretically without explicit inclusion of electron-electron interaction. The present data can thus be used as a very precise test of current models for photoionization.

Jaenkaelae, K. [Department of Physics, P.O. Box 3000, 90014 University of Oulu, Oulu (Finland); Alagia, M. [CNR-IOM, Laboratorio TASC, IT-34149 Trieste (Italy); Feyer, V.; Richter, R. [Sincrotrone Trieste, Area Science Park, IT-34149 Trieste (Italy); Prince, K. C. [Sincrotrone Trieste, Area Science Park, IT-34149 Trieste (Italy); CNR-IOM, Laboratorio TASC, IT-34149 Trieste (Italy)



Effects of symmetry on circular and linear magnetic dichroism in angle-resolved photoemission spectra of Gd/Y (0001) and Fe-Ni//Cu (001)  

SciTech Connect

We have observed circular and linear magnetic dichroism in angle- resolved photoemission spectra of 50-monolayer Gd film grown on Y(0001) and 6-monolayer Fe-Ni alloy films grown on Cu(001). The 4f level of Gd and the Fe 3p level of the Fe-Ni alloy were measured. A different geometry was used for the magnetic circular dichroism than was used to measure the magnetic linear dichroism. The geometries were chosen so that the shape of the magnetic circular dichroism is predicted to be equal to the shape of the magnetic linear dichroism for four-fold symmetric Fe-Ni/Cu(001) but not for three-fold symmetric Gd/Y(0001). Experimental results are presented. In this paper we examine the effect of symmetry (experimental geometry and sample geometry) on magnetic linear and circular dichroism in angle- resolved photoemission. In particular we chose separate geometries for measuring magnetic circular and magnetic linear dichroism. The geometries were chosen such that samples with four-fold symmetry about the sample normal may have magnetic circular and magnetic linear dichroism of the same shape. But samples with three-fold symmetry should not exhibit circular and magnetic linear dichroism of the same shape. The samples studied are three-fold symmetric Gd films grown on Y(0001) and four-fold symmetric Fe-Ni alloy grown on Cu(001). After presenting the methods of the experiment, we briefly review parts of a model of magnetic dichroism developed by Venus and coworkers and our specialization and extension of it, particularly for FeNi/Cu(001). We then show the results of our measurements.

Goodman, K.W.; Tobin, J.G.; Schumann, F.O. [Pennsylvania State Univ., University Park, PA (United States); Willis, R.F. [Pennsylvania State Univ., University Park, PA (United States); Gammon, J.W. [Virginia Commonwealth Univ., Richmond, VA (United States); Pappas, D.P. [Virginia Commonwealth Univ., Richmond, VA (United States); Kortright, J.B. [Lawrence Berkeley National Lab., CA (United States); Denlinger, J.D. [Lawrence Berkeley National Lab., CA (United States); Rotenberg, E. [Lawrence Berkeley National Lab., CA (United States); Warwick, A. [Lawrence Berkeley National Lab., CA (United States); Smith, N.V. [Lawrence Berkeley National Lab., CA (United States)



Magneto-optical granulometry: on the determination of the statistics of magnetically induced particle chains in concentrated ferrofluids from linear dichroism experiments  

E-Print Network (OSTI)

An analytical theoretical model for the influence of the magnetically induced nanoparticle chaining on the linear dichroism in ferrofluids was developed. The model is based on a statistical theory for magnetic nanoparticle chaining in ferrofluids. Together with appropriate experimental approach and data processing strategy, the model grounds a magneto-optical granulometry method able to determine the magnetic field dependence of the statistics of magnetically induced particle chains in concentrated ferrofluids.

V. Socoliuc; L. B. Popescu



Linear dichroism and resonant photoemission in Gd 011  

SciTech Connect

Magnetic Linear Dichroism in Angular Distributions (MLDAD) from Photoelectron Emission was used to probe the nature of Resonant Photoemission. Gd 5p and Gd 4f emission were investigated. Using novel theoretical simulations, we were able to show that temporal matching is a requirement for ``True`` Resonant Photoemission, where the Resonant Photoemission retains the characteristics of Photoelectron Emission.

Mishra, S.R.; Cummins, T.R.; Gammon, W.J.; van der Laan, G.; Goodman, K.W.; Tobin, J.G.



Comparison of magnetic linear dichroism in 4f photoemission and 4d{endash}4f photoemission from Gd on Y(0001)  

SciTech Connect

Magnetic linear dichroism (MLD) in 4d{endash}4f resonant and 4f nonresonant photoemission (PE) is studied from thin epitaxial gadolinium films. In an angle resolved and high-energy resolution mode, experiments were conducted with the electric-field vector of the incident light perpendicular to the sample magnetization. Our results show a significant difference in behavior of MLD in resonant PE as compared to that in nonresonant PE. Off-resonance, the MLD signal is dominated by a negative feature at the low binding energy side of the peak. Near the 4d{endash}4f resonance maximum, the MLD displays a plus{endash}minus shape, with a negative signal at the low binding energy side of the 4f peak and a positive signal at the high binding energy side. Analysis of MLD in 4d{endash}4f resonant PE may provide insight into interactions of the 4d core hole with the 4f core level in the intermediate state. {copyright} {ital 1997 American Vacuum Society.}

Gammon, W.J.; Mishra, S.R.; Pappas, D.P. [Department of Physics, Virginia Commonwealth University, Richmond, Virginia 23284-2000 (United States)] [Department of Physics, Virginia Commonwealth University, Richmond, Virginia 23284-2000 (United States); Goodman, K.W.; Tobin, J.G. [Lawrence Livermore National Laboratory, Lawrence Livermore, California 93550 (United States)] [Lawrence Livermore National Laboratory, Lawrence Livermore, California 93550 (United States); Schumann, F.O.; Willis, R. [Department of Physics, Pennsylvania State University, University Park, Pennsylvania 16802 (United States)] [Department of Physics, Pennsylvania State University, University Park, Pennsylvania 16802 (United States); Denlinger, J.D.; Rotenberg, E.; Warwick, A.; Smith, N.V. [Advanced Light Source, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States)] [Advanced Light Source, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States)



Magnetic Dichroism Spectromicroscopy at SPEAR3  

NLE Websites -- All DOE Office Websites (Extended Search)

Dichroism Absorption Microscopy and Spectroscopy at the SSRL Dichroism Absorption Microscopy and Spectroscopy at the SSRL XDSM Examples X-ray absorption spectroscopy (XAS) utilizes the energy dependent absorption of x-rays to obtain information about the elemental composition of the sample and the chemical environment of each element (see also NEXAFS Spectroscopy). Typically XAS is measured by detecting the intensity of an x-ray beam before and after it is transmitted through a sample. This approach provides information about bulk properties. However, one can also achieve excellent sensitivity to interfaces, buried layers and diluted impurities or dopants by detecting electrons or photons that are emitted from the sample due to secondary processes instead. Finally, one can employ the polarization dependence of the x-ray absorption process


Linear chain magnetism  

Science Journals Connector (OSTI)

Linear chain magnetism ... A brief introduction to this concept, which is also called lower dimensional magnetism. ...

Richard L. Carlin



X-ray magnetic circular dichroism in (Ge,Mn) compounds: experiments and modeling Samuel Tardif,1, 2,  

E-Print Network (OSTI)

X-ray magnetic circular dichroism in (Ge,Mn) compounds: experiments and modeling Samuel Tardif,1, 2: July 29, 2013) X-ray absorption (XAS) and x-ray magnetic circular dichroism (XMCD) spectra at the L2),6 and x-ray spectroscopy (x-ray absorption spec- troscopy, XAS, and x-ray magnetic circular


Magnetic dichroism in valence-band x-ray photoemission spectroscopy  

Science Journals Connector (OSTI)

A fully relativistic description of spin-resolved valence-band x-ray photoemission spectroscopy (VB-XPS) of magnetic solids is presented that is based on multiple scattering theory. This approach allows us to investigate possible magnetic dichroism in VB-XPS. As is demonstrated by results for CoxPt1-x, application to disordered alloys is straightforward within the framework of the coherent potential approximation alloy theory. The spin-integrated spectra for unpolarized radiation were found to be in very satisfying agreement with corresponding experimental data. For the spin-resolved spectra a pronounced magnetic circular dichroism is predicted that should be easily observed.

H. Ebert and J. Schwitalla



Theoretical description of field-induced magnetic circular x-ray dichroism in nonmagnetic solids  

Science Journals Connector (OSTI)

It is demonstrated that the presence of an external magnetic field for a paramagnetic solid gives rise to a circular magnetic dichroism in x-ray dichroism (MCXD) in full analogy to the MCXD observed in ferromagnetic solids. It is shown that the conventional sum rules can be adopted for this situation to give access to the spin and orbital susceptibilities. Results of calculations for various transition metal systems demonstrate the applicability of the sum rules. In particular, for the alloy systems AgxPd1-x and AgxPt1-x use of the field induced MCXD should allow us to study in detail the Stoner enhancement of the spin susceptibility as well as the role of the orbital susceptibility of Pd and Pt, respectively.

S. Mankovsky and H. Ebert



Verification of Ni magnetic moment in GdNi2 Laves phase by magnetic circular dichroism measurement  

Science Journals Connector (OSTI)

Investigation of the magnetic moment of nickel in the polycrystal GdNi2 Laves phase was carried out by means of magnetic circular dichroism (MCD) in the core-level x-ray-absorption spectroscopy. It was revealed that the nickel magnetic moment originating from the 3d state (band) does exist and couples antiparallel to that of gadolinium whose MCD was observed at the M4,5 absorption edge. That is, nickel retains an intrinsic magnetic moment even in the Laves phase concentration. Furthermore, by analyzing in terms of sum rule, the contribution of spin and orbital magnetic moments to the magnetic moment was evaluated and discussed.

M. Mizumaki; K. Yano; I. Umehara; F. Ishikawa; K. Sato; A. Koizumi; N. Sakai; T. Muro



Nuclear spin circular dichroism  

SciTech Connect

Recent years have witnessed a growing interest in magneto-optic spectroscopy techniques that use nuclear magnetization as the source of the magnetic field. Here we present a formulation of magnetic circular dichroism (CD) due to magnetically polarized nuclei, nuclear spin-induced CD (NSCD), in molecules. The NSCD ellipticity and nuclear spin-induced optical rotation (NSOR) angle correspond to the real and imaginary parts, respectively, of (complex) quadratic response functions involving the dynamic second-order interaction of the electron system with the linearly polarized light beam, as well as the static magnetic hyperfine interaction. Using the complex polarization propagator framework, NSCD and NSOR signals are obtained at frequencies in the vicinity of optical excitations. Hartree-Fock and density-functional theory calculations on relatively small model systems, ethene, benzene, and 1,4-benzoquinone, demonstrate the feasibility of the method for obtaining relatively strong nuclear spin-induced ellipticity and optical rotation signals. Comparison of the proton and carbon-13 signals of ethanol reveals that these resonant phenomena facilitate chemical resolution between non-equivalent nuclei in magneto-optic spectra.

Vaara, Juha, E-mail: juha.vaara@iki.fi [NMR Research Group, Department of Physics, University of Oulu, P.O. Box 3000, FIN-90014 Oulu (Finland)] [NMR Research Group, Department of Physics, University of Oulu, P.O. Box 3000, FIN-90014 Oulu (Finland); Rizzo, Antonio [Istituto per i Processi Chimico-Fisici del Consiglio Nazionale delle Ricerche (IPCF-CNR), Area della Ricerca, via G. Moruzzi 1, I-56124 Pisa (Italy)] [Istituto per i Processi Chimico-Fisici del Consiglio Nazionale delle Ricerche (IPCF-CNR), Area della Ricerca, via G. Moruzzi 1, I-56124 Pisa (Italy); Kauczor, Joanna; Norman, Patrick [Department of Physics, Chemistry and Biology, Linköping University, S-58183 Linköping (Sweden)] [Department of Physics, Chemistry and Biology, Linköping University, S-58183 Linköping (Sweden); Coriani, Sonia, E-mail: coriani@units.it [Dipartimento di Scienze Chimiche e Farmaceutiche, Università degli Studi di Trieste, Via L. Giorgieri 1, I-34127 Trieste (Italy)] [Dipartimento di Scienze Chimiche e Farmaceutiche, Università degli Studi di Trieste, Via L. Giorgieri 1, I-34127 Trieste (Italy)



Magnetic dichroism in valence-band photoemission spectroscopy of disordered bcc FexCo1-x alloys  

Science Journals Connector (OSTI)

A fully relativistic calculation of spin-resolved valence-band photoemission spectra for bcc FexCo1-x alloys is presented that is based on the Korringa-Kohn-Rostoker coherent-potential approximation method of band-structure calculation. The result for the spin-integrated spectra for unpolarized radiation was found to be in very satisfying agreement with corresponding experimental data. For the spin-resolved spectra a pronounced magnetic circular dichroism is predicted that should be observable in a corresponding experiment.

S. Ostanin and H. Ebert



End station for nanoscale magnetic materials study: Combination of scanning tunneling microscopy and soft X-ray magnetic circular dichroism spectroscopy  

SciTech Connect

We have constructed an end station for nanoscale magnetic materials study at the soft X-ray beamline HiSOR BL-14 at Hiroshima Synchrotron Radiation Center. An ultrahigh-vacuum scanning tunneling microscope (STM) was installed for an in situ characterization of nanoscale magnetic materials in combination with soft X-ray magnetic circular dichroism (XMCD) spectroscopy experiment. The STM was connected to the XMCD experimental station via damper bellows to isolate it from environmental vibrations, thus achieving efficient spatial resolution for observing Si(111) surface at atomic resolution. We performed an in situ experiment with STM and XMCD spectroscopy on Co nanoclusters on an Au(111) surface and explored its practical application to investigate magnetic properties for well-characterized nanoscale magnetic materials.

Ueno, Tetsuro; Sawada, Masahiro; Namatame, Hirofumi [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hiroshima 739-0046 (Japan); Kishimizu, Yusuke; Kimura, Akio [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8526 (Japan); Taniguchi, Masaki [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hiroshima 739-0046 (Japan); Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8526 (Japan)



Theoretical study of the magnetic x-ray dichroism of Os, Ir, Pt, and Au impurities in Fe  

Science Journals Connector (OSTI)

The electronic structure of the 5d impurities Os, Ir, Pt, and Au in ferromagnetic Fe has been studied by the spin-polarized, relativistic version of the Korringa-Kohn-Rostoker Green’s-function method. This approach simultaneously treats spin polarization and spin-orbit coupling and naturally allows for a theoretical investigation of effects arising from an interplay of both. Here the polarization dependence of x-ray absorption (magnetic x-ray dichroism) is considered. For all the impurities studied, the agreement with recent experimental L2 and L3 absorption spectra is very satisfactory. For Pt in Fe, a decomposition of the spectra into various absorption channels is presented and the applicability of a simplified model is discussed that interprets the spectra in terms of a spin-polarized band structure alone.

H. Ebert and R. Zeller



Linear Collider Final Focus Magnet Construction | Superconducting Magnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Linear Collider Final Focus Magnet Construction Linear Collider Final Focus Magnet Construction The final focus magnets for the International Linear Collider require very small quadrupoles be placed within the detector background field for both the entrance and exit beams. The use of superconducting magnets for this function provide solutions to several problems confronting the machine designers. One constraint is the operation within the 3 tesla detector field. The direct wind magnets are capable of operation without the use of magnetic materials in their construction, making them ideal for compact focussing solutions within detectors. The second constraint is the small physical size dictated by the crossing angle of the beams and proximity to the IR within the detector solenoid. The Direct Wind design does not require a collar to withstand Lorentz


Theoretical Fe L2,3- and K-edge x-ray magnetic circular dichroism spectra of free iron clusters  

Science Journals Connector (OSTI)

A fully relativistic ab initio theoretical scheme is employed for investigating L2,3- and K-edge x-ray absorption near-edge structure (XANES) and x-ray magnetic circular dichroism (XMCD) spectra of free Fe clusters of 9–89 atoms. The L2,3-edge spectra of clusters differ from spectra of bulk only quantitatively; a higher degree of localization of the d electrons in clusters is reflected through a higher intensity of the main XANES and XMCD peaks at the absorption edge. The K-edge XANES and XMCD spectra of clusters, on the other hand, differ from their bulk counterparts more significantly, even for the largest clusters investigated within our study. Several features, which could serve as spectroscopic markers of the difference between the clusters and bulk, were identified in both the L2,3- and K-edge spectra. Contracting the bond lengths in clusters changes XMCD spectra only quantitatively.

Ond?ej Šipr and Hubert Ebert


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi



An Energy-Stabilized Varied-Line-Space-Monochromator UndulatorBeam Line for PEEM Illumination and Magnetic Circular Dichroism  

SciTech Connect

A new undulator beam line has been built and commissioned at the Advanced Light Source for illumination of the PEEM3 microscope. The beam line delivers high flux beams over an energy range from C1s through the transition metals to include the M edges of the magnetic rare earth elements. We present details of the optical design, and data on the performance of the zero-order tracking of the photon energy.

Warwick, Tony; McKinney, Wayne; Domning, Ed; Doran, Andrew; Padmore, Howard



Linear Collider Final Focus Magnet Construction | Superconducting Magnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Six Layer Quadrupole Six Layer Quadrupole The incoming beam final quad for the linear collider 20 mr option requires a gradient of 140 T/m within a solenoid of 3 Tesla. To meet this goal, a design using 6 around 1 cable bonded to a one inch diameter tube was used. The magnet design required 6 layers of this cable. Two layers were bonded at a time, with S-glass compression wrap every two layers. Final cold testing results were very good, with only two training quenches before reaching short sample. Initial test results at a glance: Background Field Tesla Temp Kelvin Gradient T/m 3 4.3 158 4 4.22 139 5 4.22 134 6 3 137 This data scales to 232 Tesla/meter at 1.9 Kelvin in a 3 Tesla background field. Present field requirements for the 20 mr IR represents 60% of the magnet capability, a comfortable margin. Indeed, even at 4.3 Kelvin in a 3


Magnetic levitation configuration incorporating levitation, guidance and linear synchronous motor  

DOE Patents (OSTI)

A propulsion and suspension system for an inductive repulsion type magnetically levitated vehicle which is propelled and suspended by a system which includes propulsion windings which form a linear synchronous motor and conductive guideways, adjacent to the propulsion windings, where both combine to partially encircling the vehicle-borne superconducting magnets. A three phase power source is used with the linear synchronous motor to produce a traveling magnetic wave which in conjunction with the magnets propel the vehicle. The conductive guideway combines with the superconducting magnets to provide for vehicle levitation. 3 figures.

Coffey, H.T.



Novel Approach to Linear Accelerator Superconducting Magnet System  

SciTech Connect

Superconducting Linear Accelerators include a superconducting magnet system for particle beam transportation that provides the beam focusing and steering. This system consists of a large number of quadrupole magnets and dipole correctors mounted inside or between cryomodules with SCRF cavities. Each magnet has current leads and powered from its own power supply. The paper proposes a novel approach to magnet powering based on using superconducting persistent current switches. A group of magnets is powered from the same power supply through the common, for the group of cryomodules, electrical bus and pair of current leads. Superconducting switches direct the current to the chosen magnet and close the circuit providing the magnet operation in a persistent current mode. Two persistent current switches were fabricated and tested. In the paper also presented the results of magnetic field simulations, decay time constants analysis, and a way of improving quadrupole magnetic center stability. Such approach substantially reduces the magnet system cost and increases the reliability.

Kashikhin, Vladimir; /Fermilab



Optimization of a dual acting, magnetically driven, linear actuator  

E-Print Network (OSTI)

In this study the geometry of a dual acting, magnetically driven, linear motion actuator will be optimized. This will be accomplished by modeling the system through a set of differential equations to be solved in Matlab. An ANSYS finite element...

Willerton, Justin Ryan



Cryogen free superconducting splittable quadrupole magnet for linear accelerators  

SciTech Connect

A new superconducting quadrupole magnet for linear accelerators was fabricated at Fermilab. The magnet is designed to work inside a cryomodule in the space between SCRF cavities. SCRF cavities must be installed inside a very clean room adding issues to the magnet design, and fabrication. The designed magnet has a splittable along the vertical plane configuration and could be installed outside of the clean room around the beam pipe previously connected to neighboring cavities. For more convenient assembly and replacement a 'superferric' magnet configuration with four racetrack type coils was chosen. The magnet does not have a helium vessel and is conductively cooled from the cryomodule LHe supply pipe and a helium gas return pipe. The quadrupole generates 36 T integrated magnetic field gradient, has 600 mm effective length, and the peak gradient is 54 T/m. In this paper the quadrupole magnetic, mechanical, and thermal designs are presented, along with the magnet fabrication overview and first test results.

Kashikhin, V.S.; Andreev, N.; Kerby, J.; Orlov, Y.; Solyak, N.; Tartaglia, M.; Velev, G.; /Fermilab



Optical dichroism in nanotubes  

Science Journals Connector (OSTI)

Utilizing the line-group symmetry of single-wall nanotubes, we have assigned their electron-energy bands by symmetry-based quantum numbers. The selection rules for optical absorption are presented in terms of these quantum numbers. Different interband transitions become allowed as the polarization of incident light is varied, and we predict a substantial optical dichroism. We suggest how to observe this effect in experiments on a single nanotube, and how it can be used to control quantum transport in nanotubes to obtain information about the structure.

I. Božovi?; N. Božovi?; M. Damnjanovi?



Linear Collider Final Focus Magnet Construction | Superconducting Magnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Two Layer Quadrupole Shielding Coil Two Layer Quadrupole Shielding Coil Near the interaction region if the ILC, the exit beam by design, is very close to the final focus quads, and is sensitive to the external field of the quads. To eliminate this effect and prevent disruption of the exiting beams, a two layer shielding quadrupole has been designed and wound. For simplicity as well as efficiency, the transfer function of this coilset has been designed to allow series connection of the focus quad with this outer shield coilset. The completed magnet will be finished with G-10 fillers, voltage taps and heaters will be added, blue epoxy filling for all interstitial spaces, and then the magnet will be wrapped with glass cloth and fiberglass roving, then cured. Once cured, this magnet will be capable of full power operation


Measurement of the transmission magnetic circular dichroism of Ga{sub 1?x}Mn{sub x}As epilayers using a built-in p-i-n photodiode  

SciTech Connect

By constructing a GaMnAs epilayer/semi-insulating In{sub 0.2}Ga{sub 0.8}As/(001) n{sup +}-GaAs substrate layer structure as a built-in p-i-n photodiode, we developed a scheme for on-chip measurements of transmission magnetic circular dichroism (T-MCD). Both the hysteresis loops in the magnetic field sweeps and the wavelength scans at saturated magnetic fields measured using the new T-MCD scheme, illustrated the same features as those previously measured on the freestanding GaMnAs thin films by conventional T-MCD. Because a large group of epitaxially grown magnetic film/semiconductor heterostructures, such as Fe, NiFe, CoFeAl, and MnGa films on semiconductor substrates, are becoming important new building blocks for semiconductor-based spin field-effect transistor, perpendicular magnetic tunnel junction (p-MTJ) and lateral MTJ devices, the new T-MCD scheme can be applied to tests of their magnetic properties by forming either p-i-n or Schottky photodiodes.

He, Z. X.; Zheng, H. Z., E-mail: hzzheng@red.semi.ac.cn; Wang, H. L.; Zhao, J. H. [State Key Laboratory of Superlattices and Microstructures, Institute of Semiconductors, Chinese Academy of Sciences, P. O. Box 912, Beijing 100083 (China)



Linear Collider Final Focus Magnet Construction | Superconducting Magnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Single Strand Superconductor Windings Single Strand Superconductor Windings Initial direct wind quad coils were constructed using 13 mil diameter single strand wire. This wire provides the smallest coil patterns possible, with quad coils wound easily onto .75 inch (19mm) diameter support tubes. The 13mil diameter superconductor gives the smallest coils possible, the penalty being higher inductance and smaller transfer function, but allowing lower operational currents. long model magnet Figure 1 shows the first one foot long model magnet constructed using the 11 axis ultrasonic wiring machine with 13 mil superconducting wire, the same wire previously used for the 472 RHIC Corrector packages. Existing stock materials were used in the construction, and the coil pattern was not optimized for harmonics, but to put as many coil turns onto the tube as


Suppression of drift waves in a linear magnetized plasma column  

SciTech Connect

In magnetically confined fusion plasmas, drift wave driven turbulence can lead to enhanced particle transport from the plasma. Because of this, a significant research emphasis has been placed on the suppression of drift waves in the plasma edge. However, the combination of the toroidal geometry and short plasma lifetimes can make it difficult to fully characterize the properties of these instabilities. Because linear magnetized plasma devices offer a combination of simpler geometry and steady state plasma generation, it is possible to perform detailed studies of many types of plasma instabilities-including drift waves. This paper reports on a recent experiment in which low frequency instabilities ({omega} {<=} {omega}{sub ci}) in the Auburn Linear EXperiment for Instability Studies plasma device were characterized as drift waves and through changes in the parallel current, it is shown that it is possible to suppress these instabilities.

DuBois, A. M.; Eadon, A. C.; Thomas, E. Jr. [Physics Department, Auburn University, Auburn, Alabama 36849 (United States)



Anisotropic Circular Dichroism Signatures of Oriented Thylakoid Membranes and Lamellar Aggregates of LHCII  

SciTech Connect

In photosynthesis research, circular dichroism (CD) spectroscopy is an indispensable tool to probe molecular architecture at virtually all levels of structural complexity. At the molecular level, the chirality of the molecule results in intrinsic CD; pigment-pigment interactions in protein complexes and small aggregates can give rise to excitonic CD bands, while 'psi-type' CD signals originate from large, densely packed chiral aggregates. It has been well established that anisotropic CD (ACD), measured on samples with defined non-random orientation relative to the propagation of the measuring beam, carries specific information on the architecture of molecules or molecular macroassemblies. However, ACD is usually combined with linear dichroism and can be distorted by instrumental imperfections, which given the strong anisotropic nature of photosynthetic membranes and complexes, might be the reason why ACD is rarely studied in photosynthesis research. In this study, we present ACD spectra, corrected for linear dichroism, of isolated intact thylakoid membranes of granal chloroplasts, washed unstacked thylakoid membranes, photosystem II (PSII) membranes (BBY particles), grana patches, and tightly stacked lamellar macroaggregates of the main light-harvesting complex of PSII (LHCII). We show that the ACD spectra of face- and edge-aligned stacked thylakoid membranes and LHCII lamellae exhibit profound differences in their psi-type CD bands. Marked differences are also seen in the excitonic CD of BBY and washed thylakoid membranes. Magnetic CD (MCD) spectra on random and aligned samples, and the largely invariable nature of the MCD spectra, despite dramatic variations in the measured isotropic and anisotropic CD, testify that ACD can be measured without substantial distortions and thus employed to extract detailed information on the (supra)molecular organization of photosynthetic complexes. An example is provided showing the ability of CD data to indicate such an organization, leading to the discovery of a novel crystalline structure in macroaggregates of LHCII.

Miloslavina Y.; Hind G.; Lambrev, P. H.; Javorfi, T.; Varkonyi, Z.; Karlicky, V.; Wall, J. S.; Garab, G.



X-Ray Directional Dichroism of a Polar Ferrimagnet  

Science Journals Connector (OSTI)

In a polar ferrimagnet GaFeO3, we have found a novel magneto-optical effect, termed x-ray nonreciprocal directional dichroism (XNDD), that the x-ray absorption at around the K edge of an Fe ion depends on whether the x-ray propagation vector is parallel or antiparallel to the outer product of the magnetization and electric-polarization vectors. The XNDD spectroscopy as demonstrated here can be a useful tool to probe the local magnetism in noncentrosymmetric systems such as magnetic interfaces and nanostructures.

M. Kubota, T. Arima, Y. Kaneko, J. P. He, X. Z. Yu, and Y. Tokura




SciTech Connect

Methods for rapidly analyzing methylated and ethylated nucleosides and bases by high pressure liquid chromatography were investigated. Deoxyribonucleotides were alkylated with alkyl iodides and dialkyl sulfates. Several unreported products of the reactions of methyl and ethyl iodide in dimethylsulfoxide were found and are being characterized. The Cary 219 UV-Vis spectrophotometer was interfaced to a microcomputer and several utility programs were written. Preliminary absorption and circular dichroism studies of the binding of ethidium to DNA and nucleosome cores showed binding to cores to be quite different from binding to DNA. Free radical and additional reactions of bisulfite with DNA in chromatin were examined. Free radical attack was minimal. Some conversion of cytosine to uracil was noted, but protein crosslinking to DNA was not detected. The first valid natural abundance /sup 13/C nmr spectra of double-stranded DNA and double-stranded DNA complexed with ethidium were obtained. These spectra suggested that DNA undergoes considerable internal motion. The data show that 13-C nmr studies of the conformational and motional properties of native DNA and of complexes of native DNA with small molecules are practical and promising. Studies of subnucleosomes derived from nucleosomes were completed. Based on these studies, a model of the linear arrangement of histone C-terminal and N-terminal chain regions along nucleosome DNA was proposed. The use of staphylococcal protease to probe histone conformations in nucleosomes was explored. Preliminary data indicate that H3 is much more susceptible to protease than other core histones, and is cleaved in its hydrophobic domain. A procedure for fractionating chromatin was alos developed. (ERB)

Not Available



Spectroscopy 16 (2002) 121125 121 Synchrotron radiation circular dichroism  

E-Print Network (OSTI)

undamaged even after long periods of exposure in the Synchroton Radiation Circular Dichroism (SRCD) beam [2

Wallace, Bonnie Ann


Vibration Stabilization of a Mechanical Model of a X-Band Linear Collider Final Focus Magnet  

SciTech Connect

The small beam sizes at the interaction point of a X-band linear collider require mechanical stabilization of the final focus magnets at the nanometer level. While passive systems provide adequate performance at many potential sites, active mechanical stabilization is useful if the natural or cultural ground vibration is higher than expected. A mechanical model of a room temperature linear collider final focus magnet has been constructed and actively stabilized with an accelerometer based system.

Frisch, Josef; Chang, Allison; Decker, Valentin; Doyle, Eric; Eriksson, Leif; Hendrickson, Linda; Himel, Thomas; Markiewicz, Thomas; Partridge, Richard; Seryi, Andrei; /SLAC



IEEE TRANSACTIONS ON MAGNETICS, VOL. 49, NO. 4, APRIL 2013 1493 Comparison of Complementary and Modular Linear Flux-Switching  

E-Print Network (OSTI)

mover length. Index Terms--Complementary and modular, flux-switching permanent magnet motor, linear and Modular Linear Flux-Switching Motors With Different Mover and Stator Pole Pitch Ruiwu Cao , Ming Cheng], flux reversal permanent magnet (FRPM) motors [12], and flux-switching permanent magnet (FSPM) motors

Mi, Chunting "Chris"


Analysis and Design of a High Power Density Axial Flux Permanent Magnet Linear Synchronous Machine Used for Stirling System  

Science Journals Connector (OSTI)

a high power density axial flux permanent magnet linear synchronous machine and the stirling system will be introduced. This machine is a tubular axial flux permanent magnet machine. It comprises two parts: stator and mover. With the 2D finite-element ... Keywords: permanent magnet, stirling engine, linear motor

Ping Zheng; Xuhui Gan; Lin Li



Effect of the size of GBCO-Ag secondary magnet on the static forces performance of linear synchronous motors  

E-Print Network (OSTI)

Bulk high temperature superconductor magnets (HTSM) have a higher flux-generating capability compared to conventional permanent magnets (PMs). These materials potentially can be used in high temperature superconducting (HTS) linear synchronous...

Zheng, Jun; Shi, Yunhua; He, Dabo; Jing, Hailian; Li, Jing; Deng, Zigang; Wang, Suyu; Wang, Jiasu; Cardwell, David A.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Design of a High Flux Vacuum-Ultraviolet Beamline for Circular Dichroism Experiments  

SciTech Connect

A vacuum-ultraviolet bending-magnet beamline for circular dichroism (CD) experiments has been designed. To maximize the photon flux and minimize the focused beam size, a cylindrical mirror and a cylindrical grating with independent optical functions are utilized. The beamline can collect a 30 mrad horizontal by 7 mrad vertical solid angle of synchrotron radiation. By using a 600 grooves/mm grating, the calculated photon flux is greater than 1x10{sup 13} photons/sec and the focused beam size is 0.4 mmx0.65 mm for the spectral range from 130 nm to 330 nm with the energy resolving power set at 1000. The linear polarization degree is better than 75% and can be increased to 90% by reducing the vertical acceptance angle down to 2 mrad. In addition to the high flux mode described above, this beamline can also be operated in a high resolution mode. By using a 1200 grooves/mm grating, a resolving power greater than 10,000 can be achieved for the spectral range from 180 to 330 nm. This beamline can provide photon flux as high as the best synchrotron CD beamlines in the world while offers simultaneously a smaller focused beam size.

Fu, H. W.; Fung, H. S.; Chung, S. C.; Huang, L. J.; Chen, C. T. [National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan (China)



H{sub 3}{sup +} molecular ion in a magnetic field: Linear parallel configuration  

SciTech Connect

A detailed study of the ground state of the H{sub 3}{sup +} molecular ion in linear configuration, parallel to the magnetic field direction, and its low-lying {sigma}, {pi}, and {delta} states is carried out for magnetic fields B=0-4.414x10{sup 13} G in the Born-Oppenheimer approximation. The variational method is employed with a single trial function which includes electronic correlation in the form exp({gamma}r{sub 12}), where {gamma} is a variational parameter. It is shown that the quantum numbers of the state of the lowest total energy (ground state) depend on the magnetic field strength. The ground state evolves from the spin-singlet {sup 1}{sigma}{sub g} state for weak magnetic fields B(less-or-similar sign)5x10{sup 8} G to a weakly bound spin-triplet {sup 3}{sigma}{sub u} state for intermediate fields and, eventually, to a spin-triplet {sup 3}{pi}{sub u} state for 5x10{sup 10}(less-or-similar sign)B(less-or-similar sign)4.414x10{sup 13} G. Local stability of the linear parallel configuration with respect to possible small deviations is checked.

Turbiner, A. V.; Guevara, N. L.; Lopez Vieyra, J. C. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-543, 04510 Mexico, D.F. (Mexico)



Direct observation of temperature dependent magnetic domain structure of the multiferroic La{sub 0.66}Sr{sub 0.34}MnO{sub 3}/BiFeO{sub 3} bilayer system by x-ray linear dichroism- and x-ray magnetic circular dichroism-photoemission electron microscopy  

SciTech Connect

Low-thickness La{sub 0.66}Sr{sub 0.34}MnO{sub 3} (LSMO)/BiFeO{sub 3} (BFO) thin film samples deposited on SrTiO{sub 3} were imaged by high resolution x-ray microscopy at different temperatures. The ultra-thin thickness of the top layer allows to image both the ferromagnetic domain structure of LSMO and the multiferroic domain structure of the buried BFO layer, opening a path to a direct observation of coupling at the interface on a microscopic level. By comparing the domain size and structure of the BFO and LSMO, we observed that, in contrast to LSMO single layers, LSMO/BFO multilayers show a strong temperature dependence of the ferromagnetic domain structure of the LSMO. Particularly, at 40?K, a similar domain size for BFO and LSMO is observed. This indicates a persistence of exchange coupling on the microscopic scale at a temperature, where the exchange bias as determined by magnetometer measurements is vanishing.

Mix, C.; Finizio, S.; Jakob, G.; Kläui, M. [Institut für Physik, Johannes Gutenberg Universität Mainz, Staudingerweg 7, D-55128 Mainz (Germany); Buzzi, M.; Nolting, F. [Swiss Light Source, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland); Kronast, F. [Helmholtz-Zentrum-Berlin für Materialien und Energie GmbH, Albert-Einstein Straße 15, D-12489 Berlin (Germany)



Three-dimensional linear peeling-ballooning theory in magnetic fusion devices  

SciTech Connect

Ideal magnetohydrodynamics theory is extended to fully 3D magnetic configurations to investigate the linear stability of intermediate to high n peeling-ballooning modes, with n the toroidal mode number. These are thought to be important for the behavior of edge localized modes and for the limit of the size of the pedestal that governs the high confinement H-mode. The end point of the derivation is a set of coupled second order ordinary differential equations with appropriate boundary conditions that minimize the perturbed energy and that can be solved to find the growth rate of the perturbations. This theory allows of the evaluation of 3D effects on edge plasma stability in tokamaks such as those associated with the toroidal ripple due to the finite number of toroidal field coils, the application of external 3D fields for elm control, local modification of the magnetic field in the vicinity of ferromagnetic components such as the test blanket modules in ITER, etc.

Weyens, T., E-mail: tweyens@fis.uc3m.es; Sánchez, R.; García, L. [Departamento de Física, Universidad Carlos III de Madrid, Madrid 28911 (Spain)] [Departamento de Física, Universidad Carlos III de Madrid, Madrid 28911 (Spain); Loarte, A.; Huijsmans, G. [ITER Organization, Route de Vinon sur Verdon, 13067 Saint Paul Lez Durance (France)] [ITER Organization, Route de Vinon sur Verdon, 13067 Saint Paul Lez Durance (France)



Electronic Circular Dichroism of Proteins from First-Principles Calculations  

Science Journals Connector (OSTI)

Electronic Circular Dichroism of Proteins from First-Principles Calculations ... The circular dichroism (CD) spectra of 47 proteins in the far-ultraviolet have been calculated from first principles, using a parameter set derived from ab initio calculations on N-methylacetamide. ... An important aspect of calculating protein CD spectra is the accurate parametrization of the ground and excited electronic states of the amide chromophore. ...

Jonathan D. Hirst; Karl Colella; Andrew T. B. Gilbert



Magnetic Energy and Helicity Budgets in the Active-Region Solar Corona. I. Linear Force-Free Approximation  

E-Print Network (OSTI)

We self-consistently derive the magnetic energy and relative magnetic helicity budgets of a three-dimensional linear force-free magnetic structure rooted in a lower boundary plane. For the potential magnetic energy we derive a general expression that gives results practically equivalent to those of the magnetic Virial theorem. All magnetic energy and helicity budgets are formulated in terms of surface integrals applied to the lower boundary, thus avoiding computationally intensive three-dimensional magnetic field extrapolations. We analytically and numerically connect our derivations with classical expressions for the magnetic energy and helicity, thus presenting a so-far lacking unified treatment of the energy/helicity budgets in the constant-alpha approximation. Applying our derivations to photospheric vector magnetograms of an eruptive and a noneruptive solar active regions, we find that the most profound quantitative difference between these regions lies in the estimated free magnetic energy and relative magnetic helicity budgets. If this result is verified with a large number of active regions, it will advance our understanding of solar eruptive phenomena. We also find that the constant-alpha approximation gives rise to large uncertainties in the calculation of the free magnetic energy and the relative magnetic helicity. Therefore, care must be exercised when this approximation is applied to photospheric magnetic field observations. Despite its shortcomings, the constant-alpha approximation is adopted here because this study will form the basis of a comprehensive nonlinear force-free description of the energetics and helicity in the active-region solar corona, which is our ultimate objective.

M. K. Georgoulis; Barry J. LaBonte



The topology of guiding center orbits in a linear magnetic cusp J. Egedala)  

E-Print Network (OSTI)

.1063/1.1388033 I. INTRODUCTION During magnetic reconnection1 magnetic field lines in opposing directions cross link the two components of the magnetic field per- pendicular to the line vanish. Particle orbits in Harris of particle orbits encircling the magnetic X-line is identified and the orbit phase space partition

Egedal, Jan


Chiral phase transition in relativistic heavy-ion collisions with weak magnetic fields: Ring diagrams in the linear sigma model  

Science Journals Connector (OSTI)

Working in the linear sigma model with quarks, we compute the finite-temperature effective potential in the presence of a weak magnetic field, including the contribution of the pion ring diagrams and considering the sigma as a classical field. In the approximation where the pion self-energy is computed perturbatively, we show that there is a region of the parameter space where the effect of the ring diagrams is to preclude the phase transition from happening. Inclusion of the magnetic field has small effects that however become more important as the system evolves to the lowest temperatures allowed in the analysis.

Alejandro Ayala; Adnan Bashir; Alfredo Raya; Angel Sánchez



A Study of Generalized Second Law of Thermodynamics in Magnetic Universe in the light of Non-Linear Electrodynamics  

E-Print Network (OSTI)

In this work, we have considered the magnetic universe in non-linear electrodynamics. The Einstein's field equations for non-flat FRW model have been considered when the universe is filled with the matter and magnetic field only. We have discussed the validity of the generalized second law of thermodynamics of the magntic universe bounded by Hubble, apparent, particle and event horizons using Gibb's law and the first law of thermodynamics for interacting and non-interacting scenarios. It has been shown that the GSL is always satisfied for Hubble, apparent and particle horizons but for event horizon, the GSL is violated initially and satisfied at late stage of the universe.

Tanwi Bandyopadhyay; Ujjal Debnath



Linear instability of magnetic Taylor-Couette flow with Hall effect Gunther Rudiger*  

E-Print Network (OSTI)

in a rather complex bifurcation diagram. In this case the critical magnetic Reynolds numbers with Hall effect MHD regime the Rayleigh criterion for stability, Eq. 4 , changes to ^ 1 5 for a weak magnetic field


Testing non-linear force-free coronal magnetic field extrapolations with the Titov-Demoulin equilibrium  

E-Print Network (OSTI)

CONTEXT: As the coronal magnetic field can usually not be measured directly, it has to be extrapolated from photospheric measurements into the corona. AIMS: We test the quality of a non-linear force-free coronal magnetic field extrapolation code with the help of a known analytical solution. METHODS: The non-linear force-free equations are numerically solved with the help of an optimization principle. The method minimizes an integral over the force-free and solenoidal condition. As boundary condition we use either the magnetic field components on all six sides of the computational box in Case I or only on the bottom boundary in Case II. We check the quality of the reconstruction by computing how well force-freeness and divergence-freeness are fulfilled and by comparing the numerical solution with the analytical solution. The comparison is done with magnetic field line plots and several quantitative measures, like the vector correlation, Cauchy Schwarz, normalized vector error, mean vector error and magnetic energy. RESULTS: For Case I the reconstructed magnetic field shows good agreement with the original magnetic field topology, whereas in Case II there are considerable deviations from the exact solution. This is corroborated by the quantitative measures, which are significantly better for Case I. CONCLUSIONS: Despite the strong nonlinearity of the considered force-free equilibrium, the optimization method of extrapolation is able to reconstruct it; however, the quality of reconstruction depends significantly on the consistency of the input data, which is given only if the known solution is provided also at the lateral and top boundaries, and on the presence or absence of flux concentrations near the boundaries of the magnetogram.

Thomas Wiegelmann; Bernd Inhester; Bernhard Kliem; Gherardo Valori; Thomas Neukirch



Strain induced electronic structure changes in magnetic transition metal oxides thin films  

SciTech Connect

We show that the angular dependence of x-ray magnetic circular dichroism (XMCD) is strongly sensitive to strain-induced electronic structure changes in magnetic transition metal oxides. We observe a pronounced dependence of the XMCD spectral shape on the experimental geometry as well as nonvanishing XMCD with distinct spectral features in transverse geometry in compressively strained MnCr{sub 2}O{sub 4} films. The angular dependent XMCD can be described as a sum over an isotropic and anisotropic contribution, the latter linearly proportional to the axial distortion due to strain. The XMCD spectra are well reproduced by atomic multiplet calculations.

van der Laan, G.; Chopdekar, R.V.; Suzuki, Y.; Arenholz, E.



Number-conserving linear-response study of low-velocity ion stopping in a collisional magnetized classical plasma  

SciTech Connect

The results of a theoretical investigation of the low-velocity stopping power of ions in a magnetized collisional and classical plasma are reported. The stopping power for an ion is calculated through the linear-response (LR) theory. The collisions, which lead to a damping of the excitations in the plasma, are taken into account through a number-conserving relaxation time approximation in the LR function. In order to highlight the effects of collisions and magnetic field, we present a comparison of our analytical and numerical results obtained for nonzero damping or magnetic field with those for vanishing damping or magnetic field. It is shown that the collisions remove the anomalous friction obtained previously [Nersisyan et al., Phys. Rev. E 61, 7022 (2000)] for the collisionless magnetized plasmas at low ion velocities. One of the major objectives of this paper is to compare and to contrast our theoretical results with those obtained through a diffusion coefficient formulation based on the Dufty-Berkovsky relation evaluated for a magnetized one-component plasma modeled with target ions and electrons.

Nersisyan, Hrachya B. [Institute of Radiophysics and Electronics, 0203 Ashtarak (Armenia); Centre of Strong Fields Physics, Yerevan State University, Alex Manoogian Street 1, 0025 Yerevan (Armenia); Deutsch, Claude [LPGP - UMR-CNRS 8578, Universite Paris XI, F-91405 Orsay (France); Das, Amal K. [Department of Physics, Dalhousie University, Halifax, Nova Scotia B3H 3J5 (Canada)



The First International Workshop on Synchrotron Radiation Circular Dichroism  

E-Print Network (OSTI)

The First International Workshop on Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy and biochemists and has been operational for about a year. Drs. Kunihiko Gekko (HiSOR, Japan) and Ye Tao (BSRF REPORTS SYNCHROTRON RADIATION NEWS, Vol. 15, No. 1, 2002 33 1st International Workshop on SRCD

Wallace, Bonnie Ann


Q & A Experiment to Search for Vacuum Dichroism, Pseudoscalar-Photon Interaction and Millicharged Fermions  

E-Print Network (OSTI)

A number of experiments are underway to detect vacuum birefringence and dichroism -- PVLAS, Q & A, and BMV. Recently, PVLAS experiment has observed optical rotation in vacuum by a magnetic field (vacuum dichroism). Theoretical interpretations of this result include a possible pseudoscalar-photon interaction and the existence of millicharged fermions. Here, we report the progress and first results of Q & A (QED [quantum electrodynamics] and Axion) experiment proposed and started in 1994. A 3.5-m high-finesse (around 30,000) Fabry-Perot prototype detector extendable to 7-m has been built and tested. We use X-pendulums and automatic control schemes developed by the gravitational-wave detection community for mirror suspension and cavity control. To polarize the vacuum, we use a 2.3-T dipole permanent magnet, with 27-mm-diameter clear borehole and 0.6-m field length,. In the experiment, the magnet is rotated at 5-10 rev/s to generate time-dependent polarization signal with twice the rotation frequency. Our ellipsometer/polarization-rotation-detection-system is formed by a pair of Glan-Taylor type polarizing prisms with extinction ratio lower than 10-8 together with a polarization modulating Faraday Cell with/without a quarter wave plate. We made an independent calibration of our apparatus by performing a measurement of gaseous Cotton-Mouton effect of nitrogen. We present our first experimental results and give a brief discussion of our experimental limit on pseudo-scalar-photon interaction and millicharged fermions.

Sheng-Jui Chen; Hsien-Hao Mei; Wei-Tou Ni



Effects of eddy currents due to a vacuum chamber wall in the airgap of a moving-magnet linear actuator  

SciTech Connect

This paper discusses the effects of eddy currents induced in an electrically conducting plate which is placed in the airgap of a linear synchronous actuator with moving permanent magnets. The eddy currents induced in this plate, which is part of a controlled atmosphere chamber, cause not only damping but also deteriorate the actuator performance by disturbing the position measurement with Hall sensors. Furthermore, feed-forward controllers are less effective due to the suppression of high frequent armature fields. These effects are analyzed with an analytical model and verified with finite element simulations and measurements.

Jansen, J. W.; Lomonova, E. A.; Rovers, J. M. M. [Department of Electrical Engineering, Eindhoven University of Technology, Den Dolech 2, 5612 AZ Eindhoven (Netherlands)



Linear mode conversion of Langmuir/z-mode waves to radiation in plasmas with various magnetic field strength  

SciTech Connect

Linear mode conversion of Langmuir/z waves to electromagnetic radiation near the plasma and upper hybrid frequency in the presence of density gradients is potentially relevant to type II and III solar radio bursts, ionospheric radar experiments, pulsars, and continuum radiation for planetary magnetospheres. Here, we study mode conversion in warm, magnetized plasmas using a numerical electron fluid simulation code when the density gradient has a wide range of angle, ?, to the ambient magnetic field, B{sub 0}, for a range of incident Langmuir/z wavevectors. Our results include: (1) Left-handed polarized ordinary (oL) and right-handed polarized extraordinary (xR) mode waves are produced in various ranges of ? for ?{sub 0} = (?L/c){sup 1/3}(?{sub ce}/?) < 1.5, where ?{sub ce} is the (angular) electron cyclotron frequency, ? is the angular wave frequency, L is the length scale of the (linear) density gradient, and c is the speed of light; (2) the xR mode is produced most strongly in the range, 40° < ? < 60°, for intermediately magnetized plasmas with ?{sub 0} = 1.0 and 1.5, while it is produced over a wider range, 0° ? ? ? 90°, for weakly magnetized plasmas with ?{sub 0} = 0.1 and 0.7; (3) the maximum total conversion efficiencies for wave power from the Langmuir/z mode to radiation are of order 50%–99% and the corresponding energy conversion efficiencies are 5%–14% (depending on the adiabatic index ? and ? = T{sub e}/m{sub e}c{sup 2}, where T{sub e} is the electron temperature and m{sub e} is the electron) for various ?{sub 0}; (4) the mode conversion window becomes wider as ?{sub 0} and ? increase. Hence, the results in this paper confirm that linear mode conversion under these conditions can explain the weak total circular polarization of interplanetary type II and III solar radio bursts because a strong xR mode can be generated via linear mode conversion near ? ? 45°.

Kim, Eun-Hwa; Johnson, Jay R. [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States)] [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Cairns, Iver H. [School of Physics, University of Sydney, Sydney, New South Wales 2002 (Australia)] [School of Physics, University of Sydney, Sydney, New South Wales 2002 (Australia)



Non-Linear Magnetic Ringing of Spin-Ordered Solid He-3  

E-Print Network (OSTI)

of preparing the initial state, not by switch- ing off a large dc field, but rather by applying a ~eak ac magnetic pulse at the zero-field resonance fre- quency IIp/2rr for a sufficient duration, in order to drive the system to a finite deviation from...

Hu, Chia-Ren; HAM, TE.



Rheo-optical determination of flow birefringence and flow dichroism with the pulsed laser method  

E-Print Network (OSTI)

Rheo-optical determination of flow birefringence and flow dichroism with the pulsed laser method online 29 August 2006 Rheo-optical measurements of the flow birefringence, flow dichroism systems under flow. However, the standard setup of an optical train, using phase modulation for the rheo-optical


Magnetism at the interface between ferromagnetic and superconducting oxides  

E-Print Network (OSTI)

-rays and by off-specular neutron reflectometry. The resulting data yield microscopic insight into the interplay methods, X-ray magnetic circular dichroism (XMCD) and neutron reflectometry, yields a detailed microscopic

Loss, Daniel

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Effects of obliqueness and strong electrostatic interaction on linear and nonlinear propagation of dust-acoustic waves in a magnetized strongly coupled dusty plasma  

SciTech Connect

Linear and nonlinear propagation of dust-acoustic waves in a magnetized strongly coupled dusty plasma is theoretically investigated. The normal mode analysis (reductive perturbation method) is employed to investigate the role of ambient/external magnetic field, obliqueness, and effective electrostatic dust-temperature in modifying the properties of linear (nonlinear) dust-acoustic waves propagating in such a strongly coupled dusty plasma. The effective electrostatic dust-temperature, which arises from strong electrostatic interactions among highly charged dust, is considered as a dynamical variable. The linear dispersion relation (describing the linear propagation characteristics) for the obliquely propagating dust-acoustic waves is derived and analyzed. On the other hand, the Korteweg-de Vries equation describing the nonlinear propagation of the dust-acoustic waves (particularly, propagation of dust-acoustic solitary waves) is derived and solved. It is shown that the combined effects of obliqueness, magnitude of the ambient/external magnetic field, and effective electrostatic dust-temperature significantly modify the basic properties of linear and nonlinear dust-acoustic waves. The results of this work are compared with those observed by some laboratory experiments.

Shahmansouri, M. [Department of Physics, Faculty of Science, Arak University, Arak 38156- 8 8349 (Iran, Islamic Republic of)] [Department of Physics, Faculty of Science, Arak University, Arak 38156- 8 8349 (Iran, Islamic Republic of); Mamun, A. A. [Department of Physics, Jahangirnagar University, Savar, Dhaka-1342 (Bangladesh)] [Department of Physics, Jahangirnagar University, Savar, Dhaka-1342 (Bangladesh)



Protein Characterisation by Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy  

SciTech Connect

Circular dichroism (CD) spectroscopy is a well-established technique for the study of proteins. Synchrotron radiation circular dichroism (SRCD) spectroscopy extends the utility of conventional CD spectroscopy (i.e. using laboratory-based instruments) because the high light flux from a synchrotron enables collection of data to lower wavelengths, detection of spectra with higher signal-to-noise levels and measurements in the presence of strongly absorbing non-chiral components such as salts, buffers, lipids and detergents. This review describes developments in instrumentation, methodologies and bioinformatics that have enabled new applications of the SRCD technique for the study of proteins. It includes examples of the use of SRCD spectroscopy for providing static and dynamic structural information on molecules, including determinations of secondary structures of intact proteins and domains, assessment of protein stability, detection of conformational changes associated with ligand and drug binding, monitoring of environmental effects, examination of the processes of protein folding and membrane insertion, comparisons of mutant and modified proteins, identification of intermolecular interactions and complex formation, determination of the dispositions of proteins in membranes, identification of natively disordered proteins and their binding partners and examination of the carbohydrate components of glycoproteins. It also discusses how SRCD can be used in conjunction with macromolecular crystallography and other biophysical techniques to provide a more complete picture of protein structures and functions, including how proteins interact with other macromolecules and ligands. This review also includes a discussion of potential new applications in structural and functional genomics using SRCD spectroscopy and future instrumentation and bioinformatics developments that will enable such studies. Finally, the appendix describes a number of computational/bioinformatics resources for secondary structure analyses that take advantage of the improved data quality available from SRCD. In summary, this review discusses how SRCD can be used for a wide range of structural and functional studies of proteins.

Wallace, B.



The topology of guiding center orbits in a linear magnetic cusp J. Egedal a) and A. Fasoli  

E-Print Network (OSTI)

.1063/1.1388033# I. INTRODUCTION During magnetic reconnection 1 magnetic field lines in opposing directions cross which the two components of the magnetic field per­ pendicular to the line vanish. Particle orbits of particle orbits encircling the magnetic X­line is identified and the orbit phase space partition

Egedal, Jan


R&D for a Soft X-Ray Free Electron Laser Facility  

E-Print Network (OSTI)

x-ray magnetic linear dichroism spectromicroscop,y” Scienceultrafast magnetic phenomena and materials science [44].Magnet Science & Technology, National High Magnetic Field

Staples, John



Induced chirality in fisetin upon binding to serum albumin: experimental circular dichroism and TDDFT calculations  

Science Journals Connector (OSTI)

Theoretical absorption and electronic circular dichroism (ECD) spectra predicted via time-dependent density functional theory (TDDFT) calculations on the neutral and four anionic species of fisetin, an achiral fl...

Iulia Matei; Sorana Ionescu; Mihaela Hillebrand



Circular Dichroism Techniques for the Analysis of Intrinsically Disordered Proteins and Domains  

Science Journals Connector (OSTI)

Circular dichroism (CD) spectroscopy is a simple and powerful technique, which allows for the assessment of the conformational properties of a protein or protein domain. Intrinsically disordered proteins (IDPs), ...

Lucía B. Chemes; Leonardo G. Alonso…




Science Journals Connector (OSTI)

Historically, magnetism is related to rock magnetism, due to a few minerals exhibiting spontaneous magnetization. Attractive properties of magnetite were already known in Antiquity and were used for navigation...

Guillaume Morin




Science Journals Connector (OSTI)

magnetism [A class of physical phenomena associated with moving electricity, including the mutual mechanical forces among magnets and electric currents] ? Magnetismus m



SU(3) Polyakov Linear $\\sigma$-Model in Magnetic Field: Thermodynamics, Higher-Order Moments, Chiral Phase Structure and Meson Masses  

E-Print Network (OSTI)

Effects of external magnetic field on various properties of the quantum chromodynamics under extreme conditions of temperature and density have been analysed. To this end, we use SU(3) Polyakov linear sigma-model and assume that the external magnetic field eB adds some restrictions to the quarks energy due to the existence of free charges in the plasma phase. In doing this, we apply the Landau theory of quantization. This requires an additional temperature to drive the system through the chiral phase-transition. Accordingly, the dependence of the critical temperature of chiral and confinement phase-transitions on the magnetic field is characterized. Based on this, we have studied the thermal evolution of thermodynamic quantities and the first four higher-order moment of particle multiplicity. Having all these calculations, we have studied the effects of magnetic field on chiral phase-transition. We found that both critical temperature T_c and critical chemical potential increase with increasing the magnetic f...

Tawfik, Abdel Nasser




Science Journals Connector (OSTI)

... dipoles in applied fields". It deals with the classical (Langevin) theory of para-magnetism, anisotropy fields and magnetic measurements. In the next chapter "Atomic structure" the author ... special relevance to ferrites and the inclusion of a quite lengthy discussion of Pauli para-magnetism and of Stoner's treatment of itinerant electron ferromagnetism, though it does much to ...




First-principles calculation of the Gilbert damping parameter via the linear response formalism with application to magnetic transition metals and alloys  

Science Journals Connector (OSTI)

A method for the calculations of the Gilbert damping parameter ? is presented, which, based on the linear response formalism, has been implemented within the fully relativistic Korringa-Kohn-Rostoker band structure method in combination with the coherent potential approximation alloy theory. To account for thermal displacements of atoms as a scattering mechanism, an alloy-analogy model is introduced. This allows the determination of ? for various types of materials, such as elemental magnetic systems and ordered magnetic compounds at finite temperature, as well as for disordered magnetic alloys at T=0 K and above. The effects of spin-orbit coupling, chemical- and temperature-induced structural disorder, are analyzed. Calculations have been performed for the 3d transition metals bcc Fe, hcp Co, and fcc Ni; their binary alloys bcc Fe1?xCox, fcc Ni1?xFex, fcc Ni1?xCox and bcc Fe1?xVx; and for 5d impurities in transition-metal alloys. All results are in satisfying agreement with experiment.

S. Mankovsky, D. Ködderitzsch, G. Woltersdorf, and H. Ebert




Science Journals Connector (OSTI)

... THIS is a good book, and we are glad to see the subject of magnetism fully treated in a popularly written text-book. It is a second edition of ... of importance, accuracy, and exhaustiveness, places the present treatise, as far as terrestrial magnetism is concerned, much before any similar book with which we are acquainted. The correction ...




Infrared Dichroism and Surface Conformational Dynamics of Adsorbed Poly(dimethylsiloxane)  

E-Print Network (OSTI)

Infrared Dichroism and Surface Conformational Dynamics of Adsorbed Poly(dimethylsiloxane) Iwao Soga conformations at a strongly adsorbing solid surface and their evolution with elapsed time during the adsorption process. Poly(dimethylsiloxane) (PDMS: Mw ) 118 000; Mw/Mn ) 1.16) was allowed to adsorb onto oxidized

Granick, Steve


Low-amplitude magnetic vortex core reversal by non-linear interaction between azimuthal spin waves and the vortex gyromode  

SciTech Connect

We show, by experiments and micromagnetic simulations in vortex structures, that an active “dual frequency” excitation of both the sub-GHz vortex gyromode and multi-GHz spin waves considerably changes the frequency response of spin wave mediated vortex core reversal. Besides additional minima in the switching threshold, a significant broadband reduction of the switching amplitudes is observed, which can be explained by non-linear interaction between the vortex gyromode and the spin waves. We conclude that the well known frequency spectra of azimuthal spin waves in vortex structures are altered substantially, when the vortex gyromode is actively excited simultaneously.

Sproll, Markus; Noske, Matthias; Kammerer, Matthias; Dieterle, Georg; Weigand, Markus; Stoll, Hermann; Schütz, Gisela [Max Planck Institute for Intelligent Systems (formerly MPI for Metals Research), Heisenbergstr. 3, 70569 Stuttgart (Germany)] [Max Planck Institute for Intelligent Systems (formerly MPI for Metals Research), Heisenbergstr. 3, 70569 Stuttgart (Germany); Bauer, Hans; Gangwar, Ajay; Woltersdorf, Georg; Back, Christian H. [Department of Physics, University of Regensburg, Universitätsstr. 31, 93040 Regensburg (Germany)] [Department of Physics, University of Regensburg, Universitätsstr. 31, 93040 Regensburg (Germany)



Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy - An Enhanced Method for Examining Protein Conformations and Protein Interactions  

SciTech Connect

CD (circular dichroism) spectroscopy is a well-established technique in structural biology. SRCD (synchrotron radiation circular dichroism) spectroscopy extends the utility and applications of conventional CD spectroscopy (using laboratory-based instruments) because the high flux of a synchrotron enables collection of data at lower wavelengths (resulting in higher information content), detection of spectra with higher signal-to-noise levels and measurements in the presence of absorbing components (buffers, salts, lipids and detergents). SRCD spectroscopy can provide important static and dynamic structural information on proteins in solution, including secondary structures of intact proteins and their domains, protein stability, the differences between wild-type and mutant proteins, the identification of natively disordered regions in proteins, and the dynamic processes of protein folding and membrane insertion and the kinetics of enzyme reactions. It has also been used to effectively study protein interactions, including protein-protein complex formation involving either induced-fit or rigid-body mechanisms, and protein-lipid complexes. A new web-based bioinformatics resource, the Protein Circular Dichroism Data Bank (PCDDB), has been created which enables archiving, access and analyses of CD and SRCD spectra and supporting metadata, now making this information publicly available. To summarize, the developing method of SRCD spectroscopy has the potential for playing an important role in new types of studies of protein conformations and their complexes.

B Wallace; R Janes




NLE Websites -- All DOE Office Websites (Extended Search)

I I Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs


Linear electric field frequency shift (important for next generation electric dipole moment searches) induced in confined gases by a magnetic field gradient  

E-Print Network (OSTI)

The search for particle electric dipole moments (edm) represents a most promising way to search for physics beyond the standard model. A number of groups are planning a new generation of experiments using stored gases of various kinds. In order to achieve the target sensitivities it will be necessary to deal with the systematic error resulting from the interaction of the well-known $\\overrightarrow{v}\\times \\overrightarrow{E}$ field with magnetic field gradients (often referred to as the geometric phase effect (Commins, ED; Am. J. Phys. \\QTR{bf}{59}, 1077 (1991), Pendlebury, JM \\QTR{em}{et al;} Phys. Rev. \\QTR{bf}{A70}, 032102 (2004)). This interaction produces a frequency shift linear in the electric field, mimicking an edm. In this work we introduce an analytic form for the velocity auto-correlation function which determines the velocity-position correlation function which in turn determines the behavior of the frequency shift (Lamoreaux, SK and Golub, R; Phys. Rev \\QTR{bf}{A71}, 032104 (2005)) and show how it depends on the operating conditions of the experiment. We also discuss some additional issues.

Authors A. L. Barabanov; R. Golub; S. K. Lamoreaux



Imaging photoelectron circular dichroism of chiral molecules by femtosecond multiphoton coincidence detection  

SciTech Connect

Here, we provide a detailed account of novel experiments employing electron-ion coincidence imaging to discriminate chiral molecules. The full three-dimensional angular scattering distribution of electrons is measured after photoexcitation with either left or right circular polarized light. The experiment is performed using a simplified photoelectron-photoion coincidence imaging setup employing only a single particle imaging detector. Results are reported applying this technique to enantiomers of the chiral molecule camphor after three-photon ionization by circularly polarized femtosecond laser pulses at 400 nm and 380 nm. The electron-ion coincidence imaging provides the photoelectron spectrum of mass-selected ions that are observed in the time-of-flight mass spectra. The coincident photoelectron spectra of the parent camphor ion and the various fragment ions are the same, so it can be concluded that fragmentation of camphor happens after ionization. We discuss the forward-backward asymmetry in the photoelectron angular distribution which is expressed in Legendre polynomials with moments up to order six. Furthermore, we present a method, similar to one-photon electron circular dichroism, to quantify the strength of the chiral electron asymmetry in a single parameter. The circular dichroism in the photoelectron angular distribution of camphor is measured to be 8% at 400 nm. The electron circular dichroism using femtosecond multiphoton excitation is of opposite sign and about 60% larger than the electron dichroism observed before in near-threshold one-photon ionization with synchrotron excitation. We interpret our multiphoton ionization as being resonant at the two-photon level with the 3s and 3p Rydberg states of camphor. Theoretical calculations are presented that model the photoelectron angular distribution from a prealigned camphor molecule using density functional theory and continuum multiple scattering X alpha photoelectron scattering calculations. Qualitative agreement is observed between the experimental results and the theoretical calculations of the Legendre moments representing the angular distribution for the two enantiomers. The electron-ion coincidence technique using multiphoton ionization opens new directions in table-top analytical mass-spectrometric applications of mixtures of chiral molecules.

Lehmann, C. Stefan; Ram, N. Bhargava; Janssen, Maurice H. M., E-mail: m.h.m.janssen@vu.nl [LaserLaB Amsterdam, VU University Amsterdam, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands)] [LaserLaB Amsterdam, VU University Amsterdam, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands); Powis, Ivan [School of Chemistry, University of Nottingham, Nottingham NG7 2RD (United Kingdom)] [School of Chemistry, University of Nottingham, Nottingham NG7 2RD (United Kingdom)



Shining New Light on Protein Structure and Function thru Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy  

SciTech Connect

Circular dichroism (CD) spectroscopy has been employed for more than 50 years for the study of the structure and dynamics of proteins. It is now a workhorse of structural biology, finding applications in the determination of protein secondary structures, monitoring and deciphering protein folding, examining macromolecular interactions, and defining and quantitating protein-ligand binding. For the most part, CD studies have used laboratory-based instruments to measure electronic transitions in the far (190-250 nm), near ultraviolet (UV) (250-300 nm) and visible (> 400 nm) wavelength ranges, which have enabled studies of polypeptide backbones, aromatic amino acids and colored chromophores, respectively. Additional transitions exist at lower wavelengths in the vacuum ultraviolet (VUV) region (<190 nm); however, these transitions tend to be inaccessible to conventional CD instruments, due to the low intensity of their Xenon arc lamp light sources at wavelengths below190 nm. In 1980, the first synchrotron-based CD instruments were constructed, which took advantage of the high photon flux available from synchrotron light sources at these wavelengths. However, the technique of synchrotron radiation circular dichroism (SRCD) did not really take off until enabling studies had been done to show that additional data were obtainable for proteins in the VUV region, that these data were readily accessible with modern beamlines, and most importantly, that new applications of these data existed in structural molecular biology.




Linear Accelerator  

NLE Websites -- All DOE Office Websites (Extended Search)

Linear Accelerator (LINAC) The core of the LANSCE facility is one of the nation's most powerful proton linear accelerators or LINAC. The LINAC at LANSCE has served the nation since...

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



NLE Websites -- All DOE Office Websites (Extended Search)

optics, the term "dichroism" refers to changes in the absorption of optics, the term "dichroism" refers to changes in the absorption of polarized light on passing through a material in two different directions. Since materials typically absorb one color of white light preferentially, the material appears with two different colors for the two light directions - it is di- (two-) c hroic (colored). Today, the term dichroism is used more generally to reflect the dependence of photon absorption of a material on polarization. The origin of the dichroism effect can be anisotropies in the charge or the spin in the material. In the latter case we speak of magnetic dichroism. Here we briefly discuss the principles and applications of magnetic dichroism techniques in the x-ray region, the X-Ray Magnetic Circular Dichroism (XMCD) and X-Ray Magnetic Linear Dichroism (XML D)


The electronic and magnetic properties of La{sub 0.85}Zr{sub 0.15}MnO{sub 3} deposited on SrTiO{sub 3} and MgO substrates  

SciTech Connect

The electronic and magnetic properties of tetravalent-ion-doped La{sub 0.85}Zr{sub 0.15}MnO{sub 3} (LZMO) thin films that were epitaxially grown on SrTiO{sub 3} (STO) and MgO substrates were studied using temperature-dependent x-ray diffraction (XRD), x-ray absorption near-edge structure, x-ray linear dichroism, and x-ray magnetic circular dichroism at the Mn L{sub 3,2}- and K-edge. XRD studies reveal that the LZMO thin films have compressive and tensile strains (along the c-axis) on the STO and MgO substrates, respectively. As the temperature is reduced from room temperature to below magnetic transition temperature, the preferentially occupied Mn majority-spin e{sub g} orbital changes from the in-plane d{sub x}{sup 2}{sub -y}{sup 2} to the out-of-plane d{sub 3z}{sup 2}{sub -r}{sup 2} orbital for LZMO/STO, and vice versa for LZMO/MgO. Experimental results suggest that the new hopping path that is mediated by the Mn{sup 2+} ions triggers a stronger d{sub 3z}{sup 2}{sub -r}{sup 2} orbital ordering of Mn{sup 3+} ions and enhances the ferromagnetic coupling between the Mn spin moments of t{sub 2g} electrons in LZMO/STO, whereas the strong tensile strain stabilizes the d{sub x}{sup 2}{sub -y}{sup 2} orbital by inducing lattice distortions of the MnO{sub 6} octahedra in LZMO/MgO.

Deshpande, N. G. [Department of Physics, Tamkang University, Tamsui 251, Taiwan (China); Department of Physics, Shivaji University, Kolhapur-416004, Maharashtra (India); Weng, C. H.; Wang, Y. F.; Shao, Y. C.; Cheng, C. Q.; Ling, D. C., E-mail: dcling@mail.tku.edu.tw, E-mail: wfpong@mail.tku.edu.tw; Hsueh, H. C.; Du, C. H.; Pong, W. F., E-mail: dcling@mail.tku.edu.tw, E-mail: wfpong@mail.tku.edu.tw [Department of Physics, Tamkang University, Tamsui 251, Taiwan (China); Tsai, H. M.; Pao, C. W.; Lin, H. J.; Lee, J. F. [National Synchrotron Radiation Research Center, Hsinchu 300, Taiwan (China); Chiou, J. W. [Department of Applied Physics, National University of Kaohsiung, Kaohsiung 811, Taiwan (China); Tsai, M. H. [Department of Physics, National Sun Yat-Sen University, Kaohsiung 804, Taiwan (China)



Magnetism in nanometer-thick magnetite  

Science Journals Connector (OSTI)

The oldest known magnetic material, magnetite, is of current interest for use in spintronics as a thin film. An open question is how thin can magnetite films be and still retain the robust ferrimagnetism required for many applications. We have grown 1-nm-thick magnetite crystals and characterized them in situ by electron and photoelectron microscopies including selected-area x-ray circular dichroism. Well-defined magnetic patterns are observed in individual nanocrystals up to at least 520 K, establishing the retention of ferrimagnetism in magnetite two unit cells thick.

Matteo Monti; Benito Santos; Arantzazu Mascaraque; Oscar Rodríguez de la Fuente; Miguel Angel Niño; Tevfik Onur Mente?; Andrea Locatelli; Kevin F. McCarty; José F. Marco; Juan de la Figuera



Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

NLE Websites -- All DOE Office Websites (Extended Search)

Electronic Structure and Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Wednesday, 29 November 2006 00:00 The possibility of using electrons' spins in addition to their charge in information technology has created much enthusiasm for a new field of electronics popularly known as "spintronics." An intensely studied approach to obtaining spin-polarized carriers for data-storage devices is the use of diluted magnetic semiconductors created by doping ions like Mn, Fe, or Co having a net spin into a semiconducting host such as GaAs, ZnO, or GaN. The interaction among these spins leads to ferromagnetic order at low temperatures, which is necessary to create spin-polarized carriers. A research team working at ALS Beamline 4.0.2 and European Synchrotron Radiation Facility Beamline ID8 made a big leap forward in clarifying the microscopic picture of magnetism and anisotropy in Mn-doped GaAs by resolving localized and hybridized d states using angle-dependent x-ray magnetic circular dichroism (XMCD) measurements.


Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

NLE Websites -- All DOE Office Websites (Extended Search)

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print The possibility of using electrons' spins in addition to their charge in information technology has created much enthusiasm for a new field of electronics popularly known as "spintronics." An intensely studied approach to obtaining spin-polarized carriers for data-storage devices is the use of diluted magnetic semiconductors created by doping ions like Mn, Fe, or Co having a net spin into a semiconducting host such as GaAs, ZnO, or GaN. The interaction among these spins leads to ferromagnetic order at low temperatures, which is necessary to create spin-polarized carriers. A research team working at ALS Beamline 4.0.2 and European Synchrotron Radiation Facility Beamline ID8 made a big leap forward in clarifying the microscopic picture of magnetism and anisotropy in Mn-doped GaAs by resolving localized and hybridized d states using angle-dependent x-ray magnetic circular dichroism (XMCD) measurements.


Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

NLE Websites -- All DOE Office Websites (Extended Search)

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print The possibility of using electrons' spins in addition to their charge in information technology has created much enthusiasm for a new field of electronics popularly known as "spintronics." An intensely studied approach to obtaining spin-polarized carriers for data-storage devices is the use of diluted magnetic semiconductors created by doping ions like Mn, Fe, or Co having a net spin into a semiconducting host such as GaAs, ZnO, or GaN. The interaction among these spins leads to ferromagnetic order at low temperatures, which is necessary to create spin-polarized carriers. A research team working at ALS Beamline 4.0.2 and European Synchrotron Radiation Facility Beamline ID8 made a big leap forward in clarifying the microscopic picture of magnetism and anisotropy in Mn-doped GaAs by resolving localized and hybridized d states using angle-dependent x-ray magnetic circular dichroism (XMCD) measurements.


Voltage regulation in linear induction accelerators  

DOE Patents (OSTI)

Improvement in voltage regulation in a Linear Induction Accelerator wherein a varistor, such as a metal oxide varistor, is placed in parallel with the beam accelerating cavity and the magnetic core. The non-linear properties of the varistor result in a more stable voltage across the beam accelerating cavity than with a conventional compensating resistance.

Parsons, William M. (Santa Fe, NM)



Voltage regulation in linear induction accelerators  

DOE Patents (OSTI)

Improvement in voltage regulation in a linear induction accelerator wherein a varistor, such as a metal oxide varistor, is placed in parallel with the beam accelerating cavity and the magnetic core is disclosed. The non-linear properties of the varistor result in a more stable voltage across the beam accelerating cavity than with a conventional compensating resistance. 4 figs.

Parsons, W.M.



Non-linear wave equations Hans Ringstrom  

E-Print Network (OSTI)

105 3. Power type non-linearities 108 4. Global existence for small data 109 5. Observations the Maxwell vacuum equations for an electric and magnetic potential also yields wave equations. In order differential equations (PDE:s) is quite big. The linear theory is based on the fact that by adding two

Ringström, Hans


Non-linear wave equations Hans Ringstrom  

E-Print Network (OSTI)

105 3. Power type non-linearities 108 4. Global existence for small data 109 5. Observations boundary conditions. Formulating the Maxwell vacuum equations for an electric and magnetic potential also di#11;erential equations (PDE:s) is quite big. The linear theory is based on the fact that by adding

Ringström, Hans


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

Notes Notes LCC - 0038 29/04/00 CBP Tech Note - 234 Transverse Field Profile of the NLC Damping Rings Electromagnet Wiggler 29 April 2000 17 J. Corlett and S. Marks Lawrence Berkeley National Laboratory M. C. Ross Stanford Linear Accelerator Center Stanford, CA Abstract: The primary effort for damping ring wiggler studies has been to develop a credible radiation hard electromagnet wiggler conceptual design that meets NLC main electron and positron damping ring physics requirements [1]. Based upon an early assessment of requirements, a hybrid magnet similar to existing designs satisfies basic requirements. However, radiation damage is potentially a serious problem for the Nd-Fe-B permanent magnet material, and cost remains an issue for samarium cobalt magnets. Superconducting magnet designs have not been


CAPITO—a web server-based analysis and plotting tool for circular dichroism data  

Science Journals Connector (OSTI)

......capable of analysing multiple CD datasets of virtually any format and...CAPITO accepts multiple CD datasets and, hence, is well suited...X-ray crystallography and nuclear magnetic resonance (NMR...analysis. 2.2 Reference datasets For this study, we used the......

Christoph Wiedemann; Peter Bellstedt; Matthias Görlach



Magnetic Stereoscopy  

E-Print Network (OSTI)

The space mission STEREO will provide images from two viewpoints. An important aim of the STEREO mission is to get a 3D view of the solar corona. We develop a program for the stereoscopic reconstruction of 3D coronal loops from images taken with the two STEREO spacecraft. A pure geometric triangulation of coronal features leads to ambiguities because the dilute plasma emissions complicates the association of features in image 1 with features in image 2. As a consequence of these problems the stereoscopic reconstruction is not unique and multiple solutions occur. We demonstrate how these ambiguities can be resolved with the help of different coronal magnetic field models (potential, linear and non-linear force-free fields). The idea is that, due to the high conductivity in the coronal plasma, the emitting plasma outlines the magnetic field lines. Consequently the 3D coronal magnetic field provides a proxy for the stereoscopy which allows to eliminate inconsistent configurations. The combination of stereoscopy and magnetic modelling is more powerful than one of these tools alone. We test our method with the help of a model active region and plan to apply it to the solar case as soon as STEREO data become available.

Thomas Wiegelmann; Bernd Inhester



Room-Temperature Ferromagnetism in a II-VI Diluted Magnetic Semiconductor Zn1-xCrxTe  

Science Journals Connector (OSTI)

The magnetic and magneto-optical properties of a Cr-doped II-VI semiconductor ZnTe were investigated. Magnetic circular dichroism measurements showed a strong interaction between the sp carriers and localized d spins, indicating that Zn1-xCrxTe is a diluted magnetic semiconductor. The Curie temperature of the film with x=0.20 was estimated to be 300±10???K, which is the highest value ever reported for a diluted magnetic semiconductor in which sp-d interactions were confirmed. In spite of its high Curie temperature, Zn1-xCrxTe film shows semiconducting electrical transport properties.

H. Saito; V. Zayets; S. Yamagata; K. Ando



Electronic Non-Contacting Linear Position Measuring System  

DOE Patents (OSTI)

A non-contacting linear position location system employs a special transmission line to encode and transmit magnetic signals to a receiver on the object whose position is to be measured. The invention is useful as a non-contact linear locator of moving objects, e.g., to determine the location of a magnetic-levitation train for the operation of the linear-synchronous motor drive system.

Post, Richard F. (Walnut Creek, CA)



Structural Study on Moving Magnet Compressor for Stirling Engine  

Science Journals Connector (OSTI)

The article describes a structural study on moving magnet compressor for Stirling engine. The performance of Stirling engine is determined by the linear compressor. The article first establishes mathematics models for ordinary linear compressors and ... Keywords: Stirling engine, moving magnet linear compressor, CAE, magnet field analysis

Ding Guozhong; Zhang Xiaoqing; He Mingshun; Shu Shuiming



Covalent Complexes of DNA and Two Stereoisomers of Benzo(a)pyrene 7,8-Dihydrodiol-9,10-epoxide Studied by Fluorescence and Linear Dichroism  

Science Journals Connector (OSTI)

...rapid cooling in ice water. To prevent reassociation...solution was bubbled with nitrogen gas saturated with water (O2 concentration...law, and the oxygen solubility was 1.4 mw per atm...the spectrum of BPT in water (16) except for a...

Ola Undeman; Per-Olof Lycksell; Astrid Gräslund; Torbjörn Astlind; Anders Ehrenberg; Bengt Jernström; Folke Tjerneld; and Bengt Nordén



Linear Collider Final Focus Magnet Construction | Superconducting Magnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Superconducting Cable Winding Tests Superconducting Cable Winding Tests To increase the transfer function, a 6 around 1 cable was next used. This cable is more efficient because it allows the packing of more conductor within the volume surrounding the support tube. This also lowers the inductance of the coil, making quench protection easier, but requires a higher operating current. Traded off is the minimum radius of curvature that can be tolerated by the bonding process as well as the insulation integrity. For this test, the first layer was designed for a length of 8 inches, and the second layer is 6 inches long. The lengths were chosen to allow inspection of the different features which were designed in. The pole spacers on the first layer for this test were chosen to be solid copper wire, instead of the standard G-10 spacer. The copper allows for a


lgebra Linear Mauro Rincon  

E-Print Network (OSTI)

8.1 Álgebra Linear Mauro Rincon Márcia Fampa Aula 8: Soluções de Sistemas de Equações Lineares #12

Cabral, Marco


Cadmium binding studies to the earthworm Lumbricus rubellus metallothionein by electrospray mass spectrometry and circular dichroism spectroscopy  

SciTech Connect

The earthworm Lumbricus rubellus has been found to inhabit cadmium-rich soils and accumulate cadmium within its tissues. Two metallothionein (MT) isoforms (1 and 2) have been identified and cloned from L. rubellus. In this study, we address the metalation status, metal coordination, and structure of recombinant MT-2 from L. rubellus using electrospray ionization mass spectrometry (ESI-MS), UV absorption, and circular dichroism (CD) spectroscopy. This is the first study to show the detailed mass and CD spectral properties for the important cadmium-containing earthworm MT. We report that the 20-cysteine L. rubellus MT-2 binds seven Cd{sup 2+} ions. UV absorption and CD spectroscopy and ESI-MS pH titrations show a distinct biphasic demetalation reaction, which we propose results from the presence of two metal-thiolate binding domains. We propose stoichiometries of Cd{sub 3}Cys{sub 9} and Cd{sub 4}Cys{sub 11} based on the presence of 20 cysteines split into two isolated regions of the sequence with 11 cysteines in the N-terminal and 9 cysteines in the C-terminal. The CD spectrum reported is distinctly different from any other metallothionein known suggesting quite different binding site structure for the peptide.

Ngu, Thanh T. [Department of Chemistry, University of Western Ontario, London, Ont., N6A 5B7 (Canada); Sturzenbaum, Stephen R. [School of Biomedical and Health Sciences, King's College, London, SE1 9NH (United Kingdom); Stillman, Martin J. [Department of Chemistry, University of Western Ontario, London, Ont., N6A 5B7 (Canada)]. E-mail: Martin.Stillman@uwo.ca


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


XMCD experimental station optimized for ultrathin magnetic films at HiSOR-BL14  

SciTech Connect

We have constructed a system for in situ X-ray magnetic circular dichroism (XMCD) measurements of ultrathin magnetic films at the soft X-ray beamline HiSOR-BL14 at Hiroshima Synchrotron Radiation Center. The XMCD experimental station is directly connected to the beamline, and equipped with a sample fabrication chamber where various types of ultrathin magnetic films can be grown with monatomic layer control. XMCD spectra of the as-grown samples can be measured with adequate precision for the analysis of magnetic moments, under proper control of the light polarization in the beamline optics. This system has enabled the investigation of natural magnetic states in the ultrathin magnetic films without the influence of surface oxidation or any cap-layers.

Sawada, Masahiro; Namatame, Hirofumi [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hirohisma, Hiroshima 739-0046 (Japan); Ueno, Tetsuro; Tagashira, Tetsuro [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-0046 (Japan); Taniguchi, Masaki [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hirohisma, Hiroshima 739-0046 (Japan); Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-0046 (Japan)



residual magnetism  

Science Journals Connector (OSTI)

The magnetization, i.e., the magnetic polarization, that remains in a magnetized material after all attempts to remove the magnetization have been made. Note: An example of residual magnetization is the magnetiza...



Optimisation of a transverse flux linear PM generator using 3D Finite Element Analysis.  

E-Print Network (OSTI)

??ENGLISH ABSTRACT: Several transverse flux and longitudinal flux linear generator topologies exist for freepiston Stirling engine applications. In this thesis the transverse flux permanent magnet… (more)

Schutte, Jacques



Piecewise Linear Phase Transitions  

E-Print Network (OSTI)

It is shown how simple assumptions lead to piecewise linear behavior, which is observed in certain phase transitions.

Joseph B. Keller



Structural and Magnetic Properties of Co-Mn-Sb Thin films  

SciTech Connect

Thin Co-Mn-Sb films of different compositions were investigated and utilized as electrodes in alumina based magnetic tunnel junctions with CoFe counterelectrode. The preparation conditions were optimized with respect to magnetic and structural properties. The Co-Mn-Sb/Al-O interface was analyzed by x-ray absorption spectroscopy and magnetic circular dichroism with particular focus on the element-specific magnetic moments. Co-Mn-Sb crystallizes in different complex cubic structures depending on its composition. The magnetic moments of Co and Mn are ferromagnetically coupled in all cases. A tunnel magnetoresistance ratio of up to 24% at 13 K was found and indicates that Co-Mn-Sb is not a ferromagnetic half-metal. These results are compared to recent works on the structure and predictions of the electronic properties.

Meinert, M.; Schmalhorst, J.-M.; Ebke, D.; Liu, N. N.; Thomas, A.; Reiss, G.; Kanak, J.; Stobiecki, T.; Arenholz, E.



Introduction to Linear Bialgebra  

E-Print Network (OSTI)

The algebraic structure, linear algebra happens to be one of the subjects which yields itself to applications to several fields like coding or communication theory, Markov chains, representation of groups and graphs, Leontief economic models and so on. This book has for the first time, introduced a new algebraic structure called linear bialgebra, which is also a very powerful algebraic tool that can yield itself to applications. With the recent introduction of bimatrices (2005)we have ventured in this book to introduce new concepts like linear bialgebra and Smarandache neutrosophic linear bialgebra and also give the applications of these algebraic structures. It is important to mention here it is a matter of simple exercise to extend these to linear n-algebra for any n greater than 2; for n = 2 we get the linear bialgebra. This book has five chapters. In the first chapter we just introduce some basic notions of linear algebra and Slinear algebra and their applications. Chapter two introduces some new algebraic bistructures. In chapter three we introduce the notion of linear bialgebra and discuss several interesting properties about them. Also, application of linear bialgebra to bicodes is given. A remarkable part of our research in this book is the introduction of the notion of birepresentation of bigroups. The fourth chapter introduces several neutrosophic algebraic structures since they help in defining the new concept of neutrosophic linear bialgebra, neutrosophic bivector spaces, Smarandache neutrosophic linear bialgebra and Smarandache neutrosophic bivector spaces. Theirprobable applications to real-world models are discussed.

W. B. Vasantha Kandasamy; Florentin Smarandache; K. Ilanthenral



Design and sizing of electromagnetic linear actuators for valve applications  

E-Print Network (OSTI)

, a description of the design and sizing of variable reluctance or permanent magnet devices is given. The main, concerning magnetic saturation, the section of this shaft will have to be greater than a minimal value. So qualities of each structure are enhanced. Keywords: Linear motion actuator, variable reluctance, permanent

Paris-Sud XI, Université de


Magnetism in bcc cobalt  

Science Journals Connector (OSTI)

Local-spin-density-approximation-based calculations, performed using a general-potential linearized augmented-plane-wave method, are presented for bcc Co. The ground-state properties and magnetization energies are reported. It is found that the moment is strongly suppressed in constrained antiferromagnetic calculations, indicating that a local-moment picture is less appropriate for this material than for bcc iron.

D. J. Singh



History of Proton Linear Accelerators  

E-Print Network (OSTI)

much. References 1. Linear Accelerators, edited by P. M .at the 1986 Linear Accelerator Conference, SLAC, Stanford,HISTORY OF PROTON LINEAR ACCELERATORS Luis W. Alvarez TWO-

Alvarez, Luis W.



IEEE TRANSACTIONS ON ENERGY CONVERSION, VOL. 27, NO. 2, JUNE 2012 489 Modeling of a Complementary and Modular Linear  

E-Print Network (OSTI)

and Modular Linear Flux-Switching Permanent Magnet Motor for Urban Rail Transit Applications Ruiwu Cao on a prototype motor. Index Terms--Flux-switching permanent magnet (FSPM) motor, linear motor, modeling. I Wang, and Wenxiang Zhao, Member, IEEE Abstract--In this paper, a complementary and modular linear flux-switching

Mi, Chunting "Chris"


Searching for minicharged particles via birefringence, dichroism and Raman spectroscopy of the vacuum polarized by a high-intensity laser wave  

SciTech Connect

Absorption and dispersion of probe photons in the field of a high-intensity circularly polarized laser wave are investigated. The optical theorem is applied for determining the absorption coefficients in terms of the imaginary part of the vacuum polarization tensor. Compact expressions for the vacuum refraction indices and the photon absorption coefficients are obtained in various asymptotic regimes of interest. The outcomes of this analysis reveal that, far from the region relatively close to the threshold of the two-photon reaction, the birefringence and dichroism of the vacuum are small and, in some cases, strongly suppressed. On the contrary, in a vicinity of the region in which the photo-production of a pair occurs, these optical properties are manifest with lasers of moderate intensities. We take advantage of such a property in the search of minicharged particles by considering high-precision polarimetric experiments. In addition, Raman-like electromagnetic waves resulting from the inelastic part of the vacuum polarization tensor are suggested as an alternative form for finding exclusion limits on these hypothetical charge carriers. The envisaged parameters of upcoming high-intensity laser facilities are used for establishing upper bounds on the minicharged particles. -- Highlights: •Via dichroism and birefringence of the vacuum by a strong laser wave, minicharged particles can be probed. •The discovery potential is the highest in a vicinity of the first pair production threshold. •As alternative observable, Raman scattered waves are put forward.

Villalba-Chávez, S., E-mail: selymv@gmail.com; Müller, C., E-mail: c.mueller@tp1.uni-duesseldorf.de



Unit I-2 Linear Maps 1 Linear maps  

E-Print Network (OSTI)

Unit I-2 Linear Maps 1 Unit I-2 Linear maps Unit I-2 Linear Maps 2 Linear map · V & U are vector spaces over the same scalars · a function f: VU is a linear map if it preserves the vector space transformation [particularly when f: RnRm] ­ linear operator when f: V V [same v.s.] ­ linear mapping ­ linear

Birkett, Stephen


lgebra Linear Mauro Rincon  

E-Print Network (OSTI)

10.1 Álgebra Linear Mauro Rincon Márcia Fampa Aula 10: Determinantes #12;10.2 8.1 - Definições #12

Cabral, Marco


Linear Graphene Plasmons  

Science Journals Connector (OSTI)

The coupling of the plasmon spectra of graphene and a nearby thick plasma is examined here in detail. The coupled modes include linear plasmons. Keywords: Graphene, plasmons, surface

N. J.M. Horing



Focusing in Linear Accelerators  

DOE R&D Accomplishments (OSTI)

Review of the theory of focusing in linear accelerators with comments on the incompatibility of phase stability and first-order focusing in a simple accelerator.

McMillan, E. M.



Linear phase compressive filter  

DOE Patents (OSTI)

A phase linear filter for soliton suppression is in the form of a laddered series of stages of non-commensurate low pass filters with each low pass filter having a series coupled inductance (L) and a reverse biased, voltage dependent varactor diode, to ground which acts as a variable capacitance (C). L and C values are set to levels which correspond to a linear or conventional phase linear filter. Inductance is mapped directly from that of an equivalent nonlinear transmission line and capacitance is mapped from the linear case using a large signal equivalent of a nonlinear transmission line.

McEwan, Thomas E. (Livermore, CA)



Using Linearity Web Copyright 2007  

E-Print Network (OSTI)

Using Linearity Web Rev. 2.0 May 2007 Copyright © 2007 #12;Using Linearity Web i Contents Introduction to Linearity Web.............................................................................1 Features, Benefits, and Value of Linearity Web..............................................1 Before You

Rodriguez, Carlos


SLAC linear collider  

SciTech Connect

A brief description of the proposed SLAC Linear Collider is given. This machine would investigate the possibilities and limitations of Linear Colliders while at the same time producing thousands of Z/sup 0/ particles per day for the study of the weak interactions.

Hollebeek, R.



Mn L3,2 X-ray absorption and magnetic circular dichroism in ferromagnetic Ga1-xMnxP  

E-Print Network (OSTI)

confirms electronic structure calculations, which generallyreported, and electronic structure calculations show a very



Observation of x-ray magnetic circular dichroism at the Ru K edge in Co-Ru alloys H. Hashizume* and K. Ishiji  

E-Print Network (OSTI)

Chemie und Biochemie, Physikalische Chemie, Universität München, München D-81377, Germany Received 16

Haskel, Daniel

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Magnetic Spinner  

Science Journals Connector (OSTI)

A science toy sometimes called the “magnetic spinner” is an interesting class demonstration to illustrate the principles of magnetic levitation. It can also be used to demonstrate Faraday's law and a horizontally suspended physical pendulum. The levitated part contains two circular magnets encased in a plastic housing. Each magnet stays above two triangular magnets fixed to the base. The magnetic repulsive force experienced by the circular magnets is independent of their orientation; therefore the holder of these magnets can be rotated without affecting its stability. The holder with the circular magnets can be oscillated up and down as a horizontally suspended physical pendulum.

P. J. Ouseph



Magnetism Digest  

Science Journals Connector (OSTI)

... and Institute of Electrical and Electronic Engineers, on the occasion of their annual conferences on magnetism and magnetic materials in the United States, have sponsored the production of a Magnetic ... references, drawn from a large number of sources, to work in the field of magnetism and magnetic materials published in the preceding year. They therefore provide a very convenient ...




The Solar Magnetic Field as a Coronal Hole Extension Forms: Effects of Magnetic Helicity and Boundary Conditions  

Science Journals Connector (OSTI)

An analytical solution is presented for linear force fields within a spherical shell, representing the solar corona. Allowing for a global magnetic helicity, we find magnetic fields over the entire corona with...

J. R. Clegg; B. J. I. Bromage; P. K. Browning


On frequency dependence of pulsar linear polarization  

E-Print Network (OSTI)

Frequency dependence of pulsar linear polarization is investigated by simulations of emission and propagation processes. Linearly polarized waves are generated through curvature radiation by relativistic particles streaming along curved magnetic field lines, which have ordinary mode (O-mode) and extra-ordinary mode (X-mode) components. As emitted waves propagate outwards, two mode components are separated due to re- fraction of the O mode, and their polarization states are also modified. According to the radius to frequency mapping, low frequency emission is generated from higher magnetosphere, where significant rotation effect leads the X and O modes to be sepa- rated. Hence, the low frequency radiation has a large fraction of linear polarization. As the frequency increases, emission is generated from lower heights, where the rotation effect becomes weaker and the distribution regions of two modes are more overlapped. Hence, more significant depolarization appears for emission at higher frequencies. In addit...

Wang, P F; Han, J L



Compact IR Quadrupoles for Linear Colliders Based on Rutherford-type Cable  

SciTech Connect

The upcoming and disrupted beams in the interaction region (IR) of a linear collider are focused by doublets consisting of two small-aperture superconducting quadrupoles. These magnets need an effective compact magnetic shielding to minimize magnetic coupling between the two channels and sufficient temperature margin to withstand radiation-induced heat depositions in the coil. This paper presents conceptual designs of IR quadrupoles for linear colliders based on NbTi and Nb{sub 3}Sn Rutherford-type cables.

Lopes, M.L.; Kashikhin, V.S.; Kashikhin, V.V.; Zlobin, A.V.; /Fermilab



North Linear Accelerator  

NLE Websites -- All DOE Office Websites (Extended Search)

North Linear Accelerator North Linear Accelerator Building Exterior Beam Enclosure Level Walk to the North Spreader North Recombiner Extras! North Linear Accelerator The North Linear Accelerator is one of the two long, straight sections of Jefferson Lab's accelerator. Electrons gain energy in this section by passing through acceleration cavities. There are 160 cavities in this straightaway, all lined up end to end. That's enough cavities to increase an electron's energy by 400 million volts each time it passes through this section. Electrons can pass though this section as many as five times! The cavities are powered by microwaves that travel down the skinny rectangular pipes from the service buildings above ground. Since the cavities won't work right unless they are kept very cold, they


Syntactic edges and linearization  

E-Print Network (OSTI)

In this thesis, I investigate the question of how the units of a linguistic expression are linearly ordered in syntax. In particular, I examine interactions between locality conditions on movement and the mapping between ...

Ko, Heejeong




Science Journals Connector (OSTI)

... each complete magnets with a pair of poles. The general character of the earth's magnetism has long been known—that the earth behaves with regard to magnets as though it ... and that these poles have a slow secular motion. For many years the earth's magnetism has been the subject of careful study by the most powerful minds. Gauss organized ...



Rotational and magnetic shunt permanent magnet quadrupoles with variable magnetic strength  

SciTech Connect

Next Linear Collider (NLC) and Very Large Hadron Collider (VLHC) projects suppose to use permanent magnets as bending, focusing and correcting elements. Prototypes of two permanent magnet quadrupoles with variable strength were built and successfully tested in Fermilab. Quadrupoles have 12.7 mm aperture diameter, 100 T/m gradient with an adjustment range of 0 to -20%. Special designs provide high precision magnetic center stability during strength change. SmCo5 permanent magnet bricks were used in these prototypes. Rotational quadrupole consists of four sections. Two central sections are rotated in counter directions to adjust the strength. Magnetic shunt quadrupole design provides variable shunting of the magnetic flux. The numerical simulation, designs, measuring results are described.

Vladimir Kashikhin et al.



Chiral Magnetic Effect from Q-balls  

E-Print Network (OSTI)

We apply a generic framework of linear sigma models for revealing a mechanism of the mysterious phenomenon, the chiral magnetic effect, in quark-gluon plasma. An electric current arises along a background magnetic field, which is given rise to by Q-balls (non-topological solitons) of the linear sigma model with axial anomaly. We find additional alternating current due to quark mass terms. The hadronic Q-balls, baby boson stars, may be created in heavy-ion collisions.

Minoru Eto; Koji Hashimoto; Hideaki Iida; Akitsugu Miwa



Earth’s magnetism  

Science Journals Connector (OSTI)

Earth’s magnetism, geomagnetism, terrestrial magnetism [The magnetism of the Earth] ? Erdmagnetismus m, Geomagnetismus




SciTech Connect

For RHIC's collision lattices the dominant sources of transverse non-linearities are located in the interaction regions. The field quality is available for most of the magnets in the interaction regions from the magnetic measurements, or from extrapolations of these measurements. We discuss the implementation of these measurements in the MADX models of the Blue and the Yellow rings and their impact on beam stability.




Linear Logic as CSP  

Science Journals Connector (OSTI)

......research-article Original Articles Linear Logic as CSP ERIC MONTEIRO Department of Informatics...translation from such proofs into a corresponding CSP process is offered. It is shown that the...between the cut elimination process and the CSP execution. Generalizations and related......




Linear Programming Environmental  

E-Print Network (OSTI)

Linear Program to control air pollution was developed in 1968 by Teller, which minimized cost Fall 2006 #12;Topics · Introduction · Background · Air · Land · Water #12;Introduction · "The United States spends more than 2% of its gross domestic product on pollution control, and this is more than any

Nagurney, Anna


Depth-dependent magnetism in epitaxial MnSb thin films: effects of surface passivation and cleaning  

SciTech Connect

Depth-dependent magnetism in MnSb(0001) epitaxial films has been studied by combining experimental methods with different surface specificities: polarized neutron reflectivity, x-ray magnetic circular dichroism (XMCD), x-ray resonant magnetic scattering and spin-polarized low energy electron microscopy (SPLEEM). A native oxide {approx}4.5 nm thick covers air-exposed samples which increases the film's coercivity. HCl etching efficiently removes this oxide and in situ surface treatment of etched samples enables surface magnetic contrast to be observed in SPLEEM. A thin Sb capping layer prevents oxidation and preserves ferromagnetism throughout the MnSb film. The interpretation of Mn L{sub 3,2} edge XMCD data is discussed.

Aldous J. D.; Sanchez-Hanke C.; Burrows, C.W.; Maskery, I.; Brewer, M.S.; Hase, T.P.A.; Duffy, J.A.; Lees, M. Rs; Decoster, T.; Theis, W.; Quesada, A.; Schmid, A.K.; Bell, G.R.



Linear Fixed-Field Multi-Pass Arcs for Recirculating Linear Accelerators  

SciTech Connect

Recirculating Linear Accelerators (RLA's) provide a compact and efficient way of accelerating particle beams to medium and high energies by reusing the same linac for multiple passes. In the conventional scheme, after each pass, the different energy beams coming out of the linac are separated and directed into appropriate arcs for recirculation, with each pass requiring a separate fixed-energy arc. In this paper we present a concept of an RLA return arc based on linear combined-function magnets, in which two and potentially more consecutive passes with very different energies are transported through the same string of magnets. By adjusting the dipole and quadrupole components of the constituting linear combined-function magnets, the arc is designed to be achromatic and to have zero initial and final reference orbit offsets for all transported beam energies. We demonstrate the concept by developing a design for a droplet-shaped return arc for a dog-bone RLA capable of transporting two beam passes with momenta different by a factor of two. We present the results of tracking simulations of the two passes and lay out the path to end-to-end design and simulation of a complete dog-bone RLA.

V.S. Morozov, S.A. Bogacz, Y.R. Roblin, K.B. Beard



Homogeneous Charge Compression Ignition Free Piston Linear Alternator  

SciTech Connect

An experimental and theoretical investigation of a homogeneous charge compression ignition (HCCI) free piston powered linear alternator has been conducted to determine if improvements can be made in the thermal and conversion efficiencies of modern electrical generator systems. Performance of a free piston engine was investigated using a rapid compression expansion machine and a full cycle thermodynamic model. Linear alternator performance was investigated with a computer model. In addition linear alternator testing and permanent magnet characterization hardware were developed. The development of the two-stroke cycle scavenging process has begun.

Janson Wu; Nicholas Paradiso; Peter Van Blarigan; Scott Goldsborough



Wave propagation in the magnetic sun  

E-Print Network (OSTI)

This paper reports on efforts to simulate wave propagation in the solar interior. Presented is work on extending a numerical code for constant entropy acoustic waves in the absence of magnetic fields to the case where magnetic fields are present. A set of linearized magnetohydrodynamic (MHD) perturbation equations has been derived and implemented.

T. Hartlep; M. S. Miesch; N. N. Mansour



Linear Collider Collaboration Tech Notes LCC-0110  

NLE Websites -- All DOE Office Websites (Extended Search)

0 0 December 2002 Post-Target Beamline Design for Proposed FFTB Experiment with Polarized Positrons Y. K. Batygin and J. C. Sheppard Stanford Linear Accelerator Center Stanford University Menlo Park, CA 04025 Abstract: The beamline after positron production target for the proposed experiment E-166 is discussed. The beamline includes bending magnets and solenoid to deliver polarized positron beam from the target to polarimeter. Results of simulation indicate that transmission efficiency of 1...3 % with beam polarization of 60...80 % can be obtained if beam energy resolution is required while the transmission of 40...77 % and polarization of 40% can be obtained without beam energy resolution. 13 December 2002


Modern Magnetism  

Science Journals Connector (OSTI)

... BATES‘S "Modern Magnetism", first published in 1939, is widely appreciated as a general survey in which ... grateful to the author for collecting together so much interesting information about recent work in magnetism. ...

E. C. S.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Superconducting Magnet Division | Brookhaven National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Superconducting Magnet Division Superconducting Magnet Division Home Production & Testing LHC Dipole Acceptance APUL Schedule (pdf) Projects Main Projects HTS Magnet Program High Field Magnet R&D Linear Collider Final Focus e Lens Solenoid Correctors for J-PARC Correctors for SuperKEKB IR Magnets LARP APUL Past Projects BEPC-II IR Quadrupoles Bio-Med Variable Field MRI GSI Rapid Cycling Magnets Helical Magnets HERA upgrade LHC IR Dipoles RHIC Publications Search Publications Selected Cryogenic Data Notebook Proceedings of the 1968 Summer Study on Superconducting Devices and Accelerators Meetings & Workshops Safety Environmental, Safety & Health ES&H Documents Lockout-Tagout Personnel Staff Pages Ramesh Gupta Brett Parker Peter Wanderer Pe ter Wanderer, head of Brookhaven's Superconducting Magnet Division,


Linear induction accelerator  

DOE Patents (OSTI)

A linear induction accelerator includes a plurality of adder cavities arranged in a series and provided in a structure which is evacuated so that a vacuum inductance is provided between each adder cavity and the structure. An energy storage system for the adder cavities includes a pulsed current source and a respective plurality of bipolar converting networks connected thereto. The bipolar high-voltage, high-repetition-rate square pulse train sets and resets the cavities. 4 figs.

Buttram, M.T.; Ginn, J.W.



Combustion powered linear actuator  

DOE Patents (OSTI)

The present invention provides robotic vehicles having wheeled and hopping mobilities that are capable of traversing (e.g. by hopping over) obstacles that are large in size relative to the robot and, are capable of operation in unpredictable terrain over long range. The present invention further provides combustion powered linear actuators, which can include latching mechanisms to facilitate pressurized fueling of the actuators, as can be used to provide wheeled vehicles with a hopping mobility.

Fischer, Gary J. (Albuquerque, NM)



Magnetic navigation an attractive possibility  

Science Journals Connector (OSTI)

...that they contained a generally linear string of as many as 20 cuboidal particles...mag-netotacticum is provided by the string of magnetite particles that appear as...Exposure to a 10-millitesla magnetic field oscillating at 2000 hertz significantly accelerated...

TH Maugh 2nd



Migratory magnetism  

Science Journals Connector (OSTI)

... in tune with the Earth's magnetic field. But how, exactly, do creatures sense magnetism? This is one of the most intriguing questions in modern biology - and also ... move preferentially in a north-south direction. This finding hints at the possible influence of magnetism on their movements. ...

Henry Gee



Site-Selective Determination of Magnetic Helices in BaTiCoFe{sub 10}O{sub 19} by Resonant Magnetic Scattering  

SciTech Connect

Synchrotron radiation intensity measurements were made for single crystals of ferrimagnetic BaTiCoFe{sub 10}O{sub 19} at the BL-6C(3A) beamline of the Photon Factory. The resonant x-ray magnetic scattering (RXMS) method at the Fe K edge makes it possible to determine the magnetic crystal structure, having the magnetic helices for Fe ions in tetrahedral 4f{sub 1}, bipyramidal 2b, and octahedral 2a, 4f{sub 2} and 12k sites. Based on the information on x-ray magnetic circular dichroism (XMCD) and a resonant magnetic scattering factor f''{sub m} ( = 0.23) estimated from BaFe{sub 12}O{sub 19} at E = 7128.2 eV, the magnetic structures have been determined from an asymmetrical ratio {Delta}R (Y{sup +}-Y{sup -})/(Y{sup +}+Y{sup -}), where Y{sup +} and Y{sup -} are scattering intensities for left- and right-circular polarizations, respectively. Spin orientations were estimated in the least-squares procedure to minimize a residual factor of {Sigma}({Delta}R{sub obs}-{Delta}R{sub calc}){sup 2}. The canting angles estimated in this study are 180 deg., 19 deg., 118 deg., 180 deg. and 65 deg. for the magnetic moments of Fe ions in 4f{sub 1}, 2b, 2a, 4f{sub 2} and 12k sites, respectively.

Okube, Maki; Kaneko, Yuhei; Ohsawa, Seiji; Sasaki, Satoshi [Materials and Structures Laboratory, Tokyo Institute of Technology, Nagatsuta 4259, Yokohama 226-8503 (Japan); Toyoda, Takeshi [Industrial Research Institute of Ishikawa, Kuratsuki 2-1, Kanazawa 920-8203 (Japan); Mori, Takeharu [Photon Factory, Institute of Materials Structure Science, KEK, Oho 1-1, Tsukuba 305-0801 (Japan)



Position sensor for linear synchronous motors employing halbach arrays  

DOE Patents (OSTI)

A position sensor suitable for use in linear synchronous motor (LSM) drive systems employing Halbach arrays to create their magnetic fields is described. The system has several advantages over previously employed ones, especially in its simplicity and its freedom from being affected by weather conditions, accumulated dirt, or electrical interference from the LSM system itself.

Post, Richard Freeman



Magnetic Testing of Bonded Magnets  

Science Journals Connector (OSTI)

Many techniques exist to characterize the magnetic properties of bonded magnets. We will review the common and not so common techniques in use, with emphasis on the advantages and disadvantages of each one, an...

S. R. Trout



Magnetic-Field-Induced Assemblies of Cobalt Nanoparticles  

Science Journals Connector (OSTI)

8 Magnetic fields have also been used to create 2D assemblies of magnetic nanoparticles at the liquid?air interface9 and 1D assembled chains or 2D rings on solid substrates or TEM grids. ... A magnet (Fisher Scientific, Pittsburgh, PA) with a 0.05-Telsa magnetic field strength was placed near the side wall of the glass vial. ... The interparticle magnetic dipole?dipole couplings and the external coupling of the magnetic dipoles to the field favor linear chain growth along the magnetic-field flux lines. ...

Guangjun Cheng; Danilo Romero; Gerald T. Fraser; A. R. Hight Walker



Optimisation and comparison of integrated models of direct-drive linear machines for wave energy conversion   

E-Print Network (OSTI)

Combined electrical and structural models of five types of permanent magnet linear electrical machines suitable for direct-drive power take-off on wave energy applications are presented. Electromagnetic models were ...

Crozier, Richard Carson



Generalized universal instability: Transient linear amplification and subcritical turbulence  

E-Print Network (OSTI)

In this work we numerically demonstrate both significant transient (i.e. non-modal) linear amplification and sustained nonlinear turbulence in a kinetic plasma system with no unstable eigenmodes. The particular system considered is an electrostatic plasma slab with magnetic shear, kinetic electrons and ions, weak collisions, and a density gradient, but with no temperature gradient. In contrast to hydrodynamic examples of non-modal growth and subcritical turbulence, here there is no sheared flow in the equilibrium. Significant transient linear amplification is found when the magnetic shear and collisionality are weak. It is also demonstrated that nonlinear turbulence can be sustained if initialized at sufficient amplitude. We prove these two phenomena are related: when sustained turbulence occurs without unstable eigenmodes, states that are typical of the turbulence must yield transient linear amplification of the gyrokinetic free energy.

Landreman, Matt; Dorland, William



Linear Fresnel | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Linear Fresnel systems, which are a type of linear concentrator, are active in Germany, Spain, Australia, India, and the United States. The SunShot Initiative funds R&D on...


History of Proton Linear Accelerators  

E-Print Network (OSTI)

the board to show why the accelerator couldn't work. Then atmuch. References 1. Linear Accelerators, edited by P. M .at the 1986 Linear Accelerator Conference, SLAC, Stanford,

Alvarez, Luis W.



History of Proton Linear Accelerators  

DOE R&D Accomplishments (OSTI)

Some personal recollections are presented that relate to the author`s experience developing linear accelerators, particularly for protons. (LEW)

Alvarez, L. W.



Magnetic K-edge absorption in 3d elements and its relation to local magnetic structure  

Science Journals Connector (OSTI)

In this paper we present a selection of circular magnetic x-ray dichroism (CMXD) measurements at the K edges of Fe, Ni, Co, and Mn in various alloys and compounds. We investigate the correlation between the measured spin-dependent absorption signal and the p-like spin polarization of the unoccupied bands at the Fermi level. In the case of Fe we find a direct correlation of the spin-dependent absorption profile to the p-like spin polarizations. This is discussed for various alloys. The measured CMXD signals are compared with theoretical calculations for the absorption spectra. For Fe and Ni we have performed spin-polarized relativistic Korringa-Kohn-Rostoker Green’s function calculations, which give a parameter-free description of the spin-dependent absorption process. The content of information in the experimental CMXD spectra on the local magnetic p and d moments is discussed in comparison with the calculated changes of the p and d moments. In the case of the Co and Ni K edges we find a direct correlation of the average strength of the spin-dependent absorption signal to the p moment. For Co also a direct correlation to the d moment is indicated. At Fe K edges no proportionality of any features of the spin-dependent absorption profile to p or d moments have been found.

S. Stähler, G. Schütz, and H. Ebert



Electronic structures and magnetic moments of Co{sub 3}FeN thin films grown by molecular beam epitaxy  

SciTech Connect

We evaluated electronic structures and magnetic moments in Co{sub 3}FeN epitaxial films on SrTiO{sub 3}(001). The experimentally obtained hard x-ray photoemission spectra of the Co{sub 3}FeN film have a good agreement with those calculated. Site averaged spin magnetic moments deduced by x-ray magnetic circular dichroism were 1.52 ?{sub B} per Co atom and 2.08 ?{sub B} per Fe atom at 100 K. They are close to those of Co{sub 4}N and Fe{sub 4}N, respectively, implying that the Co and Fe atoms randomly occupy the corner and face-centered sites in the Co{sub 3}FeN unit cell.

Ito, Keita; Sanai, Tatsunori; Yasutomi, Yoko; Toko, Kaoru; Honda, Syuta; Suemasu, Takashi [Institute of Applied Physics, Graduate School of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8573 (Japan)] [Institute of Applied Physics, Graduate School of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8573 (Japan); Zhu, Siyuan; Kimura, Akio [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan)] [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Ueda, Shigenori [Synchrotron X-ray Station at SPring-8, National Institute for Materials Science (NIMS), 1-1-1 Kouto, Sayo-cho, Hyogo 679-5148 (Japan)] [Synchrotron X-ray Station at SPring-8, National Institute for Materials Science (NIMS), 1-1-1 Kouto, Sayo-cho, Hyogo 679-5148 (Japan); Takeda, Yukiharu; Saitoh, Yuji [Condensed Matter Science Division, Japan Atomic Energy Agency (JAEA), 1-1-1 Kouto, Sayo-cho, Hyogo 679-5148 (Japan)] [Condensed Matter Science Division, Japan Atomic Energy Agency (JAEA), 1-1-1 Kouto, Sayo-cho, Hyogo 679-5148 (Japan); Imai, Yoji [Institute of Applied Physics, Graduate School of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8573 (Japan) [Institute of Applied Physics, Graduate School of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8573 (Japan); National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba Central 5, 1-1-1 Higashi, Tsukuba, Ibaraki 305-8565 (Japan)



Modified Magnetic Ground State in Nimn (2) O (4) Thin Films  

SciTech Connect

The authors demonstrate the stabilization of a magnetic ground state in epitaxial NiMn{sub 2}O{sub 4} (NMO) thin films not observed in their bulk counterpart. Bulk NMO exhibits a magnetic transition from a paramagnetic phase to a collinear ferrimagnetic moment configuration below 110 K and to a canted moment configuration below 70 K. By contrast, as-grown NMO films exhibit a single magnetic transition at 60 K and annealed films exhibit the magnetic behavior found in bulk. Cation inversion and epitaxial strain are ruled out as possible causes for the new magnetic ground state in the as-grown films. However, a decrease in the octahedral Mn{sup 4+}:Mn{sup 3+} concentration is observed and likely disrupts the double exchange that produces the magnetic state at intermediate temperatures. X-ray magnetic circular dichroism and bulk magnetometry indicate a canted ferrimagnetic state in all samples at low T. Together these results suggest that the collinear ferrimagnetic state observed in bulk NMO at intermediate temperatures is suppressed in the as grown NMO thin films due to a decrease in octahedral Mn{sup 4+}, while the canted moment ferrimagnetic ordering is preserved below 60 K.

Nelson-Cheeseman, B.B.; Chopdekar, R.V.; Iwata, J.M.; Toney, M.F.; Arenholz, E.; Suzuki, Y.; /SLAC



Capillary instability of the cylindrical interface between ferrofluids in a magnetic field with circular field lines  

Science Journals Connector (OSTI)

Capillary breakup of a viscous magnetic fluid layer subjected to a gradient magnetic field under hydroweightlessness is studied within the linear theory. The cylinder surface of a current-carrying conductor se...

V. M. Korovin



Linear concentrating solar collector  

SciTech Connect

The present invention relates to a segment of a linear concentrating solar collector which includes two plates distanced from each other and extending parallel to each other; a member connects the plates to each other and holes are bored in each of the plates in a parallel manner along a parabolic curve. A member passes through the holes each holding a small strip made of a reflecting material all strips together forming a parabolic surface. The invention relates also to a collector comprising at least two of each segments and an absorber extending along the focus line of the entire collector. The collector is advantageously provided with horizontal and/or vertical members which ascertains that the collector can follow the position of the sun.

Aharon, N. B.



Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines. 3 figs.

Kerns, J.A.; Stone, R.R.; Fabyan, J.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, John A. (Livermore, CA); Stone, Roger R. (Walnut Creek, CA); Fabyan, Joseph (Livermore, CA)



Strange Magnetism  

E-Print Network (OSTI)

We present an analytic and parameter-free expression for the momentum dependence of the strange magnetic form factor of the nucleon and its corresponding radius which has been derived in Heavy Baryon Chiral Perturbation Theory. We also discuss a model-independent relation between the isoscalar magnetic and the strange magnetic form factors of the nucleon based on chiral symmetry and SU(3) only. These limites are used to derive bounds on the strange magnetic moment of the proton from the recent measurement by the SAMPLE collaboration.

Thomas R. Hemmert; Ulf-G. Meissner; Sven Steininger



Optical Magnetism  

Science Journals Connector (OSTI)

Magnetic dipole radiation one fourth as intense as electric dipole radiation, as well as a novel nonlinear magneto-optical effect are reported in dielectric media.

Oliveira, Samuel L; Rand, Stephen C


High force density linear permanent magnet motors : "electromagnetic muscle actuators"  

E-Print Network (OSTI)

Actuator performance represents a key constraint on the capability of many engineered devices. Performance of these devices is often exceeded by their muscle-powered natural counterparts, inspiring the development of new, ...

Ruddy, Bryan P. (Bryan Paul), 1983-



Magnetic Field Safety Magnetic Field Safety  

E-Print Network (OSTI)

Magnetic Field Safety Training #12;Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain medical conditions such as pacemakers, magnetic implants, or embedded shrapnel. In addition, high magnetic

McQuade, D. Tyler


II MODEL AND FEEDBACK LINEARIZING CONTROLLER 1 A Multilayer Perceptron Replaces a Feedback  

E-Print Network (OSTI)

in a permanent magnetic field DC Programa de P'os Gradua¸c~ao em Engenharia El'etrica, Pontif'icia Universidade magnetic field DC motor connected to a load via a gear train. The nonlinear load is a shaft with a mass and Feedback Linearizing Controller The servomechanism studied in this research consists of a permanent

Amaral, José Nelson


Vector optical fields with polarization distributions similar to electric and magnetic field lines  

Science Journals Connector (OSTI)

We present, design and generate a new kind of vector optical fields with linear polarization distributions modeling to electric and magnetic field lines. The geometric configurations...

Pan, Yue; Li, Si-Min; Mao, Lei; Kong, Ling-Jun; Li, Yongnan; Tu, Chenghou; Wang, Pei; Wang, Hui-Tian



Magnetic Field Safety Training  

NLE Websites -- All DOE Office Websites (Extended Search)

Safety Training Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain...


Magnetic insulation  

Science Journals Connector (OSTI)

... by Winterberg1, led me to look into the background of the idea of 'magnetic insulation'. The purpose of this letter is to point out that the scheme described in ... were presented earlier in a longer article2. In that article he suggested that 'magnetic insulation' might make possible a transformer for 109 V. A year later the same objections ...





Science Journals Connector (OSTI)

... is reached, the rate of diminution becomes very rapid indeed, until, finally, the magnetism of the iron disappears at the same time as for small forces. Instead of ... a lower maximum, and its rise is less rapid. The critical temperature at which magnetism disappears changes rapidly with the composition of the steel. For very soft charcoal iron ...



Magnetism Group  

Science Journals Connector (OSTI)

... of the Institute of Physics and the Physical Society has announced the establishment of a Magnetism Group. The aim of the new Group is to further interest in ... Group. The aim of the new Group is to further interest in magnetism by holding regular discussion meetings and in other ways. It is intended that these ...



Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... A similar investigation of the effect of the moon's action on terrestrial magnetism requires a series of observations made at much less distant intervals than the monthly ones ... heat, from the central body of our system, or merely having its own inherent magnetism modified by solar action, then we must choose as our unit the lunation, or ...



Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... IN bringing before you this evening, gentlemen, the subject of terrestrial magnetism, it is not my intention to attempt to present you with an exhaustive paper ... clearly as I am able, what is the actual condition of our knowledge respecting the magnetism of the globe, and what the nature of its complex variations, without, however, ...



Terrestrial Magnetism  

Science Journals Connector (OSTI)

... THE present activity of the department of terrestrial magnetism of the Carnegie Institution of Washington and the largeness of its future aims are alike ... a “progress report” which he contributes to the latest (March) number of Terrestrial Magnetism. The department, which has lately entered on its eleventh year, has under construetion ...




Remanent Magnetism  

Science Journals Connector (OSTI)

... STUDY of the natural remanent magnetism of rocks is becoming a familiar method for determining the direction of the Earth's ... the geomagnetic poles or of the continents themselves. An alternative use for measurements of remanent magnetism, namely, the determination of the temperature of formation of pyroclastic deposits, is described ...



Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, J.A.; Stone, R.R.; Fabyan, J.



Linear and Non Linear Analysis of the Hadley Circulation  

Science Journals Connector (OSTI)

We present a synthesis of results obtained with the linear stability of the one-cell Hadley circulation. This flow is observe in the...

P. Laure; B. Roux



Superconducting Magnets  

NLE Websites -- All DOE Office Websites (Extended Search)

Mit Hilfe der Technologie supraleitender Magnete lassen sich in Mit Hilfe der Technologie supraleitender Magnete lassen sich in Ringbeschleunigern höhere Energien erreichen. Weil supraleitende Spulen keinen elektrischen Widerstand aufweisen, können damit stärkere Magnetfelder erzeugt werden. In normal leitenden Elektromagneten wird - wegen des elektrischen Widerstands der Drähte - die Spule aufgeheizt. Auf diese Weise geht sehr viel Energie in Form von Wärme verloren, was die Energiekosten dieser Magnete in die Höhe treibt. Supraleitende Spulen erlauben es, Magnete grosser Feldstärke unter günstigen Bedingungen zu betreiben und damit die Energiekosten zu senken. Durch den Einbau supraleitender Spulen in den Ringbeschleuniger von Fermilab konnte dessen Energie verdoppelt werden.Auch der im Bau befindliche "Large Hadron Collider" am CERN wird supraleitende Magnete


Magnetic nanotubes  

DOE Patents (OSTI)

A magnetic nanotube includes bacterial magnetic nanocrystals contacted onto a nanotube which absorbs the nanocrystals. The nanocrystals are contacted on at least one surface of the nanotube. A method of fabricating a magnetic nanotube includes synthesizing the bacterial magnetic nanocrystals, which have an outer layer of proteins. A nanotube provided is capable of absorbing the nanocrystals and contacting the nanotube with the nanocrystals. The nanotube is preferably a peptide bolaamphiphile. A nanotube solution and a nanocrystal solution including a buffer and a concentration of nanocrystals are mixed. The concentration of nanocrystals is optimized, resulting in a nanocrystal to nanotube ratio for which bacterial magnetic nanocrystals are immobilized on at least one surface of the nanotubes. The ratio controls whether the nanocrystals bind only to the interior or to the exterior surfaces of the nanotubes. Uses include cell manipulation and separation, biological assay, enzyme recovery, and biosensors.

Matsui, Hiroshi (Glen Rock, NJ); Matsunaga, Tadashi (Tokyo, JP)



Berkeley Proton Linear Accelerator  

DOE R&D Accomplishments (OSTI)

A linear accelerator, which increases the energy of protons from a 4 Mev Van de Graaff injector, to a final energy of 31.5 Mev, has been constructed. The accelerator consists of a cavity 40 feet long and 39 inches in diameter, excited at resonance in a longitudinal electric mode with a radio-frequency power of about 2.2 x 10{sup 6} watts peak at 202.5 mc. Acceleration is made possible by the introduction of 46 axial "drift tubes" into the cavity, which is designed such that the particles traverse the distance between the centers of successive tubes in one cycle of the r.f. power. The protons are longitudinally stable as in the synchrotron, and are stabilized transversely by the action of converging fields produced by focusing grids. The electrical cavity is constructed like an inverted airplane fuselage and is supported in a vacuum tank. Power is supplied by 9 high powered oscillators fed from a pulse generator of the artificial transmission line type.

Alvarez, L. W.; Bradner, H.; Franck, J.; Gordon, H.; Gow, J. D.; Marshall, L. C.; Oppenheimer, F. F.; Panofsky, W. K. H.; Richman, C.; Woodyard, J. R.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Unit I-3 Linear Independence & Bases 1 Linear independence & bases  

E-Print Network (OSTI)

} ­ so we can write u1 = c2u2 + c3u3 + ... + crur with not all ci = 0 ­ re-arranging gives a non-zero lc u1 - c2u2 - c3u3 - ... - crur = 0 so the vectors are linearly dependent ! Unit I-3 Linear

Birkett, Stephen


Magnetism in small vanadium clusters  

Science Journals Connector (OSTI)

Using the self-consistent-field molecular-orbital theory and the density-functional approximation, we show that vanadium could become magnetic if its size and dimension were constrained. This is illustrated for vanadium forming clusters with body-centered-cubic (bcc) geometry as well as for linear chains. The magnetic moment of the bcc clusters is found to vanish abruptly as the size increases, while the clusters always retain their moment in the linear-chain configurations. The moments are also found to be finite for large interatomic spacings irrespective of the cluster topology, and tend to vanish when the interatomic distances are reduced. The results are explained by using a simple Stoner criterion.

Feng Liu; S. N. Khanna; P. Jena



Low dimensional magnetism  

E-Print Network (OSTI)

Magnetism in Ultracold Gases 4 Magnetic phase diagram of aMagnetism . . . . . . . . . . . .1.3 Magnetism in condensedIntroduction 1 Brief introduction to magnetism 1.1 Classic

Kjall, Jonas Alexander



Linear Collider Collaboration Tech Notes LCC-0109  

NLE Websites -- All DOE Office Websites (Extended Search)

9 9 TESLA 2002-11 CBP Tech Note-269 November 2002 Alignment Stability Models for Damping Rings Andrej Wolski Lawrence Berkeley National Laboratory University of California Berkeley, CA Winfried Decking Deutsches Elektron Synchrotron (DESY) Hamburg, Germany Abstract: Linear collider damping rings are highly sensitive to magnet alignment. Emittance tuning simulations for current designs of damping rings for TESLA and NLC have given encouraging results, but depend on invasive measurements of dispersion. The frequency with which such measurements must be made is therefore an operational issue, and depends on the time stability of the alignment. In this note, we consider three effects that lead to misalignment and the need to retune the damping ring: (1)


Magnetic Viscosity  

Science Journals Connector (OSTI)

1 January 1893 research-article Magnetic Viscosity J. Hopkinson E. Wilson F. Lydall The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Proceedings of the Royal Society of London. www.jstor.org



Rock magnetism  

Science Journals Connector (OSTI)

The past three decades have witnessed a new paradigm, the plate tectonics paradigm, in Earth sciences. The record of the Earth's magnetic field stored in rocks played a major role in the establishment of this par...

Ronald T. Merrill



Learning About Magnets!  

NLE Websites -- All DOE Office Websites (Extended Search)

the the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a force that can "attract" or "repel" other magnets and magnetic materials, like iron or nickel. What is a Magnet? This bar magnet is a permanent magnet. Permanent magnets can be found in the Earth as rocks and metals. Magnets have


Controlling Magnetism at the Nanoscale  

E-Print Network (OSTI)

Manipulation of Magnetism - External148 Conclusion A The Magnetism Cheat Sheet A.1 Magnetic157 A.2 Magnetism Unit Conversion

Wong, Jared



Radio-frequency quadrupole resonator for linear accelerator  

DOE Patents (OSTI)

An RFQ resonator for a linear accelerator having a reduced level of interfering modes and producing a quadrupole mode for focusing, bunching and accelerating beams of heavy charged particles, with the construction being characterized by four elongated resonating rods within a cylinder with the rods being alternately shorted and open electrically to the shell at common ends of the rods to provide an LC parallel resonant circuit when activated by a magnetic field transverse to the longitudinal axis.

Moretti, A.



Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

1 03/12/99 1 03/12/99 NLC Damping Ring Wiggler Studies 1999 December 3, 1999 J. Corlett, N. Hartmann, K. Kennedy, G. Koehler, S. Marks, J. Rasson, T. Saleh Lawrence Berkeley National Laboratory Berkeley, CA, USA Abstract: The primary objective of FY99 was to develop credible conceptual wiggler requirements. Three magnet technologies were considered: electromagnet, hybrid permanent magnet and superconducting. Based upon an early assessment of requirements, a hybrid magnet similar to existing designs, with appropriate modification of gap and period, satisfies basic requirements. However, radiation damage is potentially a serious problem for the ND-FE-B permanent magnet material, and cost remains an issue for samarium cobalt magnets. Therefore the primary effort was put into developing a radiation-hard electromagnet wiggler conceptual


Astrophysical Gyrokinetics: Basic Equations and Linear Theory  

E-Print Network (OSTI)

Magnetohydrodynamic (MHD) turbulence is encountered in a wide variety of astrophysical plasmas, including accretion disks, the solar wind, and the interstellar and intracluster medium. On small scales, this turbulence is often expected to consist of highly anisotropic fluctuations with frequencies small compared to the ion cyclotron frequency. For a number of applications, the small scales are also collisionless, so a kinetic treatment of the turbulence is necessary. We show that this anisotropic turbulence is well described by a low frequency expansion of the kinetic theory called gyrokinetics. This paper is the first in a series to examine turbulent astrophysical plasmas in the gyrokinetic limit. We derive and explain the nonlinear gyrokinetic equations and explore the linear properties of gyrokinetics as a prelude to nonlinear simulations. The linear dispersion relation for gyrokinetics is obtained and its solutions are compared to those of hot-plasma kinetic theory. These results are used to validate the performance of the gyrokinetic simulation code {\\tt GS2} in the parameter regimes relevant for astrophysical plasmas. New results on global energy conservation in gyrokinetics are also derived. We briefly outline several of the problems to be addressed by future nonlinear simulations, including particle heating by turbulence in hot accretion flows and in the solar wind, the magnetic and electric field power spectra in the solar wind, and the origin of small-scale density fluctuations in the interstellar medium.

Gregory G. Howes; Steven C. Cowley; William Dorland; Gregory W. Hammett; Eliot Quataert; Alexander A. Schekochihin



Linear wave propagation in relativistic magnetohydrodynamics  

Science Journals Connector (OSTI)

The properties of linear Alfvén slow and fast magnetoacoustic waves for uniform plasmas in relativistic magnetohydrodynamics(MHD) are discussed augmenting the well-known expressions for their phase speeds with knowledge on the group speed. A 3 + 1 formalism is purposely adopted to make direct comparison with the Newtonian MHD limits easier and to stress the graphical representation of their anisotropic linear wave properties using the phase and group speed diagrams. By drawing these for both the fluid rest frame and for a laboratory Lorentzian frame which sees the plasma move with a three-velocity having an arbitrary orientation with respect to the magnetic field a graphical view of the relativistic aberrationeffects is obtained for all three MHD wave families. Moreover it is confirmed that the classical Huygens construction relates the phase and group speed diagram in the usual way even for the lab frame viewpoint. Since the group speed diagrams correspond to exact solutions for initial conditions corresponding to a localized point perturbation their formulae and geometrical construction can serve to benchmark current high-resolution algorithms for numerical relativistic MHD.

R. Keppens; Z. Meliani



Linear wave propagation in relativistic magnetohydrodynamics  

E-Print Network (OSTI)

The properties of linear Alfv\\'en, slow, and fast magnetoacoustic waves for uniform plasmas in relativistic magnetohydrodynamics (MHD) are discussed, augmenting the well-known expressions for their phase speeds with knowledge on the group speed. A 3+1 formalism is purposely adopted to make direct comparison with the Newtonian MHD limits easier and to stress the graphical representation of their anisotropic linear wave properties using the phase and group speed diagrams. By drawing these for both the fluid rest frame and for a laboratory Lorentzian frame which sees the plasma move with a three-velocity having an arbitrary orientation with respect to the magnetic field, a graphical view of the relativistic aberration effects is obtained for all three MHD wave families. Moreover, it is confirmed that the classical Huygens construction relates the phase and group speed diagram in the usual way, even for the lab frame viewpoint. Since the group speed diagrams correspond to exact solutions for initial conditions co...

Keppens, R



Linear wave propagation in relativistic magnetohydrodynamics  

SciTech Connect

The properties of linear Alfven, slow, and fast magnetoacoustic waves for uniform plasmas in relativistic magnetohydrodynamics (MHD) are discussed, augmenting the well-known expressions for their phase speeds with knowledge on the group speed. A 3+1 formalism is purposely adopted to make direct comparison with the Newtonian MHD limits easier and to stress the graphical representation of their anisotropic linear wave properties using the phase and group speed diagrams. By drawing these for both the fluid rest frame and for a laboratory Lorentzian frame which sees the plasma move with a three-velocity having an arbitrary orientation with respect to the magnetic field, a graphical view of the relativistic aberration effects is obtained for all three MHD wave families. Moreover, it is confirmed that the classical Huygens construction relates the phase and group speed diagram in the usual way, even for the lab frame viewpoint. Since the group speed diagrams correspond to exact solutions for initial conditions corresponding to a localized point perturbation, their formulae and geometrical construction can serve to benchmark current high-resolution algorithms for numerical relativistic MHD.

Keppens, R. [Centre for Plasma-Astrophysics, K.U. Leuven, Celestijnenlaan 200B, 3001 Heverlee (Belgium); Leuven Mathematical Modeling and Computational Science Centre, K.U. Leuven (Belgium); FOM-Institute for Plasma Physics, P.O. Box 1207, 3430 BE Nieuwegein (Netherlands) and Astronomical Institute, Utrecht University (Netherlands); Meliani, Z. [Centre for Plasma-Astrophysics, K.U. Leuven, Celestijnenlaan 200B, 3001 Heverlee (Belgium)



Linear wave propagation in relativistic magnetohydrodynamics  

E-Print Network (OSTI)

The properties of linear Alfv\\'en, slow, and fast magnetoacoustic waves for uniform plasmas in relativistic magnetohydrodynamics (MHD) are discussed, augmenting the well-known expressions for their phase speeds with knowledge on the group speed. A 3+1 formalism is purposely adopted to make direct comparison with the Newtonian MHD limits easier and to stress the graphical representation of their anisotropic linear wave properties using the phase and group speed diagrams. By drawing these for both the fluid rest frame and for a laboratory Lorentzian frame which sees the plasma move with a three-velocity having an arbitrary orientation with respect to the magnetic field, a graphical view of the relativistic aberration effects is obtained for all three MHD wave families. Moreover, it is confirmed that the classical Huygens construction relates the phase and group speed diagram in the usual way, even for the lab frame viewpoint. Since the group speed diagrams correspond to exact solutions for initial conditions corresponding to a localized point perturbation, their formulae and geometrical construction can serve to benchmark current high-resolution algorithms for numerical relativistic MHD.

R. Keppens; Z. Meliani



Neutrino magnetic moment in a magnetized plasma  

E-Print Network (OSTI)

The contribution of a magnetized plasma to the neutrino magnetic moment is calculated. It is shown that only part of the additional neutrino energy in magnetized plasma connecting with its spin and magnetic field strength defines the neutrino magnetic moment. It is found that the presence of magnetized plasma does not lead to the considerable increase of the neutrino magnetic moment in contrast to the results presented in literature previously.

N. V. Mikheev; E. N. Narynskaya



Nano and picosecond magnetization dynamics of weakly coupled CoFe/Cr/NiFe trilayers studied by a multitechnique approach  

Science Journals Connector (OSTI)

We present results on the magnetization dynamics in heterostructures of the CoFe/Cr/NiFe type. We have employed a combination of different layer-selective methods covering a broad range from quasistatic hysteresis measurements by x-ray magnetic circular dichroism (XMCD), over time-resolved photoemission electron microscopy (PEEM) at subnanosecond timescales to high-frequency ferromagnetic resonance (FMR) experiments. With increasing driving frequency, we found a different influence of the coupling between the two ferromagnetic layers on the dynamic behavior. Employing the spatial resolution of the PEEM method, we have been able to discern various dynamic responses in different regions of the sample that could be attributed to magnetodynamic processes with a different degree of coupling. In conjunction with the complementary FMR and XMCD measurements, we attribute the inhomogeneous influence of interlayer coupling to a shift from domain-wall-motion-dominated dynamics at low frequencies to precession-dominated dynamics at higher frequencies.

A. M. Kaiser; C. Schöppner; F. M. Römer; C. Hassel; C. Wiemann; S. Cramm; F. Nickel; P. Grychtol; C. Tieg; J. Lindner; C. M. Schneider



Symmetric interfacial reconstruction and magnetism in La0.7Ca0.3MnO3/YBa2Cu3O7/La0.7Ca0.3MnO3 heterostructures  

SciTech Connect

We have analyzed the interface structure and composition of La{sub 0.7}Ca{sub 0.3}MnO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7}/La{sub 0.7}Ca{sub 0.3}MnO{sub 3} trilayers by combined polarized neutron reflectometry, aberration-corrected microscopy, and atomic column resolution electron-energy-loss spectroscopy and x-ray absorption with polarization analysis. We find the same stacking sequence at both top and bottom cuprate interfaces. X-ray magnetic circular dichroism experiments show that both cuprate interfaces are magnetic with a magnetic moment induced in Cu atoms as expected from symmetric Mn-O-Cu superexchange paths. These results supply a solid footing for the applicability of recent theories explaining the interplay between magnetism and superconductivity in this system in terms of the induced Cu spin polarization at both interfaces.

Visani, C. [Universidad Complutense, Spain; Tornos, J. [Universidad Complutense, Spain; Nemes, Norbert [Universidad Complutense, Spain; Rocci, M. [Universidad Complutense, Spain; Leon, C. [Universidad Complutense, Spain; Santamaria, J. [Universidad Complutense, Spain; te Velthuis, G. E. [Argonne National Laboratory (ANL); Liu, Y. [Argonne National Laboratory (ANL); Hoffman, A. [Argonne National Laboratory (ANL); Freeland, J. W. [Argonne National Laboratory (ANL); Garcia-Hernandez, M [Instituto de Ciencia de Materiales de Madrid (ICMM); Fitzsimmons, M. R. [Los Alamos National Laboratory (LANL); Kirby, B. J. [Los Alamos National Laboratory (LANL); Varela del Arco, Maria [ORNL; Pennycook, Stephen J [ORNL



Modeling bubbles and droplets in magnetic fluids Mark S. Korlie, Arup Mukherjee, Bogdan G. Nita, John G.  

E-Print Network (OSTI)

and linear magnetic material are assumed and uniform imposed magnetic fields are considered, although of vertical fields, due to a combination of elongation along the field lines and the fluid dynamics. In both cases, #12;Modeling bubbles and droplets in magnetic fluids 2 an imposed magnetic field, even

Yecko, Philip


[New technology for linear colliders  

SciTech Connect

This report discusses the following topics on research of microwave amplifiers for linear colliders: Context in current microwave technology development; gated field emission for microwave cathodes; cathode fabrication and tests; microwave cathode design using field emitters; and microwave localization.

McIntyre, P.M.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Linear actuator powered flapping wing  

E-Print Network (OSTI)

Small scale unmanned aerial vehicles (UAVs) have proven themselves to be useful, but often too noisy for certain operations due to their rotary motors. This project examined the feasibility of using an almost silent linear ...

Benson, Christopher Lee




E-Print Network (OSTI)

(o Linear-finite-element-operator)) ;; initialize various fields that depend on the space ;; if coefficients is not defined, we set it to arrays of floating-point ;; zeros ...


Highly linear low noise amplifier  

E-Print Network (OSTI)

, the Low Noise Amplifier (LNA) is expected to provide high linearity, thus preventing the intermodulation tones created by the interference signal from corrupting the carrier signal. The research focuses on designing a novel LNA which achieves high...

Ganesan, Sivakumar



Linear Accelerator | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

(MeV). At 450 MeV, the electrons are relativistic: they are traveling at >99.999% of the speed of light, which is 299,792,458 meters second (186,000 milessecond). Photo: Linear...


Petroglyphs, Lighting, and Magnetism  

E-Print Network (OSTI)

1950 Electricity and Magnetism: Theory and Applications.I Petroglyphs, Lightning, and Magnetism | Walker Figure 8.I Petroglyphs, Lightning, and Magnetism | Walker Figure IL

Walker, Merle F




E-Print Network (OSTI)

Robust Linear Control of (Chaotic) Permanent-Magnet Synchronous Motors With Uncertainties Antonio Loría, Member, IEEE Abstract--We solve the problem of set-point (respectively, tracking) control of a permanent-magnet permanent-magnet synchronous machines (PMSM). This problem has attracted a number of researchers from

Boyer, Edmond


Cosmic Acceleration and Anisotropic models with Magnetic field  

E-Print Network (OSTI)

Plane symmetric cosmological models are investigated with or without any dark energy components in the field equations. Keeping an eye on the recent observational constraints concerning the accelerating phase of expansion of the universe, the role of magnetic field is assessed. The presence of magnetic field can favour an accelerating model even if we take a linear relationship between the directional Hubble parameters.

S. K. Tripathy; K. L. Mahanta



A linear MOSFET regulator for improving performance of the booster ramping power supplies at the APS.  

SciTech Connect

The APS booster ring uses ramping power supplies to power the sextupole, quadrupole, and dipole magnets as the beam energy ramps up linearly to 7 GeV. Due to the circuit topology used, those supplies are unable to follow the linear ramp to the desired accuracy. The best regulation achieved is 0.25% while 0.1% is desired. In addition to the unsatisfying regulation, those supplies are sensitive to AC line perturbation and are not able to reject AC line noises of more than a few tens of hertz. To improve the performance, a linear MOSFET regulation system using paralleled MOSFET devices in series with the power supply is proposed. The system uses a realtime current feedback loop to force the MOSFETs to work in the linear operation mode. By using this linear MOSFET regulator, the voltage drop on MOSFETs, and hence the voltage imposed on magnets, can be regulated very quickly. As a result, the regulation of the magnet current can be improved significantly. So far the simulation results show that with the linear regulator, the current regulation can be improved to better than 0.1%. Because of the high bandwidth of the linear regulator, it can reduce the harmonic content in the output current as well as reject the AC line disturbance. This paper discusses the circuit topology, the regulation method, and the simulation results.

Feng, G.; Deriy, B.; Wang, J.; Accelerator Systems Division (APS)



SunShot Initiative: Linear Fresnel  

NLE Websites -- All DOE Office Websites (Extended Search)

Linear Fresnel to someone by Linear Fresnel to someone by E-mail Share SunShot Initiative: Linear Fresnel on Facebook Tweet about SunShot Initiative: Linear Fresnel on Twitter Bookmark SunShot Initiative: Linear Fresnel on Google Bookmark SunShot Initiative: Linear Fresnel on Delicious Rank SunShot Initiative: Linear Fresnel on Digg Find More places to share SunShot Initiative: Linear Fresnel on AddThis.com... Concentrating Solar Power Systems Parabolic Trough Linear Fresnel Power Tower Dish Engine Components Competitive Awards Staff Photovoltaics Systems Integration Balance of Systems Linear Fresnel DOE funds solar research and development (R&D) in linear Fresnel systems as one of four CSP technologies aiming to meet the goals of the SunShot Initiative. Linear Fresnel systems, which are a type of linear


Magnetic Catalysis vs Magnetic Inhibition  

E-Print Network (OSTI)

We discuss the fate of chiral symmetry in an extremely strong magnetic field B. We investigate not only quark fluctuations but also neutral meson effects. The former would enhance the chiral-symmetry breaking at finite B according to the Magnetic Catalysis, while the latter would suppress the chiral condensate once B exceeds the scale of the hadron structure. Using a chiral model we demonstrate how neutral mesons are subject to the dimensional reduction and the low dimensionality favors the chiral-symmetric phase. We point out that this effect, the Magnetic Inhibition, can be a feasible explanation for recent lattice-QCD data indicating the decreasing behavior of the chiral-restoration temperature with increasing B.

Kenji Fukushima; Yoshimasa Hidaka



Magnetic Particle Process Improvement  

SciTech Connect

The magnetic particle testing process is performed to find linear, surface and near surface discontinuities in ferromagnetic test materials. A wet fluorescent method is used at Honeywell Federal Manufacturing & Technologies (FM&T). This method employs a liquid carrier mixed with iron oxide particles in suspension, and the particles used in the method are coated with a fluorescent dye to make them visible under a black light. The process in its current state employs the use of a tank of liquid solution of a mineral oil carrier with iron oxide particles in suspension. The change to the use of an aerosol delivery system with the same material reduces the amount of waste involved in the process while preserving the sensitivity of the testing, shortens the flowtime for the test, and saves labor and material costs.

Hubert, R.R.



Experimental Validation of a Numerical Controller Using Convex Optimization with Linear Matrix Inequalities on a Quarter-Car Suspension System  

E-Print Network (OSTI)

of the transfer function from the road disturbance to the actuating effort with the change in the sprung mass of the quarter-car system. The quarter-car system makes use of a linear brushless permanent magnet motor (LBPMM) as an actuator, a linear variable...

Chintala, Rohit



Magnetic fluctuations of a large nonuniform plasma column J. E. Maggsa)  

E-Print Network (OSTI)

Magnetic fluctuations of a large nonuniform plasma column J. E. Maggsa) and G. J. Morales Physics of spontaneously generated magnetic fluctuations in a large linear device in which the plasma density has different as at an interior plasma­plasma interface, thus phenomena of interest to magnetic fusion research as well

California at Los Angles, University of


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

6, 27/05/99 6, 27/05/99 Tolerances of Random RF Jitters in X-Band Main Linacs May 27, 1999 Kiyoshi KUBO KEK Tsukuba, Japan Abstract: Tracking simulations have been performed for the main linacs of an X-band linear collider. We discuss the choice of phase of the accelerating field relative to the bunches. The tolerances of the phase and the amplitude errors are studied. Tolerances of Random RF Jitters in X-Band Main Linacs K. Kubo, KEK Abstract Tracking simulations have been performed for main linacs of X-band linear collider. We discuss about choice of the phase of the accelerating field relative to the bunches. The tolerances of the phase and the amplitude errors are studied. 1 INTRODUCTION In order to preserve the low emittance through the main linacs of future linear colliders, various effects


Application of linear response theory to magnetotransport properties of dense plasmas  

Science Journals Connector (OSTI)

Linear response theory, as developed within the Zubarev formalism, is a quantum statistical approach for describing systems out of but close to equilibrium, which has been successfully applied to a wide variety of plasmas in an external electric field and/or containing a temperature gradient. We present here an extension of linear response theory to include the effects of an external magnetic field. General expressions for the complete set of relevant transport properties are given. In particular, the Hall effect and the influence of a magnetic field on the dc electrical conductivity are discussed. Low-density limits including electron-electron scattering are presented as well as results for arbitrary degeneracy.

J. R. Adams, H. Reinholz, and R. Redmer



Independent Oversight Inspection, Stanford Linear Accelerator...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Stanford Linear Accelerator Center - January 2007 January 2007 Inspection of Environment, Safety, and Health Programs at the Stanford Linear Accelerator Center This report...


Linear operator inequalities for strongly stable weakly regular linear systems  

E-Print Network (OSTI)

that A has compact resolvent and its eigenvectors form a Riesz basis for the state space, we give an explicit to a spectral factorization problem and to a lin- ear quadratic optimal control problem. More concretely R, which implies that R #21; 0. The associated linear matrix inequality in the unknown self

Curtain, Ruth F.



NLE Websites -- All DOE Office Websites (Extended Search)

II II Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs


Magnetic Reconnection  

SciTech Connect

We review the fundamental physics of magnetic reconnection in laboratory and space plasmas, by discussing results from theory, numerical simulations, observations from space satellites, and the recent results from laboratory plasma experiments. After a brief review of the well-known early work, we discuss representative recent experimental and theoretical work and attempt to interpret the essence of significant modern findings. In the area of local reconnection physics, many significant findings have been made with regard to two- uid physics and are related to the cause of fast reconnection. Profiles of the neutral sheet, Hall currents, and the effects of guide field, collisions, and micro-turbulence are discussed to understand the fundamental processes in a local reconnection layer both in space and laboratory plasmas. While the understanding of the global reconnection dynamics is less developed, notable findings have been made on this issue through detailed documentation of magnetic self-organization phenomena in fusion plasmas. Application of magnetic reconnection physics to astrophysical plasmas is also brie y discussed.

Masaaki Yamada, Russell Kulsrud and Hantao Ji



Non-linear Plasma Wake Growth of Electron Holes  

E-Print Network (OSTI)

An object's wake in a plasma with small Debye length that drifts \\emph{across} the magnetic field is subject to electrostatic electron instabilities. Such situations include, for example, the moon in the solar wind wake and probes in magnetized laboratory plasmas. The instability drive mechanism can equivalently be considered drift down the potential-energy gradient or drift up the density-gradient. The gradients arise because the plasma wake has a region of depressed density and electrostatic potential into which ions are attracted along the field. The non-linear consequences of the instability are analysed in this paper. At physical ratios of electron to ion mass, neither linear nor quasilinear treatment can explain the observation of large-amplitude perturbations that disrupt the ion streams well before they become ion-ion unstable. We show here, however, that electron holes, once formed, continue to grow, driven by the drift mechanism, and if they remain in the wake may reach a maximum non-linearly stable...

Hutchinson, I H; Zhou, C


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Charged relativistic fluids and non-linear electrodynamics  

E-Print Network (OSTI)

The electromagnetic fields in Maxwell's theory satisfy linear equations in the classical vacuum. This is modified in classical non-linear electrodynamic theories. To date there has been little experimental evidence that any of these modified theories are tenable. However with the advent of high-intensity lasers and powerful laboratory magnetic fields this situation may be changing. We argue that an approach involving the self-consistent relativistic motion of a smooth fluid-like distribution of matter (composed of a large number of charged or neutral particles) in an electromagnetic field offers a viable theoretical framework in which to explore the experimental consequences of non-linear electrodynamics. We construct such a model based on the theory of Born and Infeld and suggest that a simple laboratory experiment involving the propagation of light in a static magnetic field could be used to place bounds on the fundamental coupling in that theory. Such a framework has many applications including a new description of the motion of particles in modern accelerators and plasmas as well as phenomena in astrophysical contexts such as in the environment of magnetars, quasars and gamma-ray bursts.

T. Dereli; R. W. Tucker



Transformations for densities Linear transformations  

E-Print Network (OSTI)

' & $ % Lecture 28 Transformations for densities Linear transformations 1-1 differentiable functions General transformations Expectation of a function 1 #12;' & $ % Transformations for discrete transformation of a U[0, 1] · Take X U[0, 1], so that fX(x) = 1 0 0 and set Y

Adler, Robert J.


Including stereoscopic information in the reconstruction of coronal magnetic fields  

E-Print Network (OSTI)

We present a method to include stereoscopic information about the three dimensional structure of flux tubes into the reconstruction of the coronal magnetic field. Due to the low plasma beta in the corona we can assume a force free magnetic field, with the current density parallel to the magnetic field lines. Here we use linear force free fields for simplicity. The method uses the line of sight magnetic field on the photosphere as observational input. The value of $\\alpha$ is determined iteratively by comparing the reconstructed magnetic field with the observed structures. The final configuration is the optimal linear force solution constrained by both the photospheric magnetogram and the observed plasma structures. As an example we apply our method to SOHO MDI/EIT data of an active region. In the future it is planned to apply the method to analyse data from the SECCHI instrument aboard the STEREO mission.

T. Wiegelmann; T. Neukirch



Magnetic Reconnection in Astrophysical and  

E-Print Network (OSTI)

Magnetic Reconnection in Astrophysical and Laboratory Plasmas Ellen G. Zweibel1 and Masaaki Yamada2 astrophysics, magnetic fields, magnetic reconnection Abstract Magnetic reconnection is a topological rearrangement of magnetic field that converts magnetic energy to plasma energy. Astrophysical flares, from


Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

NLE Websites -- All DOE Office Websites (Extended Search)

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Wednesday, 29 November 2006 00:00...


National High Magnetic Field Laboratory Audio Dictionary: Magnetic...  

NLE Websites -- All DOE Office Websites (Extended Search)

Links Magnets from Mini to Mighty Meet the Magnets How to Make an Electromagnet (audio slideshow) Compasses in Magnetic Fields (interactive tutorial) Magnetic Field Around a...


The Next Linear Collider Klystron Development Program  

E-Print Network (OSTI)

Klystrons capable of 75 MW output power at 11.4 GHz have been under development at SLAC for the last decade. The work has been part of the program to realize all the components necessary for the construction of the Next Linear Collider (NLC). The effort has produced a family of solenoid-focused 50 MW klystrons, which are currently powering a 0.5 GeV test accelerator at SLAC and several test stands, where high power components are evaluated and fundamental research is performed studying rf breakdown and dark current production. Continuing development has resulted in a Periodic Permanent Magnet (PPM) focused 50 MW klystron, tested at SLAC and subsequently contracted for manufacture by industry in England and Japan. A 75 MW version of that PPM klystron was built at SLAC and reached 75 MW, with 2.8 microsecond pulses. Based on this design, a prototype 75 MW klystron, designed for low-cost manufacture, is currently under development at SLAC, and will eventually be procured from industry in modest quantities for ad...

Jongewaard, E; Pearson, C; Phillips, R M; Sprehn, D; Vlieks, A E



Jeffrey S. Oishi Stanford Linear Accelerator Center  

E-Print Network (OSTI)

triangles: integration of resistive term Magnetic helicity measures the linkage of magnetic field lines geometries and equations #12;Disks can create their own fields even when the magnetic Prandtl Number Pm of Natural History Magnetic Helicity and Astrophysical Disk Dynamos #12;Astrophysical disks transport


Symmetrical interfacial reconstruction and magnetism in La{sub 0.7}Ca{sub 0.3}MnO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7}/La{sub 0.7}Ca{sub 0.3}MnO{sub 3} heterostructures.  

SciTech Connect

We have analyzed the interface structure and composition of La{sub 0.7}Ca{sub 0.3}MnO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7}/La{sub 0.7}Ca{sub 0.3}MnO{sub 3} trilayers by combined polarized neutron reflectometry, aberration-corrected microscopy, and atomic column resolution electron-energy-loss spectroscopy and x-ray absorption with polarization analysis. We find the same stacking sequence at both top and bottom cuprate interfaces. X-ray magnetic circular dichroism experiments show that both cuprate interfaces are magnetic with a magnetic moment induced in Cu atoms as expected from symmetric Mn-O-Cu superexchange paths. These results supply a solid footing for the applicability of recent theories explaining the interplay between magnetism and superconductivity in this system in terms of the induced Cu spin polarization at both interfaces.

Visani, C.; Tornos, J.; Nemes, N. M.; Rocci, M.; Leon, C.; Santamaria, J.; te Velthuis, S. G. E.; Liu, Y.; Hoffmann, A.; Freeland, J. W.; Garcia-Hernandez, M.; Fitzsimmons, M. R.; Kirby, B. J.; Varela, M.; Pennycock, S. J. (Materials Science Division); ( XSD); (Univ. Complutense de Madrid); (Inst. de Ciencia de Materiales de Madrid); (LANL); (ORNL)



Variable-field permanent magnet dipole  

SciTech Connect

A new concept for a variable-field permanent-magnet dipole (VFPMD) has been designed, fabricated, and tested at Los Alamos. The VFPMD is a C-shaped sector magnet with iron poles separated by a large block of magnet material (SmCo). The central field can be continuously varied from 0.07 T to 0.3 T by moving an iron shunt closer or further away from the back of the magnet. The shunt is specially shaped to make the dependence of the dipole field strength on the shunt position as linear as possible. The dipole has a 2.8 cm high by 8 cm wide aperture with {approximately}10 cm long poles.

Barlow, D.B.; Kraus, R.H. Jr.; Meyer, R.E.



Magnetic elliptical polarization of Schumann resonances  

SciTech Connect

Measurements of orthogonal, horizontal components of the magnetic field in the ELF range obtained during September 1985 show that the Schumann resonance eigenfrequencies determined separately for the north-south and east-west magnetic components differ by as much as 0.5 Hz, suggesting that the underlying magnetic signal is not linearly polarized at such times. The high degree of magnetic ellipticity found suggests that the side multiplets of the Schumann resonances corresponding to azimuthally inhomogeneous normal modes are strongly excited in the highly asymmetric earth-ionosphere cavity. The dominant sense of polarization over the measurement passband is found to be right-handed during local daylight hours, and to be left-handed during local nighttime hours. 16 references.

Sentman, D.D.



Electromagnetic field quantization in a linear dielectric medium  

E-Print Network (OSTI)

By modeling a dielectric medium with two independent reservoirs, i.e., electric and magnetic reservoirs, the electromagnetic field is quantized in a linear dielectric medium consistently. A Hamiltonian is proposed from which using the Heisenberg equations, not only the Maxwell equations but also the structural equations can be obtained. Using the Laplace transformation, the wave equation for the electromagnetic vector potential is solved in the case of a homogeneous dielectric medium. Some examples are considered showing the applicability of the model to both absorptive and nonabsorptive dielectrics.

F. Kheirandish; M. Amooshahi



Superconducting magnet  

DOE Patents (OSTI)

A superconducting magnet designed to produce magnetic flux densities of the order of 4 to 5 Webers per square meter is constructed by first forming a cable of a plurality of matrixed superconductor wires with each wire of the plurality insulated from each other one. The cable is shaped into a rectangular cross-section and is wound with tape in an open spiral to create cooling channels. Coils are wound in a calculated pattern in saddle shapes to produce desired fields, such as dipoles, quadrupoles, and the like. Wedges are inserted between adjacent cables as needed to maintain substantially radial placement of the long dimensions of cross sections of the cables. After winding, individual strands in each of the cables are brought out to terminals and are interconnected to place all of the strands in series and to maximize the propagation of a quench by alternating conduction from an inner layer to an outer layer and from top half to bottom half as often as possible. Individual layers are separated from others by spiraled aluminum spacers to facilitate cooling. The wound coil is wrapped with an epoxy tape that is cured by heat and then machined to an interference fit with an outer aluminum pipe which is then affixed securely to the assembled coil by heating it to make a shrink fit. In an alternate embodiment, one wire of the cable is made of copper or the like to be heated externally to propagate a quench.

Satti, John A. (Naperville, IL)



Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

Notes Notes LCC - 0018, 15/06/99 Rev B, June 2002 Correct Account of RF Deflections in Linac Acceleration June 15, 1999 G.V. Stupakov Stanford Linear Accelerator Center Stanford, California Abstract: During acceleration in the linac structure, the beam not only increases its longitudinal momentum, but also experiences a transverse kick from the accelerating mode which is linear in accelerating gradient. This effect is neglected in such computer codes as LIAR and TRANSPORT. We derived the Hamiltonian equations that describe the effect of RF deflection into the acceleration process and included it into the computational engine of LIAR. By comparing orbits for the NLC main linac, we found that the difference between the two algorithms is about 10\%. The effect will be more pronounced at smaller


Precision linear ramp function generator  

DOE Patents (OSTI)

A ramp function generator is provided which produces a precise linear ramp function which is repeatable and highly stable. A derivative feedback loop is used to stabilize the output of an integrator in the forward loop and control the ramp rate. The ramp may be started from a selected baseline voltage level and the desired ramp rate is selected by applying an appropriate constant voltage to the input of the integrator.

Jatko, W.B.; McNeilly, D.R.; Thacker, L.H.



Cast dielectric composite linear accelerator  

DOE Patents (OSTI)

A linear accelerator having cast dielectric composite layers integrally formed with conductor electrodes in a solventless fabrication process, with the cast dielectric composite preferably having a nanoparticle filler in an organic polymer such as a thermosetting resin. By incorporating this cast dielectric composite the dielectric constant of critical insulating layers of the transmission lines of the accelerator are increased while simultaneously maintaining high dielectric strengths for the accelerator.

Sanders, David M. (Livermore, CA); Sampayan, Stephen (Manteca, CA); Slenes, Kirk (Albuquerque, NM); Stoller, H. M. (Albuquerque, NM)



Segmented rail linear induction motor  

DOE Patents (OSTI)

A segmented rail linear induction motor has a segmented rail consisting of a plurality of nonferrous electrically conductive segments aligned along a guideway. The motor further includes a carriage including at least one pair of opposed coils fastened to the carriage for moving the carriage. A power source applies an electric current to the coils to induce currents in the conductive surfaces to repel the coils from adjacent edges of the conductive surfaces.

Cowan, Jr., Maynard (1107 Stagecoach Rd. SE., Albuquerque, NM 87123); Marder, Barry M. (1412 Pinnacle View Dr. NE., Albuquerque, NM 87123)



Segmented rail linear induction motor  

DOE Patents (OSTI)

A segmented rail linear induction motor has a segmented rail consisting of a plurality of nonferrous electrically conductive segments aligned along a guideway. The motor further includes a carriage including at least one pair of opposed coils fastened to the carriage for moving the carriage. A power source applies an electric current to the coils to induce currents in the conductive surfaces to repel the coils from adjacent edges of the conductive surfaces. 6 figs.

Cowan, M. Jr.; Marder, B.M.



Learning About Magnets!  

NLE Websites -- All DOE Office Websites (Extended Search)

by the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a...


Interface Magnetism in Multiferroics  

E-Print Network (OSTI)

1.2.1 Magnetism . . . . . . . . . . . . . . . . . . . 1.2.2domain walls . . . . . 3 Magnetism of domain walls in BiFeOof electrical control of magnetism in mixed phase BiFeO 3

He, Qing


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


High-precision description and new properties of a spin-1 particle in a magnetic field  

E-Print Network (OSTI)

The exact Foldy-Wouthuysen Hamiltonian is derived for a pointlike spin-1 particle with a normal magnetic moment in a nonuniform magnetic field. For a uniform magnetic field, it is exactly separated into terms linear and quadratic in spin. New unexpected properties of a particle with an anomalous magnetic moment are found. Spin projections of a particle moving in a uniform magnetic field are not integer and the tensor polarization is asymmetric in the plane orthogonal to the field. Previously described spin-tensor effects caused by the tensor magnetic polarizability exist not only for nuclei but also for pointlike particles.

Alexander J. Silenko



Circumstellar Magnetic Field Diagnostics from Line Polarization  

E-Print Network (OSTI)

Given that dynamically significant magnetic fields in at least some massive stars have now been measured, our contribution addresses the question, to what extent can fields be directly detected in circumstellar gas? The question speaks directly to the very interesting topic of line-driving physics coupled with magnetized plasmas, and how this coupling produces structure in the wind flow. We focus our attention on weak-field diagnostics. These come in two main types: the Hanle effect, which pertains to coherence effects for linear polarization from line scattering, and the weak longitudinal Zeeman effect, which pertains to circular polarization in lines.

Richard Ignace; Kenneth G. Gayley



Femtosecond Opto-Magnetism  

Science Journals Connector (OSTI)

We demonstrate that circularly polarized laser pulses may selectively excite different modes of magnetic resonance, realize quantum control of magnons, trigger magnetic phase...

Kimel, Alexey; Kirilyuk, A; Rasing, Th


Large linear magnetoresistance in a GaAs/AlGaAs heterostructure  

SciTech Connect

We report non-saturating linear magnetoresistance (MR) in a two-dimensional electron system (2DES) at a GaAs/AlGaAs heterointerface in the strongly insulating regime. We achieve this by driving the gate voltage below the pinch-off point of the device and operating it in the non-equilibrium regime with high source-drain bias. Remarkably, the magnitude of MR is as large as 500% per Tesla with respect to resistance at zero magnetic field, thus dwarfing most non-magnetic materials which exhibit this linearity. Its primary advantage over most other materials is that both linearity and the enormous magnitude are retained over a broad temperature range (0.3 K to 10 K), thus making it an attractive candidate for cryogenic sensor applications.

Aamir, Mohammed Ali, E-mail: aamir@physics.iisc.ernet.in; Goswami, Srijit, E-mail: aamir@physics.iisc.ernet.in; Ghosh, Arindam [Department of Physics, Indian Institute of Science, Bangalore 560 012 (India); Baenninger, Matthias; Farrer, Ian; Ritchie, David A. [Cavendish Laboratory, University of Cambridge, J.J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Tripathi, Vikram [Department of Theoretical Physics, Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai 400005 (India); Pepper, Michael [Department of Electrical and Electronic Engineering, University College, London WC1E 7JE (United Kingdom)



Dereverberation by linear systems techniques  

E-Print Network (OSTI)

- sentation by a finite number of thin layers and wave propagation normal to these layers. A linear, recursive mathematical model is developed and a method for the identification of parameters in the absence of noise i. , discussed. Appli ations are made...--Final System Configuration 29 16. Water Model--System Flow Diagram 17. The A Matrix 18. The B, C, and D Matrices 31 32 33 I. INTROD&JCTIO22 The removal of deleterious effects which arise in the transmission of waves through layered media is a problem...

Schell, John August



Unit I-4 More about linear maps 1 More about linear maps  

E-Print Network (OSTI)

Unit I-4 More about linear maps 1 Unit I-4 More about linear maps Unit I-4 More about linear maps 2 Using bases to define linear maps · V, U vector spaces · a unique linear map T: V U is determined · if v = a1v1 + ... + anvn then T(v) = a1T(v1) + ... + anT(vn) Unit I-4 More about linear maps 3 Example

Birkett, Stephen


Cryogenic technology boosts linear accelerator capability  

Science Journals Connector (OSTI)

Cryogenic technology boosts linear accelerator capability ... Two critical properties of matter at cryogenic temperatures—superconductivity and superfluidity—should open the way for a major advance in electron linear accelerator capability. ...



Ultrashort Pulse Propagation in the Linear Regime  

E-Print Network (OSTI)

First, we investigate the Bouguer-Lambert-Beer (BLB) law as applied to the transmission of ultrashort pulses through water in the linear absorption regime. We present a linear theory for propagation of ultrashort laser pulses, and related...

Wang, Jieyu



New architecture for RF power amplifier linearization  

E-Print Network (OSTI)

Power amplifier linearization has become an important part of the transmitter system as 3G and developing 4G communication standards require higher linearity than ever before. The thesis proposes two power amplifier ...

Boo, Hyun H



The Next Linear Collider Program  

NLE Websites -- All DOE Office Websites (Extended Search)

To use the left side navigation on this page, you will need to turn on To use the left side navigation on this page, you will need to turn on Javascript. You do not need JavaScript to use the text-based navigation bar at the bottom of the page. The Next Linear Collider at SLAC Navbar MISSION: Scientists expect research at this facility to answer fundamental questions about the behavior of matter and the origins of the Universe. NLC 8-Pack on the Drawing Board What's New In the Next Linear Collider: • NLC Newsletter October, 2001 • NLC Snowmass report 2001 • NLC All Hands Talk, August 2001 Upcoming Events: • Fall 2001 Working Sessions, Oct. 22-23, 2001 • Pulse Compression Workshop, Oct. 22-24, 2001 • Machine Advisory Committee Mtg., Oct. 24-26, 2001 • ISG-7 at KEK, Nov. 12-15, 2001 • LC' 02 at SLAC, Feb. 4-8, 2002 NLC Website Search: Entire SLAC Web | Help |


Challenges in future linear colliders  

SciTech Connect

For decades, electron-positron colliders have been complementing proton-proton colliders. But the circular LEP, the largest e-e+ collider, represented an energy limit beyond which energy losses to synchrotron radiation necessitate moving to e-e+ linear colliders (LCs), thereby raising new challenges for accelerator builders. Japanese-American, German, and European collaborations have presented options for the Future Linear Collider (FLC). Key accelerator issues for any FLC option are the achievement of high enough energy and luminosity. Damping rings, taking advantage of the phenomenon of synchrotron radiation, have been developed as the means for decreasing beam size, which is crucial for ensuring a sufficiently high rate of particle-particle collisions. Related challenges are alignment and stability in an environment where even minute ground motion can disrupt performance, and the ability to monitor beam size. The technical challenges exist within a wider context of socioeconomic and political challenges, likely necessitating continued development of international collaboration among parties involved in accelerator-based physics.

Swapan Chattopadhyay; Kaoru Yokoya



Repair of overheating linear accelerator  

SciTech Connect

Los Alamos Neutron Science Center (LANSCE) is a proton accelerator that produces high energy particle beams for experiments. These beams include neutrons and protons for diverse uses including radiography, isotope production, small feature study, lattice vibrations and material science. The Drift Tube Linear Accelerator (DTL) is the first portion of a half mile long linear section of accelerator that raises the beam energy from 750 keV to 100 MeV. In its 31st year of operation (2003), the DTL experienced serious issues. The first problem was the inability to maintain resonant frequency at full power. The second problem was increased occurrences of over-temperature failure of cooling hoses. These shortcomings led to an investigation during the 2003 yearly preventative maintenance shutdown that showed evidence of excessive heating: discolored interior tank walls and coper oxide deposition in the cooling circuits. Since overheating was suspected to be caused by compromised heat transfer, improving that was the focus of the repair effort. Investigations revealed copper oxide flow inhibition and iron oxide scale build up. Acid cleaning was implemented with careful attention to protection of the base metal, selection of components to clean and minimization of exposure times. The effort has been very successful in bringing the accelerator through a complete eight month run cycle allowing an incredible array of scientific experiments to be completed this year (2003-2004). This paper will describe the systems, investigation analysis, repair, return to production and conclusion.

Barkley, Walter; Baldwin, William; Bennett, Gloria; Bitteker, Leo; Borden, Michael; Casados, Jeff; Fitzgerald, Daniel; Gorman, Fred; Johnson, Kenneth; Kurennoy, Sergey; Martinez, Alberto; O’Hara, James; Perez, Edward; Roller, Brandon; Rybarcyk, Lawrence; Stark, Peter; Stockton, Jerry



A linear MOSFET regulation system to improve the performance of the booster-ramping power supplies at the APS.  

SciTech Connect

The APS booster ring uses ramping power supplies to power the sextupole, quadrupole, and dipole magnets as the beam energy ramps up linearly to 7 GeV. Due to the circuit topology used, those supplies are unable to follow the linear ramp to the desired accuracy. The best regulation achieved is 0.5% while 0.1 % is desired. In addition to the unsatisfying regulation, those supplies are sensitive to AC line perturbations and are not able to reject AC line noises higher than a few tens of Hertz. To improve the performance, a linear MOSFET regulation system using paralleled MOSFET devices in series with the power supply is proposed. The system uses a real-time current feedback loop to force the MOSFETs to work in the linear operation mode. By using this linear MOSFET regulator, the voltage drop on MOSFETs, and hence the voltage imposed on magnets, can be regulated very quickly. As a result, the regulation of the magnet current can be improved significantly. Experiments and simulation have been performed to verify the proposed method. Results show that, with the linear regulator, the current regulation can be improved to better than 0.1%. Because of the high bandwidth of the linear regulator, it can reduce the harmonic content in the output current as well as reject the AC line disturbance.

Feng, G.; Deriy, B.; Wang, J.; Shang, H.; Xu, S.



General linear methods for Volterra integral equations  

Science Journals Connector (OSTI)

We investigate the class of general linear methods of order p and stage order q=p for the numerical solution of Volterra integral equations of the second kind. Construction of highly stable methods based on the Schur criterion is described and examples ... Keywords: Convolution test equation, General linear methods, Linear stability analysis, Order conditions, Volterra integral equations

G. Izzo; Z. Jackiewicz; E. Messina; A. Vecchio



Quadrupole magnets measurement  

SciTech Connect

A rotating coil setup is designed for quadrupole magnet measurement at the Accelerator Test Facility (ATF); Hall probe measurement was also performed for one of each type of quadrupole magnet. Both mechanical and magnetic properties of the quadrupole magnets were measured, the results are reported here. 5 refs., 12 figs., 12 tabs.

Wang, Xijie (California Univ., Los Angeles, CA (USA). Center for Advanced Accelerators Physics); Sylvester, C. (Brookhaven National Lab., Upton, NY (USA))



Magnetic Imaging Wolfgang Kuch  

E-Print Network (OSTI)

Magnetic Imaging Wolfgang Kuch Freie Universit¨at Berlin, Institut f¨ur Experimentalphysik, Arnimallee 14, 14195 Berlin, Germany kuch@physik.fu-berlin.de Abstract. Imaging of magnetic domains has- ern techniques is used nowadays routinely for magnetic imaging of magnetic ma- terials

Kuch, Wolfgang


Magnetism in Nanocrystalline Gold  

Science Journals Connector (OSTI)

Magnetism in Nanocrystalline Gold ... Bridging the current gap in experimental study of magnetism in bare gold nanomaterials, we report here on magnetism in gold nanocrystalline films produced by cluster deposition in the aggregate form that can be considered as a crossover state between a nanocluster and a continuous film. ... gold; nanocrystalline film; magnetism; cluster deposition; SQUID magnetometry ...

Vladimir Tuboltsev; Alexander Savin; Alexandre Pirojenko; Jyrki Räisänen



Magnetism of spiral galaxies  

Science Journals Connector (OSTI)

... magnetic fields of spiral galaxies has taken a special place in the study of cosmic magnetism, but magnetic fields are a universal property of all galactic-type objects, as is ... . The past ten years have been notable for rapid, qualitative progress in understanding the magnetism of spiral galaxies, a result of both theoretical and observational developments. A few decades ...

Alexander Ruzmaikin; Dmitry Sokoloff; Anvar Shukurov



Magnetism in microquasars  

Science Journals Connector (OSTI)

...Lynden-Bell, E. R. Priest and N. O. Weiss Magnetism in microquasars I. F. Mirabel Centre...binaries|magnetic field|plasma physics| Magnetism in microquasars By I. F. Mirabel Centre...Trans. R. Soc. Lond. A (2000) Magnetism in microquasars 843 At rst glance it...



Early History of Magnetism  

Science Journals Connector (OSTI)

... 2, Dr. J. B. Kramer read a paper on “The Early History of Magnetism”, in which he discussed the various accounts of the first discovery of a magnet ... accounts of the first discovery of a magnet, and the development of the science of magnetism down to A.D. 1600. His remarks were divided into five sections, the ...


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Singular lines of one-dimensional force-free magnetic field  

Science Journals Connector (OSTI)

The behavior of adiabatically slow deformations of the force-free field is investigated. Using the linear approximation it ... of boundary perturbations of one-dimensional force-free field there appear singular magnetic

N. A. Bobrova; S. I. Syrovatskii



The study of magnetic reconnection in solar spicules  

E-Print Network (OSTI)

This work is devoted to study the magnetic reconnection instability under solar spicule conditions. Numerical study of the resistive tearing instability in a current sheet is presented by considering the magnetohydrodynamic (MHD) framework. To investigate the effect of this instability in a stratified atmosphere of solar spicules, we solve linear and non-ideal MHD equations in the x-z plane. In the linear analysis it is assumed that resistivity is only important within the current sheet, and the exponential growth of energies takes place faster as plasma resistivity increases. We are interested to see the occurrence of magnetic reconnection during the lifetime of a typical solar spicule.

Fazel, Z



A Superconducting Magnet Upgrade of the ATF2 Final Focus  

SciTech Connect

The ATF2 facility at KEK is a proving ground for linear collider technology with a well instrumented extracted beam line and Final Focus (FF). The primary ATF2 goal is to demonstrate the extreme beam demagnification and spot stability needed for a linear collider FF. But the ATF2 FF uses water cooled magnets and the ILC baseline has a superconducting (SC) FF. We plan to upgrade ATF2 and replace some of the warm FF magnets with SC FF magnets. The ATF2 SC magnets, like the ILC FF, will made via direct wind construction. ATF2 coil winding is in progress at BNL and warm magnetic measurements indicate we have achieved good field quality. Studies indicate that having ATF2 FF magnets with larger aperture and better field quality should allow reducing the ATF2 FF beta function for study of focusing regimes relevant to CLIC. The ATF2 magnet cryostat will have laser view ports for directly monitoring cold mass movement. We plan to make stability measurements at BNL and KEK to relate ATF2 FF magnet performance to that of a full length ILC QD0 R and D FF prototype under construction at BNL.

Parker B.; Anerella M.; Escallier J.; He P.; Jain A.; Marone A.; Wanderer P.; Wu K.C.; Hauviller C.; Marin E.; Tomas R.; Zimmermann F.; Bolzon B.; Jeremie A.; Kimura N.; Kubo K.; Kume T.; Kuroda S.; Okugi T.; Tauchi T.; Terunuma N.; Tomaru T.; Tsuchiya K.; Urakawa J.; Yamamoto A.; Bambabe P.; Coe P.; Urner D.; Seryi A.; Spencer C.; White G.



A Superconducting Magnet Upgrade of the ATF2 Final Focus  

SciTech Connect

The ATF2 facility at KEK is a proving ground for linear collider technology with a well instrumented extracted beam line and Final Focus (FF). The primary ATF2 goal is to demonstrate the extreme beam demagnification and spot stability needed for a linear collider FF. But the ATF2 FF uses water cooled magnets and the ILC baseline has a superconducting (SC) FF. We plan to upgrade ATF2 and replace some of the warm FF magnets with SC FF magnets. The ATF2 SC magnets, like the ILC FF, will made via direct wind construction. ATF2 coil winding is in progress at BNL and warm magnetic measurements indicate we have achieved good field quality. Studies indicate that having ATF2 FF magnets with larger aperture and better field quality should allow reducing the ATF2 FF beta function for study of focusing regimes relevant to CLIC. The ATF2 magnet cryostat will have laser view ports for directly monitoring cold mass movement. We plan to make stability measurements at BNL and KEK to relate ATF2 FF magnet performance to that of a full length ILC QD0 R&D FF prototype under construction at BNL.

Parker, Brett; /Brookhaven; Anerella, Michael; /Brookhaven; Escallier, John; /Brookhaven; He, Ping; /Brookhaven; Jain, Animesh; /Brookhaven; Marone, Andrew; /Brookhaven; Wanderer, Peter; /Brookhaven; Wu, Kuo-Chen; /Brookhaven; Bambade, Philip; /Orsay, LAL; Bolzon, Benoit; /Annecy, LAPP; Jeremie, Andrea; /Annecy, LAPP; Coe, Paul; /Oxford U.; Urner, David /Oxford U.; Hauviller, Claude; /CERN; Marin, Eduardo; /CERN; Tomas, Rogelio; /CERN; Zimmermann, Frank; /CERN; Kimura, Nobuhiro; /KEK, Tsukuba; Kubo, Kiyoshi; /KEK, Tsukuba; Kume, Tatsuya /KEK, Tsukuba; Kuroda, Shigeru; /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /SLAC /SLAC /SLAC



Thermoelectric effects in organic conductors in a strong magnetic field  

SciTech Connect

The linear response of the electron system of a layered conductor to the temperature gradient in this system in a strong magnetic field is investigated theoretically. Thermoelectric emf is studied as a function of the magnitude and orientation of a strong external magnetic field; the experimental investigation of this function, combined with the study of the electric and thermal resistance, allows one to completely determine the structure of the energy spectrum of charge carriers.

Kirichenko, O. V.; Peschanskii, V. G. [National Academy of Sciences of Ukraine, Verkin Institute for Low Temperature Physics and Engineering (Ukraine)], E-mail: vpeschansky@ilt.kharkov.ua; Hasan, R. A. [Bir-Zeit University (Autonomy of Palestine) (Country Unknown)



Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

1 1 May 2001 Lattice Description for NLC Damping Rings at 120 Hz Andrzej Wolski Lawrence Berkeley National Laboratory Abstract: We present a lattice design for the NLC Main Damping Rings at 120 Hz repe tition rate. A total wiggler length of a little over 46 m is needed to achieve the damping time required for extracted, normalized, vertical emittance below 0.02 mm mrad. The dynamic aperture (using a linear model for the wiggler) is in excess of 15 times the injected beam size. The principal lattice parameters and characteristics are presented in this note; we also outline results of studies of alignment and field quality tolerances. CBP Tech Note-227 LCC-0061 Lattice Description for NLC Main Damping Rings at 120 Hz Andrzej Wolski Lawrence Berkeley National Laboratory


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

0 0 April 2001 Rev.1 July 2003 Guide to LIBXSIF, a Library for Parsing the Extended Standard Input Format of Accelerated Beamlines Peter G. Tenenbaum Stanford Linear Accelerator Center Stanford University Stanford, CA Abstract: We describe LIBXSIF, a standalone library for parsing the Extended Standard Input Format of accelerator beamlines. Included in the description are: documentation of user commands; full description of permitted accelerator elements and their attributes; the construction of beamline lists; the mechanics of adding LIBXSIF to an existing program; and "under the hood" details for users who wish to modify the library or are merely morbidly curious. Guide to LIBXSIF, a Library for Parsing the Extended Standard Input Format of


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

NLC Home Page NLC Technical SLAC The LCC Tech Note series was started in July 1998 to document the JLC/NLC collaborative design effort. The notes are numbered sequentially and may also be given a SLAC, FNAL, LBNL, LLNL and/or KEK publication number. The LCC notes will be distributed through the Web in electronic form as PDF files -- the authors are responsible for keeping the original documents. Other document series are the NLC Notes that were started for the SLAC ZDR, the KEK ATF Notes, and at some future time there should be a series of Technical (NLD) Notes to document work on detector studies for the next-generation linear collider. LCC-0001 "Memorandum of Understanding between KEK and SLAC," 2/98. LCC-0002 "Transparencies and Summaries from the 1st ISG meeting: January 1998," G. Loew, ed., 2/98.


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

5 08//00 5 08//00 Study of Beam Energy Spectrum Measurement in the NLC Extraction Line August 2000 Yuri Nosochkov and Tor Raubenheimer Stanford Linear Accelerator Center Stanford, CA Abstract: The NLC extraction line optics includes a secondary focal point with a very small _- function and 2 cm dispersion which can be used for measurement of outgoing beam energy spread. In this study, we performed tracking simulations to transport the NLC disrupted beam from the Interaction Point (IP) to the extraction line secondary focus (the IP image), `measure' the transverse beam pro_le at the IP image and reconstruct the beam energy spectrum. The resultant distribution was compared with the original energy spectrum at the IP. Study of Beam Energy Spectrum Measurement


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

2 03/12/99 2 03/12/99 PEP-II RF Cavity Revisited December 3, 1999 R. Rimmer, G. Koehler, D. Li, N. Hartmann, N. Folwell, J. Hodgson, B. McCandless Lawrence Berkeley National Laboratory Stanford Linear Accelerator Center Berkeley, CA, USA Stanford, CA, USA Abstract: This report describes the results of numerical simulations of the PEP-II RF cavity performed after the completion of the construction phase of the project and comparisons are made to previous calculations and measured results. These analyses were performed to evaluate new calculation techniques for the HOM distribution and RF surface heating that were not available at the time of the original design. These include the use of a high frequency electromagnetic element in ANSYS and the new Omega 3P code to study wall


Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

4, 10/03/00 4, 10/03/00 Luminosity for NLC Design Variations March 10, 1999 K.A. Thompson and T.O. Raubenheimer Stanford Linear Accelerator Center Stanford, CA, USA Abstract: In this note we give Guineapig simulation results for the luminosity and luminosity spectrum of three baseline NLC designs at 0.5~TeV and 1.0~TeV and compare the simulation results with analytic approximations. We examine the effects of varying several design parameters away from the NLC-B-500 and NLC-B-1000 designs, in order to study possible trade-offs of parameters that could ease tolerances, increase luminosity, or help to optimize machine operation for specific physics processes. Luminosity for NLC Design Variations K.A. Thompson and T.O.Raubenheimer INTRODUCTION In this note we give Guineapig [l] simulation results for the luminosity and


Reticle stage based linear dosimeter  

DOE Patents (OSTI)

A detector to measure EUV intensity employs a linear array of photodiodes. The detector is particularly suited for photolithography systems that includes: (i) a ringfield camera; (ii) a source of radiation; (iii) a condenser for processing radiation from the source of radiation to produce a ringfield illumination field for illuminating a mask; (iv) a reticle that is positioned at the ringfield camera's object plane and from which a reticle image in the form of an intensity profile is reflected into the entrance pupil of the ringfield camera, wherein the reticle moves in a direction that is transverse to the length of the ringfield illumination field that illuminates the reticle; (v) detector for measuring the entire intensity along the length of the ringfield illumination field that is projected onto the reticle; and (vi) a wafer onto which the reticle imaged is projected from the ringfield camera.

Berger, Kurt W. (Livermore, CA)



On extreme Bosonic linear channels  

E-Print Network (OSTI)

The set of all channels with fixed input and output is convex. We first give a convenient formulation of necessary and sufficient condition for a channel to be extreme point of this set in terms of complementary channel, a notion of big importance in quantum information theory. This formulation is based on the general approach to extremality of completely positive maps in an operator algebra due to Arveson. We then apply this formulation to prove the main result of this note: under certain nondegeneracy conditions, purity of the environment is necessary and sufficient for extremality of Bosonic linear (quasi-free) channel. It follows that Gaussian channel between finite-mode Bosonic systems is extreme if and only if it has minimal noise.

A. S. Holevo



Linear Transformer Ideal Transformer Consider linear and ideal transformers attached to Circuit 1 and Circuit 2.  

E-Print Network (OSTI)

Linear Transformer Ideal Transformer I1 + V2 _ + V1 _ Consider linear and ideal transformers in linear transformer equations for :MLL ,, 21 ( ) ( ) ( ) ( ) ( ) ( ) 12212212 2 1 112 2 12 2 1 2212 2 PP Now solve the linear transformer equations for the currents: 1 212 2 22 2 1 2 1 212 2 22 12 2 2 2

Kozick, Richard J.


Magnetic Fields Analogous to electric field, a magnet  

E-Print Network (OSTI)

characteristic of elementary particles such as an electron #12;Magnetic Fields Magnetic field lines Direction;Magnetic Fields Magnetic field lines enter one end (south) of magnet and exit the other end (north) Opposite magnetic poles attract like magnetic poles repel #12;Like the electric field lines

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University


HTS Magnet Program | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

HTS Magnet Program HTS Magnet Program High Temperature Superconductors (HTS) have the potential to revolutionize the field of superconducting magnets for particle accelerators, energy storage and medical applications. This is because of the fact that as compared to the conventional Low Temperature Superconductors (LTS), the critical current density (Jc ) of HTS falls slowly both: as a function of increasing field, and as a function of increasing temperature These unique properties can be utilized to design and build: HTS magnets that produce very high fields (20 - 50 T) HTS magnets that operate at elevated temperatures (20 - 77 K) This is a significant step forward over the convention LTS magnets which generally operate at a temperature of ~4 K and with field usually limited


Nanocomposite Magnets: Transformational Nanostructured Permanent Magnets  

SciTech Connect

Broad Funding Opportunity Announcement Project: GE is using nanomaterials technology to develop advanced magnets that contain fewer rare earth materials than their predecessors. Nanomaterials technology involves manipulating matter at the atomic or molecular scale, which can represent a stumbling block for magnets because it is difficult to create a finely grained magnet at that scale. GE is developing bulk magnets with finely tuned structures using iron-based mixtures that contain 80% less rare earth materials than traditional magnets, which will reduce their overall cost. These magnets will enable further commercialization of HEVs, EVs, and wind turbine generators while enhancing U.S. competitiveness in industries that heavily utilize these alternatives to rare earth minerals.




Magnetic Cusp Configuration of the SPL Plasma Generator  

SciTech Connect

The Superconducting Proton Linac (SPL) is a novel linear accelerator concept currently studied at CERN. As part of this study, a new Cs-free, RF-driven external antenna H{sup -} plasma generator has been developed to withstand an average thermal load of 6 kW. The magnetic configuration of the new plasma generator includes a dodecapole cusp field and a filter field separating the plasma heating and H{sup -} production regions. Ferrites surrounding the RF antenna serve in enhancing the coupling of the RF to the plasma. Due to the space requirements of the plasma chamber cooling circuit, the cusp magnets are pushed outwards compared to Linac4 and the cusp field strength in the plasma region is reduced by 40% when N-S magnetized magnets are used. The cusp field strength and plasma confinement can be improved by replacing the N-S magnets with offset Halbach elements of which each consists of three magnetic sub-elements with different magnetization direction. A design challenge is the dissipation of RF power induced by eddy currents in the cusp and filter magnets which may lead to overheating and demagnetization. In view of this, a copper magnet cage has been developed that shields the cusp magnets from the radiation of the RF antenna.

Kronberger, Matthias; Chaudet, Elodie; Favre, Gilles; Lettry, Jacques; Kuechler, Detlef; Moyret, Pierre; Paoluzzi, Mauro; Prever-Loiri, Laurent; Schmitzer, Claus; Scrivens, Richard; Steyaert, Didier [CERN, 385 Route de Meyrin, 1211 Geneva (Switzerland)



Surface magnetism of Fe(001)  

Science Journals Connector (OSTI)

Results of all-electron self-consistent semirelativistic full-potential linearized augmented-plane-wave local-density and local-spin-density studies are reported for a seven-layer Fe(001) thin film. The calculated work function for the ferromagnetic state is found to be in excellent agreement with experiment, whereas that calculated for the paramagnetic state is significantly worse (namely, 0.5 eV too large), indicating the importance of spin polarization on this electrostatic property. For both states, partial densities of states (projected by layer and by orbital angular momentum), surface states, and charge (and spin) densities are presented and their differences employed to discuss the origin of surface magnetism. No Friedel oscillation is found in the layer-by-layer charge density. The surface-layer magnetic moment is found to have been increased by 0.73?B from the center layer to 2.98?B/atom; a very small Friedel oscillation is obtained for the spin density, which indicates possible size effects in this seven-layer film. Layer-by-layer Fermi contact hyperfine fields are presented: While the core-polarization contributions are proportional to the magnetic moment, the conduction-electron contribution shows a pronounced Friedel oscillation in the central layer and, significantly, a change of sign and increase in the magnitude for the surface-layer contribution. The hyperfine field at the nucleus of the center-layer atoms is found to be in excellent agreement with experiment. The net result for the surface-layer atoms is a predicted decrease in magnitude of the total Fermi contact hyperfine field despite the large increase of their magnetic moments. The relevance of this prediction to experiment is discussed.

S. Ohnishi; A. J. Freeman; M. Weinert



The influence of the magnetic field on the performance of an active magnetic regenerator (AMR)  

E-Print Network (OSTI)

The influence of the time variation of the magnetic field, termed the magnetic field profile, on the performance of a magnetocaloric refrigeration device using the active magnetic regeneration (AMR) cycle is studied for a number of process parameters for both a parallel plate and packed bed regenerator using a numerical model. The cooling curve of the AMR is shown to be almost linear far from the Curie temperature of the magnetocaloric material. It is shown that a magnetic field profile that is 10% of the cycle time out of sync with the flow profile leads to a drop in both the maximum temperature span and the maximum cooling capacity of 20-40\\% for both parallel plate and packed bed regenerators. The maximum cooling capacity is shown to depend very weakly on the ramp rate of the magnetic field. Reducing the temporal width of the high field portion of the magnetic field profile by 10% leads to a drop in maximum temperature span and maximum cooling capacity of 5-20%. An increase of the magnetic field from 1 T t...

Bjørk, R


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Tamper resistant magnetic stripes  

DOE Patents (OSTI)

This invention relates to a magnetic stripe comprising a medium in which magnetized particles are suspended and in which the encoded information is recorded by actual physical rotation or alignment of the previously magnetized particles within the flux reversals of the stripe which are 180.degree. opposed in their magnetic polarity. The magnetized particles are suspended in a medium which is solid, or physically rigid, at ambient temperatures but which at moderately elevated temperatures, such as 40.degree. C., is thinable to a viscosity permissive of rotation of the particles therein under applications of moderate external magnetic field strengths within acceptable time limits.

Naylor, Richard Brian (Albuquerque, NM); Sharp, Donald J. (Albuquerque, NM)



Effects of the 9-T magnetic field on MRS photodiode  

SciTech Connect

The experimental results on the performance of the MRS (Metal/Resistor/Semiconductor) photodiode in the strong magnetic field of 9T, and the possible impact of the quench of the magnet at 9.5T on sensor's operation are reported. The measurement method used is being described. The results of the work agree with the expectations that the MRS photodiode is not exhibiting sensitivity to the magnetic field presence. This result is essential for the design of the future electron-positron linear collider detector.

Beznosko, D.; Blazey, G.; Dyshkant, A.; Rykalin, V.; /Northern Illinois U.



Magnetic Field Production during Preheating at the Electroweak Scale  

Science Journals Connector (OSTI)

We study the generation of magnetic fields during preheating within a scenario of hybrid inflation at the electroweak scale. We find that the nonperturbative and strongly out-of-equilibrium process of generation of magnetic fields with a nontrivial helicity occurs along the lines predicted by Vachaspati many years ago. The magnitude (?B/?EW?10-2) and correlation length of these helical magnetic fields grow linearly with time during preheating and are consistent with the possibility that these seeds gave rise to the microgauss fields observed today in galaxies and clusters of galaxies.

Andrés Díaz-Gil; Juan García-Bellido; Margarita García Pérez; Antonio González-Arroyo



Reverse?field reciprocity for conducting specimens in magnetic fields  

Science Journals Connector (OSTI)

A new static?electromagnetic reciprocity principle is presented extending ordinary resistive reciprocity to the case of nonzero magnetic fields by requiring the magnetic field to be reversed when the reciprocal measurement is made. The principle is supported by measurements on various types of specimens including those which exhibit the quantum?Hall effect. A derivation using elementary electromagnetic theory shows that the principle will hold provided only that the specimen is electrically linear (Ohmic) and that the Onsager form for the conductivity tensor applies throughout. The principle has important implications for electrical measurements on semiconductors in applied?magnetic fields.

H. H. Sample; W. J. Bruno; S. B. Sample; E. K. Sichel



International Workshop on Linear Colliders 2010  

ScienceCinema (OSTI)

IWLC2010 International Workshop on Linear Colliders 2010ECFA-CLIC-ILC joint meeting: Monday 18 October - Friday 22 October 2010Venue: CERN and CICG (International Conference Centre Geneva, Switzerland) This year, the International Workshop on Linear Colliders organized by the European Committee for Future Accelerators (ECFA) will study the physics, detectors and accelerator complex of a linear collider covering both CLIC and ILC options.Contact Workshop Secretariat  IWLC2010 is hosted by CERN




Linear degeneracy in the semiclassical atom  

Science Journals Connector (OSTI)

If the angular and radial quantum numbers of states with the same binding energy satisfy a linear relation, as is the situation in the Coulomb potential, the spectrum is said to be linearly degenerate. We present a detailed study of the consequences of such linear degeneracy in atomic potentials. One of the results is a new, and more general, derivation of Scott’s correction to the Thomas-Fermi energy.

Berthold-Georg Englert and Julian Schwinger



Subcritical Fission Reactor Based on Linear Collider  

E-Print Network (OSTI)

The beams of Linear Collider after main collision can be utilized to build an accelerator--driven sub--critical reactor.

I. F. Ginzburg



Linear PM Generator for Wave Energy Conversion.  

E-Print Network (OSTI)

??The main objective of this thesis is to design a selected version of linear PM generator and to determine the electromechanical characteristics at variable operating… (more)

Parthasarathy, Rajkumar



Ultra-high vacuum photoelectron linear accelerator  

DOE Patents (OSTI)

An rf linear accelerator for producing an electron beam. The outer wall of the rf cavity of said linear accelerator being perforated to allow gas inside said rf cavity to flow to a pressure chamber surrounding said rf cavity and having means of ultra high vacuum pumping of the cathode of said rf linear accelerator. Said rf linear accelerator is used to accelerate polarized or unpolarized electrons produced by a photocathode, or to accelerate thermally heated electrons produced by a thermionic cathode, or to accelerate rf heated field emission electrons produced by a field emission cathode.

Yu, David U.L.; Luo, Yan



Huge market forecast for linear LDPE  

Science Journals Connector (OSTI)

Huge market forecast for linear LDPE ... It now appears that the success of the new technology, which rests largely on energy and equipment cost savings, could be overwhelming. ...



LED Replacements for Linear Fluorescent Lamps Webcast  

Energy.gov (U.S. Department of Energy (DOE))

In this June 20, 2011 webcast on LED products marketed as replacements for linear fluorescent lamps, Jason Tuenge of the Pacific Northwest National Laboratory (PNNL) discussed current Lighting...


Local Linear Learned Image Processing Pipeline  

Science Journals Connector (OSTI)

The local linear learned (L3) algorithm is presented that simultaneously performs the demosaicking, denoising, and color transform calculations of an image processing pipeline for a...

Lansel, Steven; Wandell, Brian


Optimization Online - Accelerated Linearized Bregman Method  

E-Print Network (OSTI)

Jun 27, 2011 ... Abstract: In this paper, we propose and analyze an accelerated linearized Bregman (ALB) method for solving the basis pursuit and related ...

Bo Huang



The Linear Engine Pathway of Transformation  

Energy.gov (U.S. Department of Energy (DOE))

This poster highlights the major milestones in the history of the linear engine in terms of technological advances, novel designs, and economic/social impact.


Linear conic optimization for nonlinear optimal control  

E-Print Network (OSTI)

Jul 7, 2014 ... 3Faculty of Electrical Engineering, Czech Technical University in Prague, ..... This linear transport equation is classical in fluid mechanics, ...



National High Magnetic Field Laboratory: An Introduction to Magnets...  

NLE Websites -- All DOE Office Websites (Extended Search)

resistive magnet is here at the Magnet Lab: It can generate a sustained magnetic field of 35 tesla. (Were not counting here our world-record hybrid magnet or the stronger,...


3D analysis of magnetization distribution magnetized by capacitor-discharge impulse magnetizer  

Science Journals Connector (OSTI)

Method for calculating the magnetization distribution magnetized by capacitor-discharge impulse magnetizer is expanded to 3D, and the calculated flux distribution is compared with measured one.

Norio Takahashi



Spin and orbital magnetization loops obtained using magnetic Compton scattering  

SciTech Connect

We present an application of magnetic Compton scattering (MCS) to decompose a total magnetization loop into spin and orbital magnetization contributions. A spin magnetization loop of SmAl{sub 2} was measured by recording the intensity of magnetic Compton scattering as a function of applied magnetic field. Comparing the spin magnetization loop with the total magnetization one measured by a vibrating sample magnetometer, the orbital magnetization loop was obtained. The data display an anti-coupled behavior between the spin and orbital magnetizations and confirm that the orbital part dominates the magnetization.

Itou, M.; Sakurai, Y. [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan)] [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan); Koizumi, A. [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)] [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)



A variable-field permanent-magnet dipole for accelerators  

SciTech Connect

A new concept for a variable-field permanent-magnet dipole has been developed and fabricated at Los Alamos. The application requires an extremely uniform dipole field in the magnet aperture and precision variability over a large operating range. An iron-core permanent- magnet design using a shunt that was specially shaped to vary the field in a precise and reproducible fashion with shunt position. The key to this design is in the shape of the shunt. The field as a function of shunt position is very linear from 90% of the maximum field to 20% of the minimum field. The shaped shunt also results in a small maximum magnetic force attracting the shunt to the yoke allowing a simple mechanical design. Calculated and measured results agree well for the magnet.

Kraus, R.H. Jr.; Barlow, D.B.; Meyer, R.



A variable-field permanent-magnet dipole for accelerators  

SciTech Connect

A new concept for a variable-field permanent-magnet dipole has been developed and fabricated at Los Alamos. The application requires an extremely uniform dipole field in the magnet aperture and precision variability over a large operating range. An iron-core permanent- magnet design using a shunt that was specially shaped to vary the field in a precise and reproducible fashion with shunt position. The key to this design is in the shape of the shunt. The field as a function of shunt position is very linear from 90% of the maximum field to 20% of the minimum field. The shaped shunt also results in a small maximum magnetic force attracting the shunt to the yoke allowing a simple mechanical design. Calculated and measured results agree well for the magnet.

Kraus, R.H. Jr.; Barlow, D.B.; Meyer, R.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


A new magnetic white dwarf : PG2329+267  

E-Print Network (OSTI)

We have discovered that the white dwarf PG 2329+267 is magnetic, and assuming a centered dipole structure, has a dipole magnetic field strength of approximately 2.3MG. This makes it one of only approximately 4% of isolated white dwarfs with a detectable magnetic field. Linear Zeeman splitting as well as quadratic Zeeman shifts are evident in the hydrogen Balmer sequence and circular spectropolarimetry reveals 10% circular polarisation in the two displaced sigma components of Halpha. We suggest from comparison with spectra of white dwarfs of known mass that PG 2329+267 is more massive than typical isolated white dwarfs, in agreement with the hypothesis that magnetic white dwarfs evolve from magnetic chemically peculiar Ap and Bp type main sequence stars.

C. Moran; T. R. Marsh; V. S. Dhillon



Entanglement of two-qubit photon beam by magnetic field  

E-Print Network (OSTI)

We have studied the possibility of affecting the entanglement measure of 2-qubit system consisting of two photons with different fixed frequencies but with two arbitrary linear polarizations, moving in the same direction, by the help of an applied external magnetic field. The interaction between the magnetic field and the photons in our model is achieved through intermediate electrons that interact with both the photons and the magnetic field. The possibility of exact theoretical analysis of this scheme is based on known exact solutions that describe the interaction of an electron subjected to an external magnetic field (or a medium of electrons not interacting with each other) with a quantized field of two photons. We adapt these exact solutions to the case under consideration. Using explicit wave functions for the resulting electromagnetic field, we calculate the entanglement measure of the photon beam as a function of the applied magnetic field and parameters of the electron medium.

A. D. Levin; D. M. Gitman; R. C. Castro



Ferromagnetic resonance in $\\epsilon$-Co magnetic composites  

E-Print Network (OSTI)

We investigate the electromagnetic properties of assemblies of nanoscale $\\epsilon$-cobalt crystals with size range between 5 nm to 35 nm, embedded in a polystyrene (PS) matrix, at microwave (1-12 GHz) frequencies. We investigate the samples by transmission electron microscopy (TEM) imaging, demonstrating that the particles aggregate and form chains and clusters. By using a broadband coaxial-line method, we extract the magnetic permeability in the frequency range from 1 to 12 GHz, and we study the shift of the ferromagnetic resonance with respect to an externally applied magnetic field. We find that the zero-magnetic field ferromagnetic resonant peak shifts towards higher frequencies at finite magnetic fields, and the magnitude of complex permeability is reduced. At fields larger than 2.5 kOe the resonant frequency changes linearly with the applied magnetic field, demonstrating the transition to a state in which the nanoparticles become dynamically decoupled. In this regime, the particles inside clusters can ...

Chalapat, Khattiya; Huuppola, Maija; Koponen, Lari; Johans, Christoffer; Ras, Robin H A; Ikkala, Olli; Oksanen, Markku A; Seppälä, Eira; Paraoanu, G S



International linear collider reference design report  

E-Print Network (OSTI)

magnet designs. Estimates of EDIA labor costs were basedthe materials, fabrication and EDIA labor fractions are wellThe fractional distribution of EDIA among several types of

Aarons, G.



Recent lunar magnetism  

E-Print Network (OSTI)

The magnetization of young lunar samples (magnetic fields (e.g. core dynamo and long-lived impact plasma fields) have not been present within the last 1.5 Ga. To better ...

Buz, Jennifer



Metallic Magnetic Hetrostructures  

E-Print Network (OSTI)

This work studied sputter deposited conventional spin valves (SV) and related structures. In SV layered structures, two ferromagnetic layers are separated by a non-magnetic spacer. Under an external magnetic field, the relative orientation...

Leung, Chi Wah


Plasma Magnetic Insulation  

Science Journals Connector (OSTI)

29 June 1987 research-article Plasma Magnetic Insulation B. B. Kadomtsev Theoretically the strong magnetic field of a tokamak should confine electrons and ions in a high-temperature...



Magnetic assisted statistical assembly  

E-Print Network (OSTI)

The objective of this thesis is to develop a process using magnetic forces to assemble micro-components into recesses on silicon based integrated circuits. Patterned SmCo magnetic thin films at the bottom of recesses are ...

Cheng, Diana I



Magnetic Nanoparticle NANOMATERIALS  

E-Print Network (OSTI)

Magnetic Nanoparticle Metrology NANOMATERIALS We are developing best practice metrology for characterization of magnetic nanoparticle systems (e.g. blocking temperature, anisotropy, property distributions, T nanoparticles and provide guidelines to the FDA to properly compare systems when approving nanoparticle systems


Uranium Monochalcogenides: Magnetic Form Factor and Magnetic Neutron Scattering  

Science Journals Connector (OSTI)

Fig. R.66. UY. (A) Magnetic form factor. The radial ?j i? integrals, which contribute to the neutron magnetic fo...

R. Tro?



LHC Magnet Program | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnet Program Magnet Program The Superconducting Magnet Division is building a number of dipole magnets for the Large Hadron Collider (LHC), which is now under construction at CERN in Geneva, Switzerland. Scheduled to begin operation in 2007, this machine will collide beams of protons with the unprecedented energy of 7 TeV per beam to explore the nature of matter at its most basic level (RHIC can collide beams of protons with energies of 0.25 TeV, but is mostly used to collide heavy ions with energies of 0.1 TeV per nucleon). The magnets are being built as part of the US program, recommended by the High Energy Physics Advisory Panel (HEPAP) and approved by Congress, to contribute to the construction and, later, use of that frontier machine by the US high energy physics community. Fermi National Accelerator Laboratory (FNAL) and


Magnetic Moment Density from Lack of Smoothness of the Ernst Potential  

E-Print Network (OSTI)

In this talk it is shown a way for constructing magnetic surface sources for stationary axisymmetric electrovac spacetimes possessing a non-smooth electromagnetic Ernst potential. The magnetic moment density is related to this lack of smoothness and its calculation involves solving a linear elliptic differential equation. As an application the results are used for constructing a magnetic source for the Kerr-Newman field.

L. Fernández-Jambrina



Magnetic susceptibility in QCD  

E-Print Network (OSTI)

Magnetic susceptibility in the deconfined phase of QCD is calculated in a closed form using a recent general expression for the quark gas pressure in magnetic field. Quark selfenergies are entering the result via Polyakov line factors and ensure the total paramagnetic effect, increasing with temperature. A generalized form of magnetic susceptibility in nonzero magnetic field suitable for experimental and lattice measurements is derived, showing a good agreement with available lattice data.

V. D. Orlovsky; Yu. A. Simonov



Magnetism Theory Group / POSTECH Magnetism Theory Group / POSTECH  

E-Print Network (OSTI)

Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH J.H . Park et al. #12;'s of FeinCsm e tal The chargeandorbitalordering geom etryin YB a C o 2 O 5 S. K. Kwon etal .Magnetism Theory

Min, Byung Il


RESEARCH: Argonne's Super Magnet  

Science Journals Connector (OSTI)

RESEARCH: Argonne's Super Magnet ... The world's largest superconducting magnet has been successfully built and operated by Argonne National Laboratory, at Argonne, Ill. ... The magnet will be part of Argonne's bubble chamber, also the world's largest, which should be completed on schedule this summer. ...



Noble gas magnetic resonator  

DOE Patents (OSTI)

Precise measurements of a precessional rate of noble gas in a magnetic field is obtained by constraining the time averaged direction of the spins of a stimulating alkali gas to lie in a plane transverse to the magnetic field. In this way, the magnetic field of the alkali gas does not provide a net contribution to the precessional rate of the noble gas.

Walker, Thad Gilbert; Lancor, Brian Robert; Wyllie, Robert



Magnetism in transition metals  

Science Journals Connector (OSTI)

By using the Hubbard tight-binding-type Hamiltonian and the cluster Bethe-lattice approximation we calculate for Fe the Curie temperature TC=2250 K and the temperature dependence of the magnetic moments and the magnetization. Moreover, we show how previous theories for itinerant magnets may be extended to include short-range spin correlations.

J. L. Morán-López; K. H. Bennemann; M. Avignon



A Study in Magnetism  

Science Journals Connector (OSTI)

... this century, for the simple comprehensiveness and original beauty of his researches in electricity and magnetism; chiefly, perhaps, for his discovery of magneto-electricity—the kind of electricity that ... space surrounding a magnet was thrown into a peculiar condition by the presence of the magnetism. Two centuries previously another Englishman, as uniquely great if not greater, Dr. Gilbert ...




Polarized electrons at the Bates Linear Accelerator Center  

SciTech Connect

A beam of polarized electrons have successfully been injected into the MIT Bates Linear Accelerator and accelerated it to 250 MeV. The intense beam was produced by photoemission from a GaAs crystal. The electron polarization at full energy, as measured by a brief test based on Moller scattering from a magnetized foil, was in excess of 30%. The peak intensity for the 15 ..mu..sec long pulses during the first test was about 2mA, representing about a third of the design value. The pulse rate of the accelerator was reduced to 60 Hz to minimize the total beam on the iron target. In a subsequent test, in which the beam hit a thick carbon target, the facility operated successfully at the full rate of 600 Hz. Under this condition, the average current on target was about 10 ..mu..A.

Souder, P.A.; Kim, D.H.; Kumar, K.; Schulze, M.; Lubell, M.; Patch, J.S.; Wilson, R.; Dodson, G.W.; Dow, K.A.; Flanz, J.



Feedback between Accelerator Physicists and magnet builders  

SciTech Connect

Our task is not to record history but to change it. (K. Marx (paraphrased)) How should Accelerator Physicists set magnet error specifications? In a crude social model, they place tolerance limits on undesirable nonlinearities and errors (higher order harmonics, component alignments, etc.). The Magnet Division then goes away for a suitably lengthy period of time, and comes back with a working magnet prototype that is reproduced in industry. A better solution is to set no specifications. Accelerator Physicists begin by evaluating expected values of harmonics, generated by the Magnet Division, before and during prototype construction. Damaging harmonics are traded off against innocuous harmonics as the prototype design evolves, lagging one generation behind the evolution of expected harmonics. Finally, the real harmonics are quickly evaluated during early industrial production, allowing a final round of performance trade-offs, using contingency scenarios prepared earlier. This solution assumes a close relationship and rapid feedback between the Accelerator Physicists and the magnet builders. What follows is one perspective of the way that rapid feedback was used to `change history` (improve linear and dynamic aperture) at RHIC, to great benefit.

Peggs, S.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

-phosphorylation in mitochondria (2, 3), sodium transport in frog skin, toad bladder (4) and toad skin (5), and hydrogen ion transport in turtle bladder (6). Linearity has also been noted in a synthetic membrane exhibiting active transport (7). (Linearity as used in these papers and here implies the flow, J, is related to the force, A1

Stanley, H. Eugene


Soft materials for linear electromechanical energy conversion  

E-Print Network (OSTI)

We briefly review the literature of linear electromechanical effects of soft materials, especially in synthetic and biological polymers and liquid crystals (LCs). First we describe results on direct and converse piezoelectricity, and then we discuss a linear coupling between bending and electric polarization, which maybe called bending piezoelectricity, or flexoelectricity.

Antal Jakli; Nandor Eber



Decomposing Linear Programs for Parallel Solution?  

E-Print Network (OSTI)

Decomposing Linear Programs for Parallel Solution? Ali P nar, Umit V. Catalyurek, Cevdet Aykanat in the solution of Linear Programming (LP) problems with block angular constraint matrices has been exploited industrial applications and the advent of powerful computers have in- creased the users' ability to formulate

�atalyürek, �mit V.


Decomposing Linear Programs for Parallel Solution ?  

E-Print Network (OSTI)

Decomposing Linear Programs for Parallel Solution ? Ali Pinar, ¨ Umit V. C¸ ataly¨urek, Cevdet in the solution of Linear Programming (LP) problems with block angular constraint matrices has been exploited with successful industrial applications and the advent of powerful computers have in­ creased the users' ability

�atalyürek, �mit V.


Limma: Linear Models for Microarray Data  

E-Print Network (OSTI)

397 23 Limma: Linear Models for Microarray Data Gordon K. Smyth Abstract A survey is given correction and control spots in conjunction with linear modelling is illustrated on the 7 data. 23.1 Introduction Limma1 is a package for differential expression analysis of data arising from microarray

Smyth, Gordon K.


Independent Oversight Inspection, Stanford Linear Accelerator Center -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Stanford Linear Accelerator Stanford Linear Accelerator Center - January 2007 Independent Oversight Inspection, Stanford Linear Accelerator Center - January 2007 January 2007 Inspection of Environment, Safety, and Health Programs at the Stanford Linear Accelerator Center The U.S. Department of Energy (DOE) Office of Independent Oversight, within the Office of Health, Safety and Security, conducted an inspection of environment, safety, and health (ES&H) programs at the DOE Stanford Linear Accelerator Center (SLAC) during October and November 2006. The inspection was performed by Independent Oversight's Office of Environment, Safety and Health Evaluations. Since the 2004 Type A electrical accident, SSO and SLAC have made improvements in many aspects of ES&H programs. However, the deficiencies in


Design and Synthesis of Novel Linear and Cyclic Peptide Ligands for Kappa Opioid Receptors  

E-Print Network (OSTI)

; Nal(2?): 2-naphthylalanine; Nbb: nitrobenzamidobenzyl; Nle: norleucine; norBNI: nor-binaltorphimine; NMR: nuclear magnetic resonance; NSAID: non-steroidal anti-inflammatory drug; OAll: O-allyl; oNBS: ortho-nitrobenzenesulfonyl; ORL-1: opioid... (both linear and cyclic analogs) for ?- opioid receptors have been identified, 1, 25 until recently the search for peptide antagonists 4 has met with limited success. Compounds in which the N-terminus was converted to a tertiary amine...

Fang, Weijie



Magnetically attached sputter targets  

DOE Patents (OSTI)

An improved method and assembly for attaching sputtering targets to cathode assemblies of sputtering systems which includes a magnetically permeable material is described. The magnetically permeable material is imbedded in a target base that is brazed, welded, or soldered to the sputter target, or is mechanically retained in the target material. Target attachment to the cathode is achieved by virtue of the permanent magnets and/or the pole pieces in the cathode assembly that create magnetic flux lines adjacent to the backing plate, which strongly attract the magnetically permeable material in the target assembly. 11 figures.

Makowiecki, D.M.; McKernan, M.A.



In-situ magnetization of NdFeB magnets for permanent magnet machines  

SciTech Connect

In-situ magnetizers are needed to facilitate the assembly of permanent magnet machines and to remagnetize the magnets after weakening due to a fault condition. The air-core magnetizer in association with the silicon steel lamination structure of the rotor has advantages over its iron-core counterpart. This novel method has been used to magnetize the NdFeB magnets in a 30-hp permanent magnet synchronous motor. The magnetizing capability for different magnetizer geometries was investigated for the magnetization of NdFeB material. The design, testing, and operation of this magnetizer are reported in this paper.

Chang, L.; Eastham, T.R.; Dawson, G.E. (Dept. of Electrical Engineering, Queen's Univ., Kingston, Ontario K7L 3N6 (CA))



Linear Transformations In this Chapter, we will define the notion of a linear transformation between  

E-Print Network (OSTI)

Chapter 6 Linear Transformations In this Chapter, we will define the notion of a linear transformation between two vector spaces V and W which are defined over the same field and prove the most basic transformations is equivalent to matrix theory. We will also study the geometric properties of linear

Carrell, Jim


Linear inductive voltage adders (IVA) for advanced hydrodynamic radiography  

SciTech Connect

The electron beam which drifts through the multiple cavities of conventional induction linacs (LIA) is replaced in an IVA by a cylindrical metal conductor which extends along the entire length of the device and effectuates the addition of the accelerator cavity voltages. In the approach to radiography, the linear inductive voltage adder drives a magnetically immersed electron diode with a millimeter diameter cathode electrode and a planar anode/bremsstrahlung converter. Both anode and cathode electrodes are immersed in a strong (15--50 T) solenoidal magnetic field. The electron beam cross section is approximately of the same size as the cathode needle and generates a similar size, very intense x-ray beam when it strikes the anode converter. An IVA driven diode can produce electron beams of equal size and energy as a LIA but with much higher currents (40--50 kA versus 4--5 kA), simpler hardware and thus lower cost. The authors present here first experimental validations of the technology utilizing HERMES 3 and SABRE IVA accelerators. The electron beam voltage and current were respectively of the order of 10 MV and 40 kA. X-ray doses of up to 1 kR {at} 1 m and spot sizes as small as 1.7 mm (at 200 R doses) were measured.

Mazarakis, M.G.; Boyes, J.D.; Johnson, D.L. [and others



Controller design and implementation for a 6-degree-of-freedom magnetically levitated positioner with high precision  

E-Print Network (OSTI)

Levitation Stage......................................................... 4 1.4 Thesis Overview........................................................................................... 10 1.5 Thesis Contributions... .......................................................................... 12 2.1.2 Concentrated-Field Magnet Matrix ....................................................... 13 2.2 Linear Motor ................................................................................................ 14 2.2.1 Sawyer Motor...

Yu, Ho



Linear Collider Collaboration Tech Notes LCC-0104  

NLE Websites -- All DOE Office Websites (Extended Search)

4 4 October 2002 Beamstrahlung Photon Load on the TESLA Extraction Septum Blade Andrei Seryi Stanford Linear Accelerator Center Stanford, CA 94309, USA Abstract: This note describes work performed in the framework of the International Linear Collider Technical Review Committee [1] to estimate the power load on the TESLA extraction septum blade due to beamstrahlung photons. It is shown, that under realistic conditions the photon load can be several orders of magnitude higher than what was estimated in the TESLA TDR [2] for the ideal Gaussian beams, potentially representing a serious limitation of the current design. Beamstrahlung Photon Load on the TESLA Extraction Septum Blade ANDREI SERYI STANFORD LINEAR


LED Linear Lamps and Troffer Lighting  

Energy.gov (U.S. Department of Energy (DOE))

The CALiPER program performed a series of investigations on linear LED lamps. Each report in the series covers the performance of up to 31 linear LED lamps, which were purchased in late 2012 or 2013. The first report focuses on bare lamp performance of LED T8 replacement lamps and subsequent reports examine performance in various troffers, as well as cost-effectiveness. There is also a concise guidance document that describes the findings of the Series 21 studies and provides practical advice to manufacturers, specifiers, and consumers (Report 21.4: Summary of Linear (T8) LED Lamp Testing , 5 pages, June 2014).


Optically isolated signal coupler with linear response  

DOE Patents (OSTI)

An optocoupler for isolating electrical signals that translates an electrical input signal linearly to an electrical output signal. The optocoupler comprises a light emitter, a light receiver, and a light transmitting medium. The light emitter, preferably a blue, silicon carbide LED, is of the type that provides linear, electro-optical conversion of electrical signals within a narrow wavelength range. Correspondingly, the light receiver, which converts light signals to electrical signals and is preferably a cadmium sulfide photoconductor, is linearly responsive to light signals within substantially the same wavelength range as the blue LED.

Kronberg, James W. (Aiken, SC)



Linear chain tensioning of moored production vessels  

SciTech Connect

Part 1 of this two-part series discussed the worldwide floating production vessel (FPV) market and evolution of the linear puller concept. The three principal types of chain jack systems - hollow ram, single and twin cylinders - were introduced. And advantages of this relatively new form of passive mooring were outlined. This concluding article covers applications of linear chain pullers on various vessels, including use on an example 35,000-t North Sea semi-submersible. Chain wear and how linear pullers avoid wear associated with windlass-type systems are discussed, along with the optimization possible through use of a swiveling chain fair-lead latch (SCFL).

Peters, B. (Bardex Corp., London (United Kingdom))




SciTech Connect

We present spectro-polarimetric observations of several molecular lines obtained with the Submillimeter Array toward the carbon-rich asymptotic giant branch star IRC+10216. We have detected and mapped the linear polarization of the CO 3-2, SiS 19-18, and CS 7-6 lines. The polarization arises at a distance of {approx_equal} 450 AU from the star and is blueshifted with respect to the Stokes I. The SiS 19-18 polarization pattern appears to be consistent with a locally radial magnetic field configuration. However, the CO 3-2 and CS 7-6 line polarization suggests an overall complex magnetic field morphology within the envelope. This work demonstrates the feasibility of using spectro-polarimetric observations to carry out tomographic imaging of the magnetic field in circumstellar envelopes.

Girart, J. M. [Institut de Ciencies de l'Espai, (CSIC-IEEC), Campus UAB, Facultat de Ciencies, C5p 2, 08193 Bellaterra, Catalunya (Spain); Patel, N. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Vlemmings, W. H. T. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden); Rao, Ramprasad, E-mail: girart@ice.cat [Submillimeter Array, Academia Sinica Institute of Astronomy and Astrophysics, 645 N. Aohoku Place, Hilo, HI 96720 (United States)



Permanent magnet steam generator  

SciTech Connect

This patent describes a system for magnetic heating of a fluid by motor rotation of a permanent magnet rotor adjacent an assembly of ferro-magnetic condensing plate and of copper heat absorber plate with protrusions through the ferro-magnetic condensing plate into an enclosure with the fluid therein and having fluid inlet and fluid outlet. The assembly has a first shaft and a second shaft coaxially spaced therefrom, a respective the motor connected to the outer end of each shaft, and a respective the permanent magnet rotor connected to the inner end of each shaft, adjacent a the heat absorber plate. The improvement described here comprises: the enclosure including a steel boiler with a first the ferro-magnetic condensing plate closing off a first end thereof and a second the ferro-magnetic condensing plate closing off a second end thereof, a the copper heat absorbing plate affixed on each ferro-magnetic plate; means, free of pockets, for promoting turbulent flow of the fluid with uniformly good heat transfer including the protrusion being a plurality of heat sinks, each heat sink of the plurality of heat sinks comprising an integral elongate member with an alternately large diameter and smaller diameter portions regularly spaced therealong. The elongate members through the first the ferro-magnetic condensing plate are coaxially aligned with the elongate members through the second the ferro-magnetic condensing plate.

Gerard, F.; Gerard, F.J.



High Field Magnet R&D |Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

High Field Magnet R&D High Field Magnet R&D The Superconducting Magnet Division is developing advanced magnet designs and magnet-related technologies for high field accelerator magnets. We are currently working on magnets for three inter-related programs: High Field Magnets for Muon Collider Papers, Presentations Common Coil Magnets Papers, Presentations Interaction Region Magnets Papers, Presentations High Temperature Superconductor (HTS) Magnets Papers, Presentations This is part of a multi-lab superconducting magnet development program for new accelerator facilities that would be part of the U.S. High Energy Physics program. These programs (@BNL, @FNAL, @LBNL) are quite complimentary to each other, so that magnet designs and technologies developed at one laboratory can be easily transferred to another. The BNL


Linear Concentrator Systems | Open Energy Information  

Open Energy Info (EERE)

Linear Concentrator Systems Linear Concentrator Systems Jump to: navigation, search Introduction Linear concentrating collector fields consist of a large number of collectors in parallel rows that are typically aligned in a north-south orientation to maximize both annual and summertime energy collection. With a single-axis sun-tracking system, this configuration enables the mirrors to track the sun from east to west during the day, ensuring that the sun reflects continuously onto the receiver tubes. Parabolic Trough Systems The predominant CSP systems currently in operation in the United States are linear concentrators using parabolic trough collectors. In such a system, the receiver tube is positioned along the focal line of each parabola-shaped reflector. The tube is fixed to the mirror structure and

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Photon emission within the linear sigma model  

E-Print Network (OSTI)

Soft-photon emission rates are calculated within the linear sigma model. The investigation is aimed at answering the question to which extent the emissivities map out the phase structure of this particular effective model of strongly interacting matter.

F. Wunderlich; B. Kampfer



18.06 Linear Algebra, Spring 2005  

E-Print Network (OSTI)

This is a basic subject on matrix theory and linear algebra. Emphasis is given to topics that will be useful in other disciplines, including systems of equations, vector spaces, determinants, eigenvalues, similarity, and ...

Strang, Gilbert


Linear Thermodynamics of Rodlike DNA Filtration  

E-Print Network (OSTI)

Linear thermodynamics transportation theory is employed to study filtration of rodlike DNA molecules. Using the repeated nanoarray consisting of alternate deep and shallow regions, it is demonstrated that the complex ...

Li, Zirui


Kinematic moment invariants for linear Hamiltonian systems  

Science Journals Connector (OSTI)

Quadratic moments of a particle distribution being transported through a linear Hamiltonian system are considered. A complete set of kinematic invariants made out of these moments are constructed leading to the discovery of new invariants.

Filippo Neri and Govindan Rangarajan



Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Cool Magnetic Molecules Cool Magnetic Molecules Print Wednesday, 25 May 2011 00:00 Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.


Passive magnetic bearing system  

DOE Patents (OSTI)

An axial stabilizer for the rotor of a magnetic bearing provides external control of stiffness through switching in external inductances. External control also allows the stabilizer to become a part of a passive/active magnetic bearing system that requires no external source of power and no position sensor. Stabilizers for displacements transverse to the axis of rotation are provided that require only a single cylindrical Halbach array in its operation, and thus are especially suited for use in high rotation speed applications, such as flywheel energy storage systems. The elimination of the need of an inner cylindrical array solves the difficult mechanical problem of supplying support against centrifugal forces for the magnets of that array. Compensation is provided for the temperature variation of the strength of the magnetic fields of the permanent magnets in the levitating magnet arrays.

Post, Richard F.



Design, Manufacture and Measurements of Permanent Quadrupole Magnets for Linac4  

E-Print Network (OSTI)

Compact quadrupole magnets are required for the CCDTL (Cell-Coupled Drift Tube Linac) of Linac 4, a 160 MeV linear accelerator of negative hydrogen ions which will replace the old 50 MeV proton Linac2 at CERN. The magnets, of an overall physical length of 140 mm and an aperture diameter of 45 mm, are based on Sm2Co17 blocks and can provide an integrated gradient of up to 1.6 Tesla. The magnetic field quality is determined by 4 ferromagnetic pole tips, aligned together with the permanent magnets blocks inside a structure made in a single piece. Tuning bars allow to individually trim the magnetic flux provided by each pole, to correct possible differences between blocks and to modify the field gradient intensity within about 20% of the nominal value. The paper describes and discusses the design, manufacture and magnetic measurements of a first prototype magnet.

Tommasini, D; Thonet, P; Vorozhtsov, A



The Ising Model on a Dynamically Triangulated Disk with a Boundary Magnetic Field  

E-Print Network (OSTI)

We use Monte Carlo simulations to study a dynamically triangulated disk with Ising spins on the vertices and a boundary magnetic field. For the case of zero magnetic field we show that the model possesses three phases. For one of these the boundary length grows linearly with disk area, while the other two phases are characterized by a boundary whose size is on the order of the cut-off. A line of continuous magnetic transitions separates the two small boundary phases. We determine the critical exponents of the continuous magnetic phase transition and relate them to predictions from continuum 2-d quantum gravity. This line of continuous transitions appears to terminate on a line of discontinuous phase transitions dividing the small boundary phases from the large boundary phase. We examine the scaling of bulk magnetization and boundary magnetization as a function of boundary magnetic field in the vicinity of this tricritical point.

Scott McGuire; Simon Catterall; Mark Bowick; Simeon Warner




E-Print Network (OSTI)

CHAPTER 3. STRUCTURE OF MAGNETIC FIELDS 1 Chapter 3 Structure of Magnetic Fields Many of the most interesting plasmas are permeated by or imbedded in magnetic fields.1 As shown in Fig. 3.1, the magnetic field properties of magnetic fields in plasmas can be discussed without specifying a model for the plasma

Callen, James D.


Pulse magnetic welder  

DOE Patents (OSTI)

A welder is described for automated closure of fuel pins by a pulsed magnetic process in which the open end of a length of cladding is positioned within a complementary tube surrounded by a pulsed magnetic welder. Seals are provided at each end of the tube, which can be evacuated or can receive tag gas for direct introduction to the cladding interior. Loading of magnetic rings and end caps is accomplished automatically in conjunction with the welding steps carried out within the tube.

Christiansen, D.W.; Brown, W.F.



Brownian motion and magnetism  

Science Journals Connector (OSTI)

We present an interesting connection between Brownian motion and magnetism. We use this to determine the distribution of areas enclosed by the path of a particle diffusing on a sphere. In addition, we find a bound on the free energy of an arbitrary system of spinless bosons in a magnetic field. The work presented here is expected to shed light on polymer entanglement, depolarized light scattering, and magnetic behavior of spinless bosons.

Supurna Sinha and Joseph Samuel



The Virtues of Magnetism  

Science Journals Connector (OSTI)

The Virtues of Magnetism ... In Mozart’s late opera Così fan tutte from 1790, Despina, the accomplice of thread puller Don Alfonso, instantly heals the two male characters who are pretending to be dying by using the virtues of magnetism. ... Although magnetism had been known for centuries, its scientific sources were not yet understood at the end of the 18th century, when Lorenzo da Ponte wrote the libretto. ...

Jan-Ole Joswig; Tommy Lorenz; Gotthard Seifert



Modeling Scattering Polarization for Probing Solar Magnetism  

E-Print Network (OSTI)

This paper considers the problem of modeling the light polarization that emerges from an astrophysical plasma composed of atoms whose excitation state is significantly influenced by the anisotropy of the incident radiation field. In particular, it highlights how radiative transfer simulations in three-dimensional models of the quiet solar atmosphere may help us to probe its thermal and magnetic structure, from the near equilibrium photosphere to the highly non-equilibrium upper chromosphere. The paper finishes with predictions concerning the amplitudes and magnetic sensitivities of the linear polarization signals produced by scattering processes in two transition region lines, which should encourage us to develop UV polarimeters for sounding rockets and space telescopes with the aim of opening up a new diagnostic window in astrophysics.

Bueno, Javier Trujillo




SciTech Connect

We study a polar-crown prominence with a bubble and its plume observed in several coronal filters by the SDO/AIA and in H{alpha} by the MSDP spectrograph in Bialkow (Poland) to address the following questions: what is the brightness of prominence bubbles in EUV with respect to the corona outside of the prominence and the prominence coronal cavity? What is the geometry and topology of the magnetic field in the bubble? What is the nature of the vertical threads seen within prominences? We find that the brightness of the bubble and plume is lower than the brightness of the corona outside of the prominence, and is similar to that of the coronal cavity. We constructed linear force-free models of prominences with bubbles, where the flux rope is perturbed by inclusion of parasitic bipoles. The arcade field lines of the bipole create the bubble, which is thus devoid of magnetic dips. Shearing the bipole or adding a second one can lead to cusp-shaped prominences with bubbles similar to the observed ones. The bubbles have complex magnetic topology, with a pair of coronal magnetic null points linked by a separator outlining the boundary between the bubble and the prominence body. We conjecture that plume formation involves magnetic reconnection at the separator. Depending on the viewing angle, the prominence can appear either anvil-shaped with predominantly horizontal structures, or cusp-shaped with predominantly vertical structuring. The latter is an artifact of the alignment of magnetic dips with respect to the prominence axis and the line of sight.

Dudik, J. [DAPEM, Faculty of Mathematics Physics and Computer Science, Comenius University, Mlynska Dolina F2, 84248 Bratislava (Slovakia); Aulanier, G.; Schmieder, B. [Observatoire de Paris, LESIA, UMR 8109 (CNRS), F-92195 Meudon Principal Cedex (France); Zapior, M. [Astronomical Institute, University of Wroclaw, Kopernika 11, 51622 Wroclaw (Poland); Heinzel, P., E-mail: dudik@fmph.uniba.sk [Astronomical Institute of the Academy of Sciences of the Czech Republic, Fricova 298, 25165 Ondrejov (Czech Republic)



Study of Generalized Second Law of Thermodynamics in Loop Quantum Cosmology with the Effect of Non-Linear Electrodynamics  

E-Print Network (OSTI)

In this work, we have discussed the Maxwell's electrodynamics in non-linear forms in FRW universe. The energy density and pressure for non-linear electrodynamics have been written in the electro-magnetic universe. The Einstein's field equations for flat FRW model in loop quantum cosmology have been considered if the universe is filled with the matter and electro-magnetic field. We separately assumed the magnetic universe and electric universe. The interaction between matter and magnetic field have been considered in one section and for some particular form of interaction term, we have found the solutions of magnetic field and the energy density of matter. We have also considered the interaction between the matter and electric field and another form of interaction term has been chosen to solve the field equations. The validity of generalized second law of thermodynamics has been investigated on apparent and event horizons using Gibb's law and the first law of thermodynamics for magnetic and electric universe separately.

Tanwi Bandyopadhyay; Ujjal Debnath



Magnetic structures of hcp bulk gadolinium  

Science Journals Connector (OSTI)

We present results of self-consistent linear-muffin-tin-orbital calculations with the atomic-sphere approximation for hcp bulk Gd, using the local spin-density approximation (LSDA) and gradient correction (GC) for the description of exchange and correlation. In the LSDA calculation antiferromagnetic order is favored over the ferromagnetic, and experimentally observed, structure. The GC weakens the bonding, leading to a higher equilibrium lattice parameter. At the new equilibrium volume the ground state is ferromagnetic. Our results point towards a magnetic phase transition under pressure.

Martina Heinemann and Walter M. Temmerman



Magnetic differential torque sensor  

SciTech Connect

A new torque sensor structure is presented. The basic idea is a simple torque sensor with a variable magnetic circuit excited by an axially magnetized permanent magnet ring. The circuit is constituted by iron toothed rings, whose teeth relative position changes whenever an applied torque twists the rotating shaft. A Hall probe measures the induction in an airgap where the induction is uniform. The new structure is an association of two previous ones, thus creating a differential system with the related advantages: diminution of thermal drifts, zero mean value for the signal. The new magnetic circuit is studied by calculating equivalent reluctances through energy calculations and by using electrical analogies.

Lemarquand, V.; Lemarquand, G. [Univ. de Savoie, Annecy-le-Vieux (France)] [Univ. de Savoie, Annecy-le-Vieux (France)



Holographic Magnetic Phase Transition  

E-Print Network (OSTI)

We study four-dimensional interacting fermions in a strong magnetic field, using the holographic Sakai-Sugimoto model of intersecting D4 and D8 branes in the deconfined, chiral-symmetric parallel phase. We find that as the magnetic field is varied, while staying in the parallel phase, the fermions exhibit a first-order phase transition in which their magnetization jumps discontinuously. Properties of this transition are consistent with a picture in which some of the fermions jump to the lowest Landau level. Similarities to known magnetic phase transitions are discussed.

Gilad Lifschytz; Matthew Lippert



Nuclear magnetic resonance imaging  

Science Journals Connector (OSTI)

Nuclear magnetic resonance imaging (NMRI) is a powerful imaging modality having a range of important applications to medicine and industry. The basic principles of NMRI are reviewed in...

Rothwell, William P



Magnetic Field Viewing Cards  

Science Journals Connector (OSTI)

For some years now laminated cards containing a green magnetically sensitive film have been available from science education suppliers. When held near a magnet these cards appear dark green in regions where the field is perpendicular to the card and light green where the field is parallel to the card. The cards can be used to explore the magnetic field near a variety of magnets as well as near wire loops. In this paper we describe how to make these cards and how we have used them in our physics classrooms and labs.

Stephen Kanim; John R. Thompson


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Recycling Magnets | Jefferson Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

Recycling Magnets July 15, 2013 The cost of a nuclear or particle physics experiment can be enormous, several hundred million dollars for the Large Hadron Collider Experiments,...


Nuclear Magnetic Moments  

Science Journals Connector (OSTI)

This paper contains approximate formulas (Eqs. (5) and (6) for the calculation of nuclear magnetic moments from observed hyperfine structure separations.

S. Goudsmit



Magnetism in hafnium dioxide  

Science Journals Connector (OSTI)

Thin films of HfO2 produced by pulsed-laser deposition on sapphire, yttria-stabilized zirconia, or silicon substrates show ferromagnetic magnetization curves with little hysteresis and extrapolated Curie temperatures far in excess of 400K. The moment does not scale with film thickness, but in terms of substrate area it is typically in the range 150–400?Bnm?2. The magnetization exhibits a remarkable anisotropy, which depends on texture and substrate orientation. Pure HfO2 powder develops a weak magnetic moment on heating in vacuum, which is eliminated on annealing in oxygen. Lattice defects are the likely source of the magnetism.

J. M. D. Coey; M. Venkatesan; P. Stamenov; C. B. Fitzgerald; L. S. Dorneles



Transverse Optical Magnetism  

Science Journals Connector (OSTI)

Magnetic interactions with light are usually so small that they are ignored, even in nonlinear optics. Scientists have discovered that parametric processes can drive the interactions...

Rand, Stephen



Magnetism and Electricity  

Science Journals Connector (OSTI)

... of the mariner's compass being especially good; indeed, the whole chapter on terrestrial magnetism is the best elementary account of the subject which has come under our notice. ...



Magnetic Braids Anthony Yeates  

E-Print Network (OSTI)

flux function Main result Conclusion 2. Thermonuclear confinement devices. ITER (Internat'l Thermonuclear Experimental Reactor). Inside the KSTAR tokamak. Correspond to periodic magnetic braids. 4 / 22

Dundee, University of


Magnetism in CePtPb  

Science Journals Connector (OSTI)

We report the behavior of the hexagonal compound CePtPb, which has an antiferromagnetic transition at TN=0.9 K. The magnetic susceptibility is highly anisotropic, with the ratio ?ab?ac extrapolating to the value 65 at TN. The low-temperature magnetization is also anisotropic with Mab saturating to 0.92?BCe atom at B=5 T, where Mc is five times smaller. The anisotropy is due both to low-symmetry crystal fields and to exchange anisotropy, which causes basal plane ferromagnetic fluctuations to develop below T?15 K. Three facts suggest that the magnetic order might coexist with heavy-fermion behavior: heat-capacity data show a linear-in-temperature contribution ??300 mJ/mol K2 in the antiferromagnetic state; the resistivity is quadratic in temperature below TN; and the magnetic entropy is generated very slowly with temperature reaching a value of only 0.7R ln2 at T=2TN. On the other hand, the long high-temperature tail of the heat-capacity data correlates with the ferromagnetic fluctuations above TN; and ac susceptibility measurements under hydrostatic pressure (to 17 kbar) show that TN increases with pressure at an approximate rate 20 mK/kbar, which suggests that CePtPb sits in the small T limit of the Doniach phase diagram; hence heavy-fermion effects may be negligible.

R. Movshovich; J. M. Lawrence; M. F. Hundley; J. Neumeier; J. D. Thompson; A. Lacerda; Z. Fisk



Magnetism Highlights| Neutron Science | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnetism Magnetism SHARE Magnetism Highlights 1-5 of 5 Results ARCS maps collaborative magnetic spin behavior in iron telluride December 01, 2011 - Researchers have long thought that magnetism and superconductivity are mutually exclusive. The former typically involves localized atomic electrons. The latter requires freely propagating, itinerant electrons. Unexpected Magnetic Excitations in Doped Insulator Surprise Researchers October 01, 2011 - When doping a disordered magnetic insulator material with atoms of a nonmagnetic material, the conventional wisdom is that the magnetic interactions between the magnetic ions in the material will be weakened. Neutron Analysis Reveals Unique Atomic-Scale Behavior of "Cobalt Blue" September 01, 2011 - Neutron scattering studies of "cobalt blue," a



SciTech Connect

The observation of the polarization emerging from a rotating star at different phases opens up the possibility to map the magnetic field in the stellar surface thanks to the well-known Zeeman-Doppler imaging. When the magnetic field is sufficiently weak, the circular and linear polarization profiles locally in each point of the star are proportional to the first and second derivatives of the unperturbed intensity profile, respectively. We show that the weak-field approximation (for weak lines in the case of linear polarization) can be generalized to the case of a rotating star including the Doppler effect and taking into account the integration on the stellar surface. The Stokes profiles are written as a linear combination of wavelength-dependent terms expressed as series expansions in terms of Hermite polynomials. These terms contain the surface-integrated magnetic field and velocity components. The direct numerical evaluation of these quantities is limited to rotation velocities not larger than eight times the Doppler width of the local absorption profiles. Additionally, we demonstrate that in a rotating star, the circular polarization flux depends on the derivative of the intensity flux with respect to the wavelength and also on the profile itself. Likewise, the linear polarization depends on the profile and on its first and second derivatives with respect to the wavelength. We particularize the general expressions to a rotating dipole.

Martinez Gonzalez, M. J. [Instituto de Astrofisica de Canarias, Via Lactea s/n, 38200 La Laguna, Tenerife (Spain); Asensio Ramos, A. [Departamento de Astrofisica, Universidad de La Laguna, E-38205 La Laguna, Tenerife (Spain)



Magnetic helicity signature produced by cross-field 2D turbulence  

SciTech Connect

Hybrid numerical simulations of freely decaying 2D turbulence are presented. The background magnetic field is perpendicular to the simulation plane, which eliminates linear kinetic Alfven waves from the system. The normalized magnetic helicity of the initial large-scale fluctuations is zero, while the normalized cross-helicity is not. As the turbulence evolves, it develops nonzero magnetic helicity at smaller scales, in the proton kinetic range. In the quasi-steady state of evolution, the magnetic helicity spectrum has a peak consistent with the solar wind observations.

Markovskii, S. A.; Vasquez, Bernard J. [Space Science Center, Institute for the Study of Earth, Oceans, and Space, and Department of Physics, University of New Hampshire, Durham, NH 03824 (United States)



Magnetic x-ray scattering at the M{sub 5} absorption edge of Ho  

SciTech Connect

Magnetic x-ray scattering from thin Ho-metal films at M{sub 5} resonance reveals atomic scattering lengths up to 200r{sub 0}--i.e., of the same order of magnitude as predicted theoretically by Hannon et al. [Phys. Rev. Lett. 61, 1245 (1988)]. The photon-energy dependence of first- and second-order magnetic satellites allows a straightforward identification of circular and linear dichroic contributions. A direct comparison to magnetic neutron scattering demonstrates the potential of the method for studies of complex magnetic structures in ultrathin films and highly diluted materials.

Ott, H.; Schierle, E.; Grigoriev, A. Yu.; Kaindl, G.; Weschke, E. [Institut fuer Experimentalphysik, Freie Universitaet Berlin, Arnimallee 14, D-14195 Berlin-Dahlem (Germany); Schuessler-Langeheine, C. [Institut fuer Experimentalphysik, Freie Universitaet Berlin, Arnimallee 14, D-14195 Berlin-Dahlem (Germany); II. Physikalisches Institut, Universitaet zu Koeln, Zuelpicher Str. 77, D-50937 Koeln (Germany); Leiner, V. [Institut fuer Experimentalphysik/Festkoerperphysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Institut fuer Werkstoffforschung, WFN, GKSS Forschungszentrum, D-21502 Geesthacht (Germany); Zabel, H. [Institut fuer Experimentalphysik/Festkoerperphysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany)



Magnetic helicity signature produced by cross-field 2D turbulence  

Science Journals Connector (OSTI)

Hybrid numerical simulations of freely decaying 2D turbulence are presented. The background magnetic field is perpendicular to the simulation plane which eliminates linear kinetic Alfvén waves from the system. The normalized magnetic helicity of the initial large-scale fluctuations is zero while the normalized cross-helicity is not. As the turbulence evolves it develops nonzero magnetic helicity at smaller scales in the proton kinetic range. In the quasi-steady state of evolution the magnetic helicity spectrum has a peak consistent with the solar wind observations.



BEPC-II Magnet Project | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

BEPC-II Magnet Project BEPC-II Magnet Project Project Overview The BEPC-II magnets are Interaction Region magnets to be used as part of an upgrade to the Beijing Electron Positron Collider. Two magnets will be produced, both of which will be inserted within the solenoidal detector at one of the collision points. Since the best use of the quadrupole focusing in this case requires placing the magnet as close to the collision point as possible, these magnets will be used within the magnetic field of the detector. This constrains the materials that can be used for construction to only non-magnetic materials. It also places severe demands on the structure of the magnet and it's holding supports due to the reaction forces between the solenoid and the magnet. To create the coil pattern for the final magnet, the coils will be


National High Magnetic Field Laboratory: An Introduction to Magnets...  

NLE Websites -- All DOE Office Websites (Extended Search)

is a magnet); opposite poles attract, like poles repel. In all magnets, the magnetic field lines run from south to north, and these fields are what produce forces on other...


Experimental and Numerical Study of Spar Buoy-magnet/spring Oscillators Used as Wave Energy Annette R. Grilli  

E-Print Network (OSTI)

Experimental and Numerical Study of Spar Buoy-magnet/spring Oscillators Used as Wave Energy at least one short-stroke linear generator (SSLG), made of a magnet, suspended to a spring, and oscillating within a coil. This system is aimed at producing low and renewable wave power (up to ¢ £ ¤ ¥ k

Grilli, Stéphan T.


Determining the exchange parameters of spin-1 metal-organic molecular magnets in pulsed magnetic fields  

SciTech Connect

We nave measured the high-field magnetization of a number of Ni-based metal-organic molecular magnets. These materials are self-assembly coordination polymers formed from transition metal ions and organic ligands. The chemistry of the compounds is versatile allowing many structures with different magnetic properties to be formed. These studies follow on from previous measurements of the Cu-based analogues in which we showed it was possible to extract the exchange parameters of low-dimensional magnets using pulsed magnetic fields. In our recent experiments we have investigated the compound (Ni(HF{sub 2})(pyz){sub 2})PF{sub 6}, where pyz = pyrazine, and the Ni-ions are linked in a quasi-two-dimensional (Q2D) square lattice via the pyrazine molecules, with the layers held together by HF{sub 2} ligands. We also investigated Ni(NCS){sub 2}(pyzdo){sub 2}, where pyzdo = pyrazine dioxide. The samples are grown at Eastern Washington University using techniques described elsewhere. Measurements are performed at the pulsed magnetic field laboratory in Los Alamos. The magnetization of powdered samples is determined using a compensated coil magnetometer in a 65 T short pulse magnet. Temperatures as low as 500 mK are achievable using a {sup 3}He cryostat. The main figure shows the magnetization of the spin-1 [Ni(HF{sub 2})(pyz){sub 2}]PF{sub 6} compound at 1.43 K. The magnetization rises slowly at first, achieving a rounded saturation whose midpoint is around 19 T. A small anomaly is also seen in the susceptibility at low fields ({approx}3 T), which might be attributed to a spin-flop transition. In contrast, the spin-1/2 [Cu(HF{sub 2})(pyz){sub 2}]PF{sub 6} measured previously has a saturation magnetization of 35.5 T and a strongly concave form of M(B) below this field. This latter compound was shown to be a good example of a Q2D Heisenberg antiferromagnet with the strong exchange coupling (J{sub 2D} = 12.4 K, J{sub {perpendicular}}/J{sub 2D} {approx} 10{sup -2}) directed along the Cu-pyz-Cu directions. The structure of the two compounds is similar, but in the case of the Cu-compound the Cu-Cu pathways are linear, whereas in the Ni-compound they are kinked. The pulsed-field data combined with information from temperature-dependent susceptibility, muon-spin rotation, electron-spin resonance and ligand-field calculations suggest that, far from being magnetically Q2D, the Ni-compound is fairly one-dimensional with the dominant exchange (J{sub 1D} = 3.1 K and J{sub {perpendicular}}/J{sub 1D} = 0.63) directed along the Ni-FHF-Ni direction. Ni(NCS){sub 2}(pyzdo){sub 2} was also investigated. Previous ultra-high field measurements using the 100 T magnet have shown that this compound has a saturation field close to 80 T. The purpose of the present studies is to map out the phase diagram of this material at mid-range fields. The data are shown in the inset to the figure. This continuing project probes the ability of organic ligands to mediate magnetic exchange, the link between structure, dimensionality and bulk magnetic properties, as well as the role of spin number in quantum magnets. Ultimately the investigations aim to determine to what extent it is possible to produce self-assembly molecular materials with tailor-made magnetic characteristics.

Mcdonald, Ross D [Los Alamos National Laboratory; Singleton, John [Los Alamos National Laboratory; Lancaster, Tom [OXFORD UNIV.; Goddard, Paul [OXFORD UNIV.; Manson, Jamie [EASTERN WASHINGTON UNIV.



Journal of Magnetism and Magnetic Materials 252 (2002) 159161 Magnetically induced alignment of FNS  

E-Print Network (OSTI)

Journal of Magnetism and Magnetic Materials 252 (2002) 159­161 Magnetically induced alignment the observation of magnetically controlled anchoring of ferro-nematic suspensions. We found that application of a weak magnetic field to a cell with the ferro-suspension induces an easy orientation axis with weak

Reznikov, Yuri


Journal of Magnetism and Magnetic Materials 225 (2001) 337345 Irreversible magnetization in nickel nanoparticles  

E-Print Network (OSTI)

in this magnetic nanoparticle system. # 2001 Elsevier Science B.V. All rights reserved. PACS: 75.10.Nr; 75.50.KjJournal of Magnetism and Magnetic Materials 225 (2001) 337­345 Irreversible magnetization in nickel in revised form 20 October 2000 Abstract We report magnetic studies on nickel nanoparticle films of average

Zuo, Fulin



SciTech Connect

Over the last few years, several novel magnet designs have been introduced to meet the requirements of new, high performance accelerators and beam lines. For example, the FAIR project at GSI requires superconducting magnets ramped at high rates ({approx} 4 T/s) in order to achieve the design intensity. Magnets for the RIA and FAIR projects and for the next generation of LHC interaction regions will need to withstand high doses of radiation. Helical magnets are required to maintain and control the polarization of high energy protons at RHIC. In other cases, novel magnets have been designed in response to limited budgets and space. For example, it is planned to use combined function superconducting magnets for the 50 GeV proton transport line at J-PARC to satisfy both budget and performance requirements. Novel coil winding methods have been developed for short, large aperture magnets such as those used in the insertion region upgrade at BEPC. This paper will highlight the novel features of these exotic magnets.




Streched Magnetic Moments  

E-Print Network (OSTI)

We note that for a system of 2 nucleons in a stretched case (J=J1+J2) the magnetic moment of the combined system is the sum of the magnetic moments of the 2 constituents. We compile other simple formulas.

Larry Zamick; Yitzhak Sharon


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Magnetic insulation (reply)  

Science Journals Connector (OSTI)

... DR WINTERBERG REPLIES: Contrary to Blewett's belief, magnetic insulation has not only been experimentally confirmed2 since I proposed it several years ago1, but ... generators (for example, the MJ Aurora machine). The magnetic field needed for the insulation effect in this case is generated by the strong azimuthal self-induced field of the ...




Magnetic reconnection in space  

SciTech Connect

Models of magnetic reconnection in space plasmas generally consider only a segment of the magnetic field lines. The consideration of only a segment of the lines is shown to lead to paradoxical results in which reconnection can be impossible even in a magnetic field constrained to be curl free or can be at an Alfven rate even when the plasma is a perfect conductor. A model of reconnecting magnetic fields is developed which shows the smallness of the interdiffusion distance {delta}{sub d} of magnetic field lines does not limit the speed of reconnection but does provide a reconnection trigger. When the reconnection region has a natural length L{sub r}, the spatial scale of the gradient of magnetic field across the magnetic field lines must reach L{sub g} Almost-Equal-To 0.3L{sub r}/ln(L{sub r}/{delta}{sub d}) for fast reconnection to be triggered, which implies a current density j Almost-Equal-To B/{mu}{sub 0}L{sub g} that is far lower than that usually thought required for fast reconnection. The relation between magnetic reconnection in space and in toroidal laboratory plasmas is also discussed.

Boozer, Allen H. [Department of Applied Physics and Applied Mathematics, Columbia University, New York, New York 10027 (United States)



Itinerant-electron magnetism  

Science Journals Connector (OSTI)

... A conference on Itinerant-Electron Magnetism was held in Oxford on September 13?15, 1976. It was sponsored by the ... was held in Oxford on September 13?15, 1976. It was sponsored by the Magnetism Section of the European Physical Society and the Institute of Physics. The Proceedings will ...

E. P. Wohlfarth



Treatise on Terrestrial Magnetism  

Science Journals Connector (OSTI)

... and from which the writer also attempts to deduce some of the other phenomena of magnetism. There seems to us to be some ambiguity in the writer's method of ... , to arrive at laws, that we may hope to form a theory of terrestrial magnetism, than from “making an hypothesis,”and then attempting to apply it to facts. ...

J. S.



Remarks on Terrestrial Magnetism  

Science Journals Connector (OSTI)

... auror are secondary currents produced by rapid, though small, changes in the earth's magnetism. In this hypothesis the earth was viewed as similar to the soft iron core ... conductors in which secondary currents would be generated whenever any change took place in the magnetism of the core.




A Treatise on Magnetism  

Science Journals Connector (OSTI)

... principle expressed by Newton when he said “Hypotheses non fingo.” The elementary laws of magnetism are deduced by rigorous induction from particular cases and are then applied to explain phenomena ... the mathematics employed throughout are of a simple character, so that the first principles of magnetism are thus thrown open to one who has gone no great way in mathematical reading ...




Magnetism and Matter  

Science Journals Connector (OSTI)

... DR. STONER and all physicists interested in magnetism are to be congratulated on the appearance of this admirable monograph. In 1926, the ... admirable monograph. In 1926, the author published a book on the same subject, “Magnetism and Atomic Structure”. The present treatise, far from being merely a revised edition ...

H. A. K.



Magnetism: Managed mess  

Science Journals Connector (OSTI)

... crime-fighting gadgetry (Fig. 1) — noted long ago that “he who controls magnetism controls the Universe”. And efforts to control ... controls the Universe”. And efforts to control magnetism continue to make progress, as Silevitch et al. ably demonstrate in this issue ( ...

Zachary Fisk



Molecular and Cosmical Magnetism  

Science Journals Connector (OSTI)

... RECENT researches on magnetism tend to suggest that the negative electron may be a magneton or unitary electromagnet as ... previously considered and observed in relation to ferromagnetic bodies on the assumption that the ferro-magnetism is due to electrons in orbital motion as a whole. Wider conclusions can be ...




Electricity and Magnetism  

Science Journals Connector (OSTI)

... and practical applications; or, speaking briefly, theory and practice. In the theoretical part, magnetism is first treated, then electricity, in the order statical electricity, electro-chemistry, and ... first treated, then electricity, in the order statical electricity, electro-chemistry, and electro-magnetism. In the practical part are comprised telegraphy and telephony, electric lighting and transmission of ...




Progress in Magnetism  

Science Journals Connector (OSTI)

... HISTORIES of physics and magnetism have much in common, beginning with the discovery of the lode-stone by the ... , beginning with the discovery of the lode-stone by the Greeks. Modern texts on magnetism tend to overlook the work of past philosophers and it is very refreshing to find ...




Magnetism and Atomic Structure  

Science Journals Connector (OSTI)

... the information with regard to the atom has been obtained by studying spectra; chemistry, magnetism, X-ray scattering, etc., play only a subsidiary part. We must admit, ... for fresh sources of information. Much may be said in support of the opinion that magnetism will open a new way by which to approach the study of the structure of ...




Magnetism and Electricity  

Science Journals Connector (OSTI)

... WRITTEN in colloquial language, this book, which is a first-year course on magnetism and electricity, will appeal to many beginners besides the students in technical institutions, for ... have almost forgotten that their jargon is not that of the man in the street. Magnetism is first dealt with, and then the ideas of static and current electricity are ...



The Origin of Magnetism  

Science Journals Connector (OSTI)

... A of the British Association at Hull this year a discussion on “The Origin of Magnetism,“ it was met with the criticism from eminent quarters that the time was not ... to one another nor providing an answer to the essential question of the origin of magnetism. In spite of the comparative failure of the discussion in its wider aspects, one ...




Gravitation and Magnetism  

Science Journals Connector (OSTI)

......1 August 1950 research-article Articles Gravitation and Magnetism E. A. Milne It is shown by the methods of kinematic relativity that there should be a connection between gravitation and magnetism of the type suggested by the empirical formulae of Blackett......

E. A. Milne



National High Magnetic Field Laboratory Slideshow: Seeing Magnetic...  

NLE Websites -- All DOE Office Websites (Extended Search)

more about magnets You can start here with a straightforward rundown. Compasses in Magnetic Fields Experiment with the compass in this tutorial to see how it responds to...


Non-linear Seismic Soil Structure Interaction Method for Developing...  

Office of Environmental Management (EM)

Contact - Sliding and Separation Non-linear springs * Material ElasticPlastic * Non-linear soil behavior * Non-linear behavior between soil and structure (i.e. the...


Experimental Analysis of Two Measurement Techniques to Characterize Photodiode Linearity  

E-Print Network (OSTI)

Experimental Analysis of Two Measurement Techniques to Characterize Photodiode Linearity Anand anand@ece.ucsb.edu Abstract--As photodiodes become more linear, accurately characterizing, the limitations of the measurement system in determining the distortion of highly linear photodiodes. I

Coldren, Larry A.


Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

3 - 6/13/06 3 - 6/13/06 Superconducting Magnet Division S&T Committee Program Review June 22-23, 2006 Conference Room A, Bldg. 725, BNL DRAFT AGENDA Thursday, June 22 0830 Executive Session to address the charge S. Aronson (25 min) 0855 Welcome S. Aronson (5 min) 0900 Superconducting Magnet Division Status & M. Harrison (45 + 15 min) Issues - mission statement, core competencies, themes, program, problems, etc. 1000 Themes - Nb3Sn, HTS, Direct wind, Accelerator integration, P. Wanderer (20 + 10 min) rapid cycling Core Competencies 1030 Superconducting Materials A. Ghosh (20 + 5 min) 1055 Break 1110 Magnetic Design R. Gupta (20 + 5 min) 1135 Magnet Construction M. Anerella (20 + 5 min) 1200 Magnet Testing G. Ganetis (20 + 5 min)


Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Print Cool Magnetic Molecules Print Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Print Cool Magnetic Molecules Print Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.


Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Print Cool Magnetic Molecules Print Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.


Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Print Cool Magnetic Molecules Print Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.


Magnet pole tips  

DOE Patents (OSTI)

An improved magnet more easily provides a radially increasing magnetic field, as well as reduced fringe field and requires less power for a given field intensity. The subject invention comprises a pair of spaced, opposed magnetic poles which further comprise a pair of pole roots, each having a pole tip attached to its center. The pole tips define the gap between the magnetic poles and at least a portion of each pole tip is separated from its associated pole root. The separation begins at a predetermined distance from the center of the pole root and increases with increasing radial distance while being constant with azimuth within that portion. Magnets in accordance with the subject invention have been found to be particularly advantageous for use in large isochronous cyclotrons.

Thorn, C.E.; Chasman, C.; Baltz, A.J.



Cryogenic permanent magnet undulators  

Science Journals Connector (OSTI)

In order to obtain high magnetic fields in a short period undulator, superconductive undulators have been actively investigated in recent years. In this paper, however, we propose a new approach, the cryogenic permanent magnet undulator (CPMU) design, using permanent magnets at the cryogenic temperature of liquid nitrogen or higher. This cryogenic scheme can be easily adapted to currently existing in-vacuum undulators and it improves the magnetic field performance by 30%–50%. Unlike superconductive undulators operating around the liquid helium temperature, there is no big technological difficulty such as the thermal budget problem. In addition, existing field correction techniques are applicable to the CPMUs. Since there is no quench in the CPMUs, the operation of the CPMUs has the same reliability as conventional permanent magnet undulators.

Toru Hara; Takashi Tanaka; Hideo Kitamura; Teruhiko Bizen; Xavier Maréchal; Takamitsu Seike; Tsutomu Kohda; Yutaka Matsuura



Cool Magnetic Molecules  

NLE Websites -- All DOE Office Websites (Extended Search)

Cool Magnetic Molecules Print Cool Magnetic Molecules Print Certain materials are known to heat up or cool down when they are exposed to a changing magnetic field. This is known as the magnetocaloric effect. All magnetic materials exhibit this effect, but in most cases, it is too small to be technologically useful. Recently, however, the search for special molecules with a surprisingly large capacity to keep cool has heated up, driven by environmental and cost considerations as well as by recent improvements in our ability to design, assemble, and probe the structure and chemistry of small molecules. An international collaboration of researchers from Spain, Scotland, and the U.S. has utilized ALS Beamline 11.3.1 (small-molecule crystallography) to characterize the design of such "molecular coolers." The work targets the synthesis of molecular cluster compounds containing many unpaired electrons ("nanomagnets") for applications involving enhanced magnetic refrigeration at very low temperatures.


Sources and Magnetic Charge  

Science Journals Connector (OSTI)

A beginning is made on a phenomenological reconstruction of the theory of magnetic charge. The concept is introduced by reference to a new kind of photon source. It is shown that photon exchange between different source types is relativistically invariant. The space-time generalization of this coupling involves an arbitrary vector. The only way to remove a corresponding arbitrariness of physical predictions is to recognize the localization of charge and impose a charge quantization condition. The consideration of particles that carry both kinds of charge loosens the charge restrictions. The great strength of magnetic attraction indicated by g24?=4(137) suggests that ordinary matter is a magnetically neutral composite of magnetically charged particles that carry fractional electric charge. There is a brief discussion of such a magnetic model of strongly interacting particles, which makes contact with empirical classification schemes. Additional remarks on notation, and on the general nature of the source description, are appended.

Julian Schwinger



Free Magnetic Energy in Solar Active Regions above the Minimum-Energy Relaxed State  

E-Print Network (OSTI)

To understand the physics of solar flares, including the local reorganisation of the magnetic field and the acceleration of energetic particles, we have first to estimate the free magnetic energy available for such phenomena, which can be converted into kinetic and thermal energy. The free magnetic energy is the excess energy of a magnetic configuration compared to the minimum-energy state, which is a linear force-free field if the magnetic helicity of the configuration is conserved. We investigate the values of the free magnetic energy estimated from either the excess energy in extrapolated fields or the magnetic virial theorem. For four different active regions, we have reconstructed the nonlinear force-free field and the linear force-free field corresponding to the minimum-energy state. The free magnetic energies are then computed. From the energy budget and the observed magnetic activity in the active region, we conclude that the free energy above the minimum-energy state gives a better estimate and more insights into the flare process than the free energy above the potential field state.

S. Regnier; E. R. Priest



Determining the minimum mass and cost of a magnetic refrigerator  

E-Print Network (OSTI)

An expression is determined for the mass of the magnet and magnetocaloric material needed for a magnetic refrigerator and these are determined using numerical modeling for both parallel plate and packed sphere bed regenerators as function of temperature span and cooling power. As magnetocaloric material Gd or a model material with a constant adiabatic temperature change, representing a infinitely linearly graded refrigeration device, is used. For the magnet a maximum figure of merit magnet or a Halbach cylinder is used. For a cost of \\$40 and \\$20 per kg for the magnet and magnetocaloric material, respectively, the cheapest 100 W parallel plate refrigerator with a temperature span of 20 K using Gd and a Halbach magnet has 0.8 kg of magnet, 0.3 kg of Gd and a cost of \\$35. Using the constant material reduces this cost to \\$25. A packed sphere bed refrigerator with the constant material costs \\$7. It is also shown that increasing the operation frequency reduces the cost. Finally, the lowest cost is also found a...

Bjørk, R; Bahl, C R H; Pryds, N



Coronal heating by stochastic magnetic pumping. Technical report  

SciTech Connect

Recent observational data cast serious doubt on the widely held view that the sun's corona is heated by traveling waves (acoustic or magnetohydrodynamic). It is here proposed that the energy responsible for heating the corona is derived from the free energy of the coronal magnetic field derived from motion of the 'feet' of magnetic field lines in the photosphere. Stochastic motion of the feet of magnetic field lines leads, on the average, to a linear increase of magnetic free energy with time. This rate of energy input is calculated for a simple model of a single thin flux tube. The model appears to agree well with observational data if the magnetic flux originates in small regions of high magnetic field strength as proposed by Tarbell, Title and Schoolman. On combining this energy input with estimates of energy loss by radiation and of energy redistribution by thermal conduction, we obtain scaling laws for density and temperature in terms of length and coronal magnetic field strength.

Sturrock, P.A.; Uchida, Y.



Linear Collider Collaboration Tech Notes LCC-0100  

NLE Websites -- All DOE Office Websites (Extended Search)

100 100 August 2002 Systematic Ground Motion and Macroalignment for Linear Colliders Rainer Pitthan Stanford Linear Accelerator Center Stanford University Stanford, CA 94309, USA Abstract: Future colliders with their µm-range operational tolerances still need to be classically aligned to the 50 - 100 µm range, and kept there, over the km range. This requirement will not be a show-stopper, but not be trivial either. 50 µm movements over a betatron wavelength is a the range where systematic long term motions can prevent efficient operation. Systematic Ground Motion and Macro-Alignment for Linear Colliders Complete talk at: http://www-project.slac.stanford.edu/lc/wkshp/snowmass2001/t6/info/pitthan july


Dual-range linearized transimpedance amplifier system  

DOE Patents (OSTI)

A transimpedance amplifier system is disclosed which simultaneously generates a low-gain output signal and a high-gain output signal from an input current signal using a single transimpedance amplifier having two different feedback loops with different amplification factors to generate two different output voltage signals. One of the feedback loops includes a resistor, and the other feedback loop includes another resistor in series with one or more diodes. The transimpedance amplifier system includes a signal linearizer to linearize one or both of the low- and high-gain output signals by scaling and adding the two output voltage signals from the transimpedance amplifier. The signal linearizer can be formed either as an analog device using one or two summing amplifiers, or alternately can be formed as a digital device using two analog-to-digital converters and a digital signal processor (e.g. a microprocessor or a computer).

Wessendorf, Kurt O. (Albuquerque, NM)



Solving Linear Systems of Differential Equations By MATLAB  

E-Print Network (OSTI)

Solving Linear Systems of Differential Equations By MATLAB. Consider X'=AX where A is nxn. Suppose there are n linearly independent eigenvectors for A,.


Safe bounds in linear and mixed-integer programming  

E-Print Network (OSTI)

Abstract: Current mixed-integer linear programming solvers are based on linear programming routines that use floating point arithmetic. Occasionally, this leads ...

Arnold Neumaier


Electronic properties of graphite in tilted magnetic fields  

SciTech Connect

The minimal nearest-neighbor tight-binding model with the Peierls substitution is employed to describe the electronic structure of Bernal-stacked graphite subject to tilted magnetic fields. We show that while the presence of the in-plane component of the magnetic field has a negligible effect on the Landau level structure at the K point of the graphite Brillouin zone, at the H point it leads to the experimentally observable splitting of Landau levels which grows approximately linearly with the in-plane field intensity.

Goncharuk, Nataliya A.; Smr?ka, Ludvík [Institute of Physics, Academy of Science of the Czech Republic, v. v. i., Cukrovarnická 10, 162 53 Praha 6 (Czech Republic)



SP - 19 Magnetic Field Safety  

NLE Websites -- All DOE Office Websites (Extended Search)



Linear and angular retroreflecting interferometric alignment target  

DOE Patents (OSTI)

The present invention provides a method and apparatus for measuring both the linear displacement and angular displacement of an object using a linear interferometer system and an optical target comprising a lens, a reflective surface and a retroreflector. The lens, reflecting surface and retroreflector are specifically aligned and fixed in optical connection with one another, creating a single optical target which moves as a unit that provides multi-axis displacement information for the object with which it is associated. This displacement information is useful in many applications including machine tool control systems and laser tracker systems, among others.

Maxey, L. Curtis (Powell, TN)



A linear logical view of linear type isomorphisms Vincent Balat and Roberto Di Cosmo  

E-Print Network (OSTI)

A linear logical view of linear type isomorphisms Vincent Balat and Roberto Di Cosmo LIENS ' Ecole lambda calculus) have recently been investigated due to their practical interest in library search, where they provide a means to search functions by type (see [18, 19, 17, 20, 9, 8, 10]) and to match

Balat, Vincent - Laboratoire Preuves, Programmes et Systèmes, Université Paris 7


Boundary observers for linear and quasi-linear hyperbolic systems with application to flow control  

Science Journals Connector (OSTI)

In this paper we consider the problem of boundary observer design for one-dimensional first order linear and quasi-linear strict hyperbolic systems with n rightward convecting transport PDEs. By means of Lyapunov based techniques, we derive some sufficient ... Keywords: Boundary observers, Hyperbolic systems, Infinite dimensional observer

Felipe Castillo; Emmanuel Witrant; Christophe Prieur; Luc Dugard



Computing nonlinear force free coronal magnetic fields  

E-Print Network (OSTI)

Knowledge of the structure of the coronal magnetic field is important for our understanding of many solar activity phenomena, e.g. flares and CMEs. However, the direct measurement of coronal magnetic fields is not possible with present methods, and therefore the coronal field has to be extrapolated from photospheric measurements. Due to the low plasma beta the coronal magnetic field can usually be assumed to be approximately force free, with electric currents flowing along the magnetic field lines. There are both observational and theoretical reasons which suggest that at least prior to an eruption the coronal magnetic field is in a nonlinear force free state. Unfortunately the computation of nonlinear force free fields is way more difficult than potential or linear force free fields and analytic solutions are not generally available. We discuss several methods which have been proposed to compute nonlinear force free fields and focus particularly on an optimization method which has been suggested recently. We compare the numerical performance of a newly developed numerical code based on the optimization method with the performance of another code based on an MHD relaxation method if both codes are applied to the reconstruction of a semi-analytic nonlinear force-free solution. The optimization method has also been tested for cases where we add random noise to the perfect boundary conditions of the analytic solution, in this way mimicking the more realistic case where the boundary conditions are given by vector magnetogram data. We find that the convergence properties of the optimization method are affected by adding noise to the boundary data and we discuss possibilities to overcome this difficulty.

T. Wiegelmann; T. Neukirch


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Non-Linear Seismic Soil Structure Interaction (SSI) Method for Developing Non-Linear Seismic SSI Analysis Techniques  

Energy.gov (U.S. Department of Energy (DOE))

Non-Linear Seismic Soil Structure Interaction (SSI) Method for Developing Non-Linear Seismic SSI Analysis Techniques Justin Coleman, P.E. October 25th, 2011


Tailoring Magnetic Properties in Bulk Nanostructured Solids  

E-Print Network (OSTI)

permanent magnets). Under specific temperature and applied magnetic field conditions, exchange coupling

Morales, Jason R.



Magnetically catalyzed fusion  

Science Journals Connector (OSTI)

We calculate the reaction cross sections for the fusion of hydrogen and deuterium in strong magnetic fields as are believed to exist in the atmospheres of neutron stars. We find that in the presence of a strong magnetic field (B?1012 G), the reaction rates are many orders of magnitude higher than in the unmagnetized case. The fusion of both protons and deuterons is important over a neutron star’s lifetime for ultrastrong magnetic fields (B?1016 G). The enhancement may have dramatic effects on thermonuclear runaways and bursts on the surfaces of neutron stars. © 1996 The American Physical Society.

Jeremy S. Heyl and Lars Hernquist



Mesoscopic Spin Magnetism  

Science Journals Connector (OSTI)

We investigate the spin magnetism of mesoscopic metallic grains. In the average response of an ensemble of grains there are corrections to macroscopic behavior due to both spectral fluctuations and electron-electron interactions. These corrections are a nonlinear function of the magnetic field. Their temperature dependence is calculated numerically and analytically. An experiment is proposed to measure the unknown interaction coupling constant in the Cooper channel. For a single sample the magnetization is found to fluctuate reproducibly about the mean. These fluctuations directly probe the energy level statistics.

H. Mathur; M. Gökçeda?; A. Douglas Stone




E-Print Network (OSTI)

1. 3 µm5 µm Reversed magnetization A NOVEL DEVICE FOR CONTINUOUS FLOW MAGNETIC TRAPPING AND SORTING Martin d'hères, France ABSTRACT The manipulation of magnetically labeled bio-objects of nano or micrometer sizes is now realizable by combining the magnetic forces with microfluidics. This paper reports

Paris-Sud XI, Université de


Force and Stiffness of Passive Magnetic Bearings Using Permanent Magnets.  

E-Print Network (OSTI)

1 Force and Stiffness of Passive Magnetic Bearings Using Permanent Magnets. Part 2 : Radial Magnetization R. Ravaud, G. Lemarquand, V. Lemarquand Abstract This paper deals with the calculation of the force and the stiffness between two ring permanent magnets whose polarization is radial

Boyer, Edmond


Original Paper Fully interconnected, linear control  

E-Print Network (OSTI)

Original Paper Fully interconnected, linear control for limit cycle walking Joseph H Solomon1 and simple control methodologies for these models (Collins & Ruina, 2005; Hobbelen & Wisse, 2008a, 2008b. Corresponding author: Joseph H. Solomon, Northwestern University, Department of Mechanical Engineering, 2145

Hartmann, Mitra J. Z.


Automatic tuning for linearly tunable filter  

E-Print Network (OSTI)

A new tuning scheme for linearly tunable high-Q filters is proposed. The tuning method is based on using the phase information for both frequency and Q factor tuning. There is no need to find out the relationship between a filter's passband...

Huang, Sung-Ling



Linearity -statistics 1.1B training  

E-Print Network (OSTI)

Linearity - statistics IPAT 1.1B training 300M training D0 resolution is evaluated using 100k single muon events (same events in all 3 plots). Red is the default 11L FTK bank trained using 300M muons on narrow beam of muons (central eta, fixed phi, high fixed pT). Using two types of training: default FTK


Linear efficient antialiased displacement and reflectance mapping  

Science Journals Connector (OSTI)

We present Linear Efficient Antialiased Displacement and Reflectance (LEADR) mapping, a reflectance filtering technique for displacement mapped surfaces. Similarly to LEAN mapping, it employs two mipmapped texture maps, which store the first two moments ... Keywords: BRDF, GPU, LEAN mapping, filtering, microfacet

Jonathan Dupuy; Eric Heitz; Jean-Claude Iehl; Pierre Poulin; Fabrice Neyret; Victor Ostromoukhov



Free energy of an anharmonic linear lattice  

Science Journals Connector (OSTI)

The anharmonic contributions of O(?4) to the free energy of a monatomic linear chain have been calculated both at high and zero temperatures. The contributions to the zero-point energy are also estimated using the Ludwig approximation. It turns out that the Ludwig approximation is not good for estimating the complicated anharmonic contributions to the zero-point energy.

M. R. Monga and V. K. Jindal



Free Energy of the Antiferromagnetic Linear Chain  

Science Journals Connector (OSTI)

Rigorous upper and lower bounds for the free energy of the antiferromagnetic Heisenberg linear chain are obtained from general convexity properties of the free energy. The lower bound is here derived; the upper bound has been obtained previously by Bulaevskii. Both are compared with the calculations of Bonner and Fisher for finite chains.

Robert B. Griffiths



Pretopology semantics for bimodal intuitionistic linear logic  

Science Journals Connector (OSTI)

......is sho wn b y structural induction? F or parts ? and ? pro ceed b y induc? tion on pro ofs? P art ? follo ws from ???? Ha...s ??? mo deling of mo dalities in linear logic one can pro ceed as these authors do to a phase?space seman tics mo deling t......

C Hartonas



Primes Solutions Of Linear Diophantine Equations  

E-Print Network (OSTI)

Let k => 1, m => 1 be small fixed integers, gcd(k, m) = 1. This note develops some techniques for proving the existence of infinitely many primes solutions x = p, and y = q of the linear Diophantine equation y = mx + k.

N. A. Carella



General moment invariants for linear Hamiltonian systems  

Science Journals Connector (OSTI)

This paper studies the behavior of the moments of a particle distribution as it is transported through a Hamiltonian system. Functions of moments that remain invariant for an arbitrary linear Hamiltonian system are constructed. These functions remain approximately invariant for Hamiltonian systems that are not strongly nonlinear. Consequently, they can be used to characterize the degree of nonlinearity of the system.

Alex J. Dragt; Filippo Neri; Govindan Rangarajan



On Finite Index Subgroups of Linear Groups  

Science Journals Connector (OSTI)

......the pro-finite completion of F, is infinite...then every finite index subgroup is of p-power...subgroup T' of finite index in F, a finitely...the pro-finite completion of the ring A...denotes the m-adic completion of A with respect...ON FINITE INDEX SUBGROUPS OF LINEAR......

Alexander Lubotzky



Non-linear dark energy clustering  

SciTech Connect

We consider a dark energy fluid with arbitrary sound speed and equation of state and discuss the effect of its clustering on the cold dark matter distribution at the non-linear level. We write the continuity, Euler and Poisson equations for the system in the Newtonian approximation. Then, using the time renormalization group method to resum perturbative corrections at all orders, we compute the total clustering power spectrum and matter power spectrum. At the linear level, a sound speed of dark energy different from that of light modifies the power spectrum on observationally interesting scales, such as those relevant for baryonic acoustic oscillations. We show that the effect of varying the sound speed of dark energy on the non-linear corrections to the matter power spectrum is below the per cent level, and therefore these corrections can be well modelled by their counterpart in cosmological scenarios with smooth dark energy. We also show that the non-linear effects on the matter growth index can be as large as 10–15 per cent for small scales.

Anselmi, Stefano; Ballesteros, Guillermo [Dipartimento di Fisica ''G. Galilei'', Università degli Studi di Padova, via Marzolo 8, I-35131 Padua (Italy); Pietroni, Massimo, E-mail: anselmi@pd.infn.it, E-mail: ballesteros@pd.infn.it, E-mail: pietroni@pd.infn.it [INFN — Sezione di Padova, via Marzolo 8, I-35131 Padua (Italy)



Zero field line in the magnetic spectra of negatively charged nitrogen-vacancy centers in diamond  

E-Print Network (OSTI)

The dependence of the luminescence of diamonds with negatively charged nitrogen-vacancy centers (NV-) vs. applied magnetic field (magnetic spectrum) was studied. A narrow line in zero magnetic field was discovered. The properties of this line are considerably different from those of other narrow magnetic spectrum lines. Its magnitude is weakly dependent of the orientation of the single-crystal sample to the external magnetic field. This line is also observed in a powdered sample. The shape of the line changes greatly when excitation light polarization is varied. The magnitude of the line has a non-linear relation to excitation light intensity. For low intensities this dependence is close to a square law. To explain the mechanism giving rise to this line in the magnetic spectrum, we suggest a model based on the dipole-dipole interaction between different NV- centers.

S. V. Anishchik; V. G. Vins; A. P. Yelisseyev; N. N. Lukzen; N. L. Lavrik; V. A. Bagryansky



Determination of the linear aperture of the SSC (Superconducting Supercollider) clustered lattice used for the conceptual design report  

SciTech Connect

A study is made of the linear aperture for the clustered lattice used for the SSC Conceptual Design Report. Random multipole errors are included in all magnetic elements including the insertion dipoles and quadrupoles. Based on the concept of smear, the linear aperture is equal to the dynamic aperture in the range -0.1 less than or equal to ..delta..P/P less than or equal to 0.03%. Strong coupling for ..delta..P/P > 0% produces large smears. A variation of the smear parameter that is insensitive to coupling is proposed. A comparison is made with results reported in the SSC Conceptual Design Report.

Dell, G.F.




NLE Websites -- All DOE Office Websites (Extended Search)

Magnetics Laboratory Magnetics Laboratory Manufacturing Technologies The Magnetics Lab provides customers with design, prototyping, packaging solutions and production of unique magnetic and resistive components from millivolts to extremely high voltage (250KV) components. Capabilities * Design review of specification and requirements * Design and develop from sketches, verbal ideas, or circuit design parameters * Coil windings of any size or configuration * Coil diameter from 0.1 to 24 inches * Low temperature and high temperature coils * Precision resistors from 0.1 ohms to 2 megaohms (non-inductive) * Special high voltage transformers (2KV to 250KV) and high voltage loads (38K ohms to 100K ohms and 2KV to 250KV) Resources * Computer Aided Mechanical Design (Solid Works 3D CAD System) for mechanical

Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


AFRD - Superconducting Magnets  

NLE Websites -- All DOE Office Websites (Extended Search)

Superconducting Magnets Superconducting Magnets Home Organization Diversity Safety Links Gallery/History Updated July 2008 Ever-stronger magnets (which must be cost-effective as well) are a key to building tomorrow's high-energy accelerators and upgrading today's. Our role— not only a leading R&D group but also the administrators of the multi-institutional National Conductor Development Program— to create both evolutionary improvements and paradigm shifts in the application of accelerator magnets, providing innovative technology that enables new science. Improvements in conductor, innovative structures to solve the challenges of high fields and brittle superconductors, and integration of computerized design and analysis tools are key. The performance requirements of modern accelerators continue to press the


Fundamentals of Magnetic Recording  

Science Journals Connector (OSTI)

In recent years magnetic recording has become a preferred medium for storing information such as printed language, mathematics, sound, and pictures. It is compact, economical, easily updated, and instantly ret...

Marvin Camras



Modular tokamak magnetic system  

DOE Patents (OSTI)

A modular tokamak system comprised of a plurality of interlocking moldules. Each module is comprised of a vacuum vessel section, a toroidal field coil, moldular saddle coils which generate a poloidal magnetic field and ohmic heating coils.

Yang, Tien-Fang (Wayland, MA)



Magnetic gripper device  

DOE Patents (OSTI)

A climbing apparatus is provided for climbing ferromagnetic surfaces, such as storage tanks and steel frame structures. A magnet assembly is rotatably mounted in a frame assembly. The frame assembly provides a pair of cam surfaces having different dimensions so that, when the frame is rotated, the cam surfaces contact the ferromagnetic surface to separate the magnet assembly from the surface. The different cam dimensions enable one side of the magnet at a time to be detached from the surface to reduce the effort needed to disengage the climbing apparatus. The cam surface also provides for smoothly attaching the apparatus. A hardened dowel pin is also attached to the frame and the pointed end of the dowel engages the surface when the magnet is attached to the surface to prevent downward sliding movement of the assembly under the weight of the user.

Meyer, R.E.



Magnetic gripper device  

DOE Patents (OSTI)

A climbing apparatus is provided for climbing ferromagnetic surfaces, such as storage tanks and steel frame structures. A magnet assembly is rotatably mounted in a frame assembly. The frame assembly provides a pair of cam surfaces having different dimensions so that, when the frame is rotated, the cam surfaces contact the ferromagnetic surface to separate the magnet assembly from the surface. The different cam dimensions enable one side of the magnet at a time to be detached from the surface to reduce the effort needed to disengage the climbing apparatus. The cam surface also provides for smoothly attaching the apparatus. A hardened dowel pin is also attached to the frame and the pointed end of the dowel engages the surface when the magnet is attached to the surface to prevent downward sliding movement of the assembly under the weight of the user.

Meyer, Ross E. (Los Alamos, NM)




Science Journals Connector (OSTI)

New, sophisticated magnetic materials can be found as essential components in computers, sensors, and actuators, and in a variety of telecommunications devices ranging from telephones to satellites. Some of th...




Nonlinear magnetization of graphene  

Science Journals Connector (OSTI)

We compute the magnetization of graphene in a magnetic field, taking into account for generality the possibility of a mass gap. We concentrate on the physical regime where quantum oscillations are not observed due to the effect of the temperature or disorder and show that the magnetization exhibits nonlinear behavior as a function of the applied field, reflecting the strong nonanalyticity of the two-dimensional effective action of Dirac electrons. The necessary values of the magnetic field to observe this nonlinearity vary from a few teslas for very clean suspended samples to 20–30 T for good samples on substrate. In the light of these calculations, we discuss the effects of disorder and interactions as well as the experimental conditions under which the predictions can be observed.

Sergey Slizovskiy and Joseph J. Betouras



USe: Magnetic Neutron Scattering  

Science Journals Connector (OSTI)

This document is part of subvolume B6b?‘Actinide Monochalcogenides’ of Volume 27 ‘Magnetic properties of non-metallic inorganic compounds based on transition elements’ of Landolt-Börnstein - Group III ‘Condens...

R. Tro?



Intrinsic Magnetic Fields  

Science Journals Connector (OSTI)

Emission theory of electromagnetic fields.—(1) Intrinsic magnetic field. The intrinsic magnetic field of a point charge is defined as that portion of the field which cannot be annihilated by the Lorentz transformation. It is shown that the intrinsic field can be represented by lines of force carried by the same moving elements as carry the electric field, and a potential is given for it. (2) Frequency of emission of moving elements. A relation between the frequency of emission of moving elements and the number of lines of force to a tube is deduced on the assumption that the latter number is the same for the electric and magnetic fields and that each moving element marks the intersection of an electric and magnetic line of force.

Leigh Page



MOON: Magnetism and interior  

Science Journals Connector (OSTI)

The internal structure and magnetic field of the Moon are two basic properties of our nearest planetary body that may or may not be related. For the Earth, these properties are closely related because the geom...

Lon L. Hood



Some Experiments in Magnetism  

Science Journals Connector (OSTI)

1 January 1904 research-article Some Experiments in Magnetism T. C. Porter The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Proceedings of the Royal Society of London. www.jstor.org



Saturn's mysterious magnetism  

Science Journals Connector (OSTI)

... 2014 Royal Astronomical Society February 2014 research-article Features Saturn's mysterious magnetism D J Southwood D J Southwood, Blackett Laboratory, Imperial College, London, UK. In his 2013 RAS Presidential Address, David......

D J Southwood



Magnetism and Recalescence  

Science Journals Connector (OSTI)

1 January 1890 research-article Magnetism and Recalescence J. Hopkinson The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Proceedings of the Royal Society of London. www.jstor.org



Geometrically frustrated quantum magnets  

E-Print Network (OSTI)

(cont.) more general lessons on frustrated quantum magnetism. At the end, we demonstrate some new mathematical tools on two other frustrated two-dimensional systems, and summarize our conclusions, with an outlook to remaining ...

Nikolić , Predrag, 1974-



Large Superconducting Magnet Systems  

E-Print Network (OSTI)

The increase of energy in accelerators over the past decades has led to the design of superconducting magnets for both accelerators and the associated detectors. The use of Nb?Ti superconducting materials allows an increase in the dipole field by up to 10 T compared with the maximum field of 2 T in a conventional magnet. The field bending of the particles in the detectors and generated by the magnets can also be increased. New materials, such as Nb3Sn and high temperature superconductor (HTS) conductors, can open the way to higher fields, in the range 13–20 T. The latest generations of fusion machines producing hot plasma also use large superconducting magnet systems.

Védrine, P



On the Electrical and Magnetic Properties of some Indian Spices  

E-Print Network (OSTI)

We have made experimental measurements of electrical conductivity, pH and relative magnetic susceptibility of the aqueous solutions of 24 indian spices. The measured values of electrical conductance of these spices are found to be linearly related to their ash content and bulk calorific values reported in literature. The physiological relevance of the pH and diamagnetic susceptibility of spices when consumed as food or medicine will be also discussed.

Samson. K. Baby; T. E. Girish



Turbulent Magnetic Reconnection Near a  

E-Print Network (OSTI)

Turbulent Magnetic Reconnection Near a 3D Magnetic Null C. S. Ng Space Science Center Institute for the Study of Earth, Oceans, and Space University of New Hampshire, Durham, NH 03824 #12;Turbulent Magnetic Reconnection Near a 3D Magnetic Null C. S. Ng, chung-sang.ng@unh.edu, Space Science Center, Institute

Ng, Chung-Sang


Magnetism and the Maxwellian Theory  

Science Journals Connector (OSTI)

... 31 that he is satisfied with my reply to his query concerning the place of magnetism in fundamental electrical theory. Of course there can be no question of “annihilating magnetic ... and properties of permanent magnets; but, as regards the understanding of fundamental physical phenomena, magnetism appears to have played a part similar to that of money in economics—a useful ...




Rock Magnetism To-Day  

Science Journals Connector (OSTI)

... ROCK magnetism is that branch of geophysics that deals with the origin of magnetization in rocks and ... that deals with the origin of magnetization in rocks and its stability. Workers in rock magnetism are also interested in the phenomenon of self-reversal, that is, a rock acquiring ...




Reverse Thermo-Remanent Magnetism  

Science Journals Connector (OSTI)

... In this communication a particular case of thermo-remanent magnetism, the direction of which is opposite to that of the applied magnetic field under ... to room temperature in a magnetic field of 0-5 Oersteds, it takes a remanent magnetism of 0-12 e.m.u./c.c. in intensity, and the direction ...



Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Magnetic fluorescent lamp  

DOE Patents (OSTI)

The radiant emission of a mercury-argon discharge in a fluorescent lamp assembly is enhanced by providing means for establishing a magnetic field with lines of force along the path of electron flow through the bulb of the lamp assembly, to provide Zeeman splitting of the ultraviolet spectral line. Optimum results are obtained when the magnetic field strength causes a Zeeman splitting of approximately 1.7 times the thermal line width.

Berman, S.M.; Richardson R.W.



Magnetism of nickel  

Science Journals Connector (OSTI)

A previously developed theory of the magnetism of iron, based upon notion of a randomized exchange field, has now been applied to calculate the properties of nickel. We obtained a Curie temperature of 1200 K, about twice the observed value. The magnetization curve, the paramagnetic susceptibility (a Curie-Weiss law), and the distribution of spin lengths are also calculated. Both similarities and differences from the results of the iron calculations are noted.

J. Hubbard



Magnetic coupling device  

DOE Patents (OSTI)

A quick connect/disconnect coupling apparatus is provided in which a base member is engaged by a locking housing through a series of interengagement pins. The pins maintain the shaft in a locked position. Upon exposure to an appropriately positioned magnetic field, pins are removed a sufficient distance such that the shaft may be withdrawn from the locking housing. The ability to lock and unlock the connector assembly requires no additional tools or parts apart from a magnetic key.

Nance, Thomas A. (Aiken, SC)



Permanent Magnet Ecr Plasma Source With Magnetic Field Optimization  

DOE Patents (OSTI)

In a plasma-producing device, an optimized magnet field for electron cyclotron resonance plasma generation is provided by a shaped pole piece. The shaped pole piece adjusts spacing between the magnet and the resonance zone, creates a convex or concave resonance zone, and decreases stray fields between the resonance zone and the workpiece. For a cylindrical permanent magnet, the pole piece includes a disk adjacent the magnet together with an annular cylindrical sidewall structure axially aligned with the magnet and extending from the base around the permanent magnet. The pole piece directs magnetic field lines into the resonance zone, moving the resonance zone further from the face of the magnet. Additional permanent magnets or magnet arrays may be utilized to control field contours on a local scale. Rather than a permeable material, the sidewall structure may be composed of an annular cylindrical magnetic material having a polarity opposite that of the permanent magnet, creating convex regions in the resonance zone. An annular disk-shaped recurve section at the end of the sidewall structure forms magnetic mirrors keeping the plasma off the pole piece. A recurve section composed of magnetic material having a radial polarity forms convex regions and/or magnetic mirrors within the resonance zone.

Doughty, Frank C. (Plano, TX); Spencer, John E. (Plano, TX)



Telescoping magnetic ball bar test gage  

DOE Patents (OSTI)

A telescoping magnetic ball bar test gage for determining the accuracy of machine tools, including robots, and those measuring machines having non-disengagable servo drives which cannot be clutched out. Two gage balls are held and separated from one another by a telescoping fixture which allows them relative radial motional freedom but not relative lateral motional freedom. The telescoping fixture comprises a parallel reed flexure unit and a rigid member. One gage ball is secured by a magnetic socket knuckle assembly which fixes its center with respect to the machine being tested. The other gage ball is secured by another magnetic socket knuckle assembly which is engaged or held by the machine in such manner that the center of that ball is directed to execute a prescribed trajectory, all points of which are equidistant from the center of the fixed gage ball. As the moving ball executes its trajectory, changes in the radial distance between the centers of the two balls caused by inaccuracies in the machine are determined or measured by a linear variable differential transformer (LVDT) assembly actuated by the parallel reed flexure unit. Measurements can be quickly and easily taken for multiple trajectories about several different fixed ball locations, thereby determining the accuracy of the machine.

Bryan, J.B.



Telescoping magnetic ball bar test gage  

DOE Patents (OSTI)

A telescoping magnetic ball bar test gage for determining the accuracy of machine tools, including robots, and those measuring machines having non-disengageable servo drives which cannot be clutched out. Two gage balls (10, 12) are held and separated from one another by a telescoping fixture which allows them relative radial motional freedom but not relative lateral motional freedom. The telescoping fixture comprises a parallel reed flexure unit (14) and a rigid member (16, 18, 20, 22, 24). One gage ball (10) is secured by a magnetic socket knuckle assembly (34) which fixes its center with respect to the machine being tested. The other gage ball (12) is secured by another magnetic socket knuckle assembly (38) which is engaged or held by the machine in such manner that the center of that ball (12) is directed to execute a prescribed trajectory, all points of which are equidistant from the center of the fixed gage ball (10). As the moving ball (12) executes its trajectory, changes in the radial distance between the centers of the two balls (10, 12) caused by inaccuracies in the machine are determined or measured by a linear variable differential transformer (LVDT) assembly (50, 52, 54, 56, 58, 60) actuated by the parallel reed flexure unit (14). Measurements can be quickly and easily taken for multiple trajectories about several different fixed ball (10) locations, thereby determining the accuracy of the machine.

Bryan, James B. (Pleasanton, CA)



Magnetism of nanosized metallic particles  

Science Journals Connector (OSTI)

The magnetism of a small cluster of magnetic atoms at finite temperatures is numerically investigated. The evolution of the system towards thermal equilibrium is studied, and the possibility of occurrence of vortexlike excitations in the arrangement of the magnetic moments within the cluster is pointed out. The magnetization curve as a function of temperature, of a small magnetic particle, suggests that magnetic clusters in granular metals are not saturated even at room temperature. The relevance of the present results to the understanding of the magnetic behavior of granular metals is discussed.

P. Vargas; J. d’Albuquerque e Castro; D. Altbir



RHIC Project | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

RHIC Project RHIC Project The Superconducting Magnet Division supplied 1740 magnetic elements, in 888 cryostats, for the RHIC facility at BNL. Of these, 780 magnetic elements were manufactured by Northrop-Grumman (Bethpage, NY) and 360 were made by Everson Electric (Bethlehem, PA). The magnets made in industry used designs developed at BNL. The first cooldown of the magnets for the RHIC engineering run was in 1999. Since then, the magnets have operated very reliably. arc dipole coil and yoke Arc dipole coil and yoke, with magnetic flux lines The magnets provide modest field (3.45 Teslas in the arc dipoles) in a cost-effective design. Key features in the principal bending and focusing magnets include the use of NbTi Rutherford cable, a single-layer coil, and cold iron as both yoke and collar. The magnets operate in forced-flow


Ground Magnetics | Open Energy Information  

Open Energy Info (EERE)

Ground Magnetics Ground Magnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Ground Magnetics Details Activities (15) Areas (12) Regions (0) NEPA(1) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Magnetic Techniques Parent Exploration Technique: Magnetic Techniques Information Provided by Technique Lithology: Presence of magnetic minerals such as magnetite. Stratigraphic/Structural: Mapping of basement structures, horst blocks, fault systems, fracture zones, dykes and intrusions. Hydrological: The circulation of hydrothermal fluid may impact the magnetic susceptibility of rocks. Thermal: Rocks lose their magnetic properties at the Curie temperature (580° C for magnetite) [1] and, upon cooling, remagnetize in the present magnetic field orientation. The Curie point depth in the subsurface may be determined in a magnetic survey to provide information about hydrothermal activity in a region.



SciTech Connect

Much of our understanding of the atomic-scale magnetic structure and the dynamical properties of solids and liquids was gained from neutron-scattering studies. Elastic and inelastic neutron spectroscopy provided physicists with an unprecedented, detailed access to spin structures, magnetic-excitation spectra, soft-modes and critical dynamics at magnetic-phase transitions, which is unrivaled by other experimental techniques. Because the neutron has no electric charge, it is an ideal weakly interacting and highly penetrating probe of matter's inner structure and dynamics. Unlike techniques using photon electric fields or charged particles (e.g., electrons, muons) that significantly modify the local electronic environment, neutron spectroscopy allows determination of a material's intrinsic, unperturbed physical properties. The method is not sensitive to extraneous charges, electric fields, and the imperfection of surface layers. Because the neutron is a highly penetrating and non-destructive probe, neutron spectroscopy can probe the microscopic properties of bulk materials (not just their surface layers) and study samples embedded in complex environments, such as cryostats, magnets, and pressure cells, which are essential for understanding the physical origins of magnetic phenomena. Neutron scattering is arguably the most powerful and versatile experimental tool for studying the microscopic properties of the magnetic materials. The magnitude of the cross-section of the neutron magnetic scattering is similar to the cross-section of nuclear scattering by short-range nuclear forces, and is large enough to provide measurable scattering by the ordered magnetic structures and electron spin fluctuations. In the half-a-century or so that has passed since neutron beams with sufficient intensity for scattering applications became available with the advent of the nuclear reactors, they have became indispensable tools for studying a variety of important areas of modern science, ranging from large-scale structures and dynamics of polymers and biological systems, to electronic properties of today's technological materials. Neutron scattering developed into a vast field, encompassing many different experimental techniques aimed at exploring different aspects of matter's atomic structure and dynamics. Modern magnetic neutron scattering includes several specialized techniques designed for specific studies and/or particular classes of materials. Among these are magnetic reflectometry aimed at investigating surfaces, interfaces, and multilayers, small-angle scattering for the large-scale structures, such as a vortex lattice in a superconductor, and neutron spin-echo spectroscopy for glasses and polymers. Each of these techniques and many others offer exciting opportunities for examining magnetism and warrant extensive reviews, but the aim of this chapter is not to survey how different neutron-scattering methods are used to examine magnetic properties of different materials. Here, we concentrate on reviewing the basics of the magnetic neutron scattering, and on the recent developments in applying one of the oldest methods, the triple axis spectroscopy, that still is among the most extensively used ones. The developments discussed here are new and have not been coherently reviewed. Chapter 2 of this book reviews magnetic small-angle scattering, and modern techniques of neutron magnetic reflectometry are discussed in Chapter 3.




Deconfinement to quark matter in neutron stars - The influence of strong magnetic fields  

SciTech Connect

We use an extended version of the hadronic SU(3) non-linear realization of the sigma model that also includes quarks to study hybrid stars. Within this approach, the degrees of freedom change naturally as the temperature/density increases. Different prescriptions of charge neutrality, local and global, are tested and the influence of strong magnetic fields and the anomalous magnetic moment on the particle population is discussed.

Dexheimer, V. [UFSC, Florianopolis, Brazil and Gettysburg College, Gettysburg, PA (Brazil); Negreiros, R. [UFF, Niteroi (Brazil) and FIAS - Johann Wolfgang Goethe University, Frankfurt (Germany); Schramm, S. [FIAS - Johann Wolfgang Goethe University, Frankfurt (Germany); Hempel, M. [University of Basel, Basel (Switzerland)



Magnetic moments of vector, axial, and tensor mesons in lattice QCD  

E-Print Network (OSTI)

We present a calculation of magnetic moments for selected spin-1 mesons using the techniques of lattice QCD. This is carried out by introducing progressively small static magnetic field on the lattice and measuring the linear response of a hadron's mass shift. The calculations are done on $24^4$ quenched lattices using standard Wilson actions, with $\\beta$=6.0 and pion mass down to 500 MeV. The results are compared to those from the form factor method where available.

F. X. Lee; S. Moerschbacher; W. Wilcox



Novel control of a permanent magnet linear generator for ocean wave energy applications.  

E-Print Network (OSTI)

??Wave energy conversion devices are a rapidly growing interest worldwide for the potential to harness a sustainable and renewable energy source. Due to the oscillatory… (more)

VanderMeulen, Aaron H.



Testing, Analysis, and Model Verification of Miniature Linear Permanent Magnet Generators.  

E-Print Network (OSTI)

??The military has become increasingly dependent on mobile electronic equipment to ensure success and safety of soldiers in remote locations. To operate the electronics, soldiers… (more)

Rippee, Michael Ray




E-Print Network (OSTI)

membership functions were introduced. This controller could attenuate road disturbance by up to 78%. Additionally, a sliding-mode controller (SMC) is developed with a different approach from the other three control methodologies. While SMC is developed...

Lee, Seungho



Novel design and implementation of a permanent magnet linear tubular generator for ocean wave energy conversion.  

E-Print Network (OSTI)

??The world’s energy consumption is growing at an alarming rate and the need for renewable energy is apparent now more than ever. Estimates have shown… (more)

Prudell, Joseph H.



Simulation of non-linear rf losses derived from characteristic Nb topography  

SciTech Connect

A simplified model has been developed to simulate non-linear RF losses on Nb surfaces exclusively due to topographical enhancement of surface magnetic fields. If local sharp edges are small enough, at locations where local surface fields exceed Hc, small volumes of material may become normal conducting without thermal leading to quench. These small volumes of normal material yield increases in the effective surface resistance of the Nb. Using topographic data from typical BCP?d and EP?d fine grain niobium surfaces, we have simulated field-dependent losses and found that when extrapolated to resulting cavity performance, these losses correspond well to characteristic BCP/EP high field Q0 performance differences for fine grain Nb. We describe the structure of the model, its limitations, and the effects of this type of non-linear loss contribution on SRF cavities.

Reece, Charles E. [JLAB; Xu, Chen; Kelley, Michael [W& M. JLAB



Estimation of Heavy Ion Densities From Linearly Polarized EMIC Waves At Earth  

SciTech Connect

Linearly polarized EMIC waves are expected to concentrate at the location where their wave frequency satisfies the ion-ion hybrid (IIH) resonance condition as the result of a mode conversion process. In this letter, we evaluate absorption coefficients at the IIH resonance in the Earth geosynchronous orbit for variable concentrations of helium and azimuthal and field-aligned wave numbers in dipole magnetic field. Although wave absorption occurs for a wide range of heavy ion concentration, it only occurs for a limited range of azimuthal and field-aligned wave numbers such that the IIH resonance frequency is close to, but not exactly the same as the crossover frequency. Our results suggest that, at L = 6.6, linearly polarized EMIC waves can be generated via mode conversion from the compressional waves near the crossover frequency. Consequently, the heavy ion concentration ratio can be estimated from observations of externally generated EMIC waves that have polarization.

Kim, Eun-Hwa; Johnson, Jay R.; Lee, Dong-Hun



Solar receiver heliostat reflector having a linear drive and position information system  

DOE Patents (OSTI)

A heliostat for a solar receiver system comprises an improved drive and control system for the heliostat reflector assembly. The heliostat reflector assembly is controllably driven in a predetermined way by a light-weight drive system so as to be angularly adjustable in both elevation and azimuth to track the sun and efficiently continuously reflect the sun's rays to a focal zone, i.e., heat receiver, which forms part of a solar energy utilization system, such as a solar energy fueled electrical power generation system. The improved drive system includes linear stepping motors which comprise low weight, low cost, electronic pulse driven components. One embodiment comprises linear stepping motors controlled by a programmed, electronic microprocessor. Another embodiment comprises a tape driven system controlled by a position control magnetic tape.

Horton, Richard H. (Schenectady, NY)



Investigation into electron cloud effects in the International Linear Collider positron damping ring  

SciTech Connect

We report modeling results for electron cloud buildup and instability in the International Linear Collider positron damping ring. Updated optics, wiggler magnets, and vacuum chamber designs have recently been developed for the 5 GeV, 3.2-km racetrack layout. An analysis of the synchrotron radiation profile around the ring has been performed, including the effects of diffuse and specular photon scattering on the interior surfaces of the vacuum chamber. The results provide input to the cloud buildup simulations for the various magnetic field regions of the ring. The modeled cloud densities thus obtained are used in the instability threshold calculations. We conclude that the mitigation techniques employed in this model will suffice to allow operation of the damping ring at the design operational specifications

Crittenden, J.A.; Conway, J.; Dugan, G.F.; Palmer, M.A.; Rubin, D.L.; Shanks, J.; Sonnad, K.G.; Boon, L.; Harkay, K.; Ishibashi, T.; Furman, M.A.; Guiducci, S.; Pivi, M.T.F.; Wang, L.; Crittenden, J.A.; Conway, J.; Dugan, G.F.; Palmer, M.A.; Rubin, D.L.; Shanks, J.; Sonnad, K.G.; Boon, L.; Harkay, K.; Ishibashi, T.; Furman, M.A.; Guiducci, S.; Pivi, M.T.F.; Wang, L.


Note: This page contains sample records for the topic "magnetic linear dichroism" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Journal of Magnetism and Magnetic Materials 290291 (2005) 836838 Dynamic response limits of an elastic magnet  

E-Print Network (OSTI)

on the elastomagnetic coupling but also on the interaction among the microparticles magnetic moments depending as for possible applications [1,2]. When the magnetic particles are permanently magnetized and the matrix material. Bar shaped samples have been produced with the permanent magnetic moments preferentially oriented

Franzese, Giancarlo


Towards a Future Linear Collider and The Linear Collider Studies at CERN  

ScienceCinema (OSTI)

During the week 18-22 October, more than 400 physicists will meet at CERN and in the CICG (International Conference Centre Geneva) to review the global progress towards a future linear collider. The 2010 International Workshop on Linear Colliders will study the physics, detectors and accelerator complex of a linear collider covering both the CLIC and ILC options. Among the topics presented and discussed will be the progress towards the CLIC Conceptual Design Report in 2011, the ILC Technical Design Report in 2012, physics and detector studies linked to these reports, and an increasing numbers of common working group activities. The seminar will give an overview of these topics and also CERN?s linear collider studies, focusing on current activities and initial plans for the period 2011-16. n.b: The Council Chamber is also reserved for this colloquium with a live transmission from the Main Auditorium.




Effects of a sheared ion velocity on the linear stability of ITG modes  

SciTech Connect

The linear dispersion of the ion temperature gradient (ITG) modes, in the presence of a non uniform background ion velocity U(parallel sign) U(parallel sign)(x) ez, in the direction of the sheared equilibrium magnetic field B0 = B0(x) ez, has been studied in the frame of the two-fluid guiding center approximation, in slab geometry. Generally speaking, the presence of an ion flow destabilizes the oscillations. The role of the excited K-H instability is discussed.

Lontano, M.; Lazzaro, E. [Istituto di Fisica del Plasma, C.N.R., Euratom-ENEA-CNR Association, Milan (Italy); Varischetti, M. C. [Istituto di Fisica del Plasma, C.N.R., Euratom-ENEA-CNR Association, Milan (Italy); Dipartimento di Fisica, Universita degli Studi di Milano, Milan (Italy)



Linear study of Rayleigh-Taylor instability in a diffusive quantum plasma  

SciTech Connect

The linear Rayleigh-Taylor (RT) instability in an incompressible quantum plasma is investigated on the basis of quantum magnetohydrodynamic model. It is shown that the occurrence of RT instability depends on density-temperature inhomogeneity (characteristic lengths) on one hand, and the system layer size on the other. It is also observed that the combined effects of external magnetic field, diffusivity, and quantum pressure significantly modify the dispersion properties of system in both the parallel and perpendicular directions. For any case, the imaginary and real parts of dispersion relation are presented and the possibility and conditions for the instability growth rate are discussed.

Momeni, Mahdi [Faculty of Physics, Shahrood University, Shahrood (Iran, Islamic Republic of)] [Faculty of Physics, Shahrood University, Shahrood (Iran, Islamic Republic of)



Enhanced dielectric-wall linear accelerator  

DOE Patents (OSTI)

A dielectric-wall linear accelerator is enhanced by a high-voltage, fast e-time switch that includes a pair of electrodes between which are laminated alternating layers of isolated conductors and insulators. A high voltage is placed between the electrodes sufficient to stress the voltage breakdown of the insulator on command. A light trigger, such as a laser, is focused along at least one line along the edge surface of the laminated alternating layers of isolated conductors and insulators extending between the electrodes. The laser is energized to initiate a surface breakdown by a fluence of photons, thus causing the electrical switch to close very promptly. Such insulators and lasers are incorporated in a dielectric wall linear accelerator with Blumlein modules, and phasing is controlled by adjusting the length of fiber optic cables that carry the laser light to the insulator surface. 6 figs.

Sampayan, S.E.; Caporaso, G.J.; Kirbie, H.C.



Linear plasma-based tritium production facility  

SciTech Connect

The concept presented here is an adaptation of a recently completed conceptual design of a compact high-fluence D-T neutron source for accelerated end-of-life testing of fusion reactor materials. Although this preliminary assessment serves to illustrate the main features of a linear plasma-based tritium breeder, it is not necessarily an optimized design. We believe that proper design choices for the breeder application will certainly reduce costs, perhaps as much as a factor of two. We also point out that Q (the ratio of fusion power produced to power input to the plasma) increases with system length and that the cost per kg of tritium decreases for longer systems with higher output. In earlier studies of linear two-component plasma systems, Q values as high as three were predicted. At this level of performance and with energy recovery, operating power requirements of the breeder could approach zero. 5 refs., 1 fig., 1 tab.

Coensgen, F.H.; Futch, A.H.; Molvik, A.W.



GSI Rapid Cycling Magnets Project | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

GSI Rapid Cycling Magnets Project GSI Rapid Cycling Magnets Project While superconducting magnets easily achieve higher magnetic fields at lower cost than conventional electromagnets, it is very difficult to ramp superconducting magnets very quickly. But exactly that is needed at the planned new facility of GSI, the Gesellschaft für Schwerionenforschung (Institute for Heavy Ion Research), in Darmstadt, Germany. In the magnets of the SIS 200 ring, one of the components of the new facility, the magnetic field must be ramped from 0.5 Tesla to 4 Tesla at a rate of 1 Tesla per second. This ramp rate is almost 25 times faster than the ramp rate of the Relativistic Heavy Ion Collider (RHIC) magnets at Brookhaven National Lab (BNL), which ramp at a rate of 0.042 Tesla per second. While the SIS 200 magnets also require a slightly higher field strength than the


A robustness application for linear estimation  

E-Print Network (OSTI)

, recursive algorithm for yielding estimates of the state of a linear dynamic system (see, for example, the excellent tutorial [1]). Many other applications of this estimation scheme exist in the areas of signal processing, power systems, telecommunications... on robustness causes the coefficient which maximizes J to approach the coefficient which produces maximum robustness. 37 REFERENCES [1] I. B. Rhodes, "A Tutorial Introduction to Estimation and Filtering, "IEEE Trans. on Automatic Control, vol. AC-16, pp...

Kitzman, Kenneth Victor



Positive energy quantization of linear dynamics  

E-Print Network (OSTI)

The abstract mathematical structure behind the positive energy quantization of linear classical systems is described. It is separated into 3 stages: the description of a classical system, the algebraic quantization and the Hilbert space quantization. 4 kinds of systems are distinguished: neutral bosonic, neutral bosonic, charged bosonic and charged fermionic. The formalism that is described follows closely the usual constructions employed in quantum physics to introduce non-interacting quantum fields.

Derezinski, Jan



The Next Linear Collider: NLC2001  

SciTech Connect

Recent studies in elementary particle physics have made the need for an e{sup +}e{sup -} linear collider able to reach energies of 500 GeV and above with high luminosity more compelling than ever [1]. Observations and measurements completed in the last five years at the SLC (SLAC), LEP (CERN), and the Tevatron (FNAL) can be explained only by the existence of at least one particle or interaction that has not yet been directly observed in experiment. The Higgs boson of the Standard Model could be that particle. The data point strongly to a mass for the Higgs boson that is just beyond the reach of existing colliders. This brings great urgency and excitement to the potential for discovery at the upgraded Tevatron early in this decade, and almost assures that later experiments at the LHC will find new physics. But the next generation of experiments to be mounted by the world-wide particle physics community must not only find this new physics, they must find out what it is. These experiments must also define the next important threshold in energy. The need is to understand physics at the TeV energy scale as well as the physics at the 100-GeV energy scale is now understood. This will require both the LHC and a companion linear electron-positron collider. A first Zeroth-Order Design Report (ZDR) [2] for a second-generation electron-positron linear collider, the Next Linear Collider (NLC), was published five years ago. The NLC design is based on a high-frequency room-temperature rf accelerator. Its goal is exploration of elementary particle physics at the TeV center-of-mass energy, while learning how to design and build colliders at still higher energies. Many advances in accelerator technologies and improvements in the design of the NLC have been made since 1996. This Report is a brief update of the ZDR.

D. Burke et al.



Linear feature selection for multipopulation classification  

E-Print Network (OSTI)

) December 1974 ABSTRACT Linear Feature Selection for Multipopulation Classification. (December 1974) Kathryn A. Havens, B. S. , Lamar University Chairman of Advisory Committee: Dr. L. F. Guseman, Jr. A classification procedure for n...-dimensional normally distributed observation vectors which belong to one of three populations is de- scribed. In particular, a computational procedure is presented for finding a lxn vector B which minimizes the probability of misclassification with respect...

Havens, Kathryn Anne



Subsonic Free Surface Waves in Linear Elasticity  

E-Print Network (OSTI)

For general anisotropic linear elastic solids with smooth boundaries, Rayleigh-type surface waves are studied. Using spectral factorizations of matrix polynomials, a self-contained exposition of the case of a homogeneous half-space is given first. The main result is about inhomogeneous anisotropic bodies with curved surfaces. The existence of subsonic free surface waves is shown by giving ray series asymptotic expansions, including formulas for the transport equation.

Sönke Hansen



Orbital Magnetism: Pros and Cons for Enhancing the Cluster Magnetism  

Science Journals Connector (OSTI)

The discrepancy seen in the experimental and theoretical results on the magnetic moment of a small magnetic cluster has been attributed to the contribution arising from orbital magnetism. In this Letter we show that the magnetic states with large orbital magnetic moment are not always energetically favorable; they could, however, be realizable by coating the cluster or deposing it on appropriate substrates. More importantly, our work shows that the crucial factors that determine the cluster magnetism are found to be the intrinsic, and consequently, the extrinsic properties of the constituent atoms of the cluster.

Antonis N. Andriotis and Madhu Menon



Magnetic monopole and the nature of the static magnetic field  

E-Print Network (OSTI)

We investigate the factuality of the hypothetical magnetic monopole and the nature of the static magnetic field. It is shown from many aspects that the concept of the massive magnetic monopoles clearly is physically untrue. We argue that the static magnetic field of a bar magnet, in fact, is the static electric field of the periodically quasi-one-dimensional electric-dipole superlattice, which can be well established in some transition metals with the localized d-electron. This research may shed light on the perfect unification of magnetic and electrical phenomena.

Xiuqing Huang



Magnets and Power Supplies  

NLE Websites -- All DOE Office Websites (Extended Search)

Bibliography Up: APS Storage Ring Parameters Previous: Longitudinal Bibliography Up: APS Storage Ring Parameters Previous: Longitudinal bunch profile and Magnets and Power Supplies Dipole Magnets and Power Supplies Value Dipole Number 80+1 No. of power supplies 1 Magnetic length 3.06 m Core length 3.00 m Bending radius 38.9611 m Power supply limit 500.0 A Field at 7 GeV 0.599 T Dipole trim coils Number 80+1 No. of power supplies 80 Magnetic length 3.06 m Core length 3.00 m Power supply limit 20.0 A Maximum field 0.04 T Horizontal Correction Dipoles Number 317 No. of power supplies 317 Magnetic length 0.160 m Core length 0.07 m Power supply limit 150.0 A Maximum field 0.16 T Max. deflection at 7 GeV 1.1 mrad Vertical Corrector Dipoles Number 317 No. of power supplies 317


Reversible collisionless magnetic reconnection  

SciTech Connect

Reversible magnetic reconnection is demonstrated for the first time by means of gyrokinetic numerical simulations of a collisionless magnetized plasma. Growth of a current-driven instability in a sheared magnetic field is accompanied by magnetic reconnection due to electron inertia effects. Following the instability growth, the collisionless reconnection is accelerated with development of a cross-shaped structure of current density, and then all field lines are reconnected. The fully reconnected state is followed by the secondary reconnection resulting in a weakly turbulent state. A time-reversed simulation starting from the turbulent state manifests that the collisionless reconnection process proceeds inversely leading to the initial state. During the reversed reconnection, the kinetic energy is reconverted into the original magnetic field energy. In order to understand the stability of reversed process, an external perturbation is added to the fully reconnected state, and it is found that the accelerated reconnection is reversible when the deviation of the E × B streamlines due to the perturbation is comparable with or smaller than a current layer width.

Ishizawa, A.; Watanabe, T.-H. [National Institute for Fusion Science, Toki 509-5292 (Japan)] [National Institute for Fusion Science, Toki 509-5292 (Japan)



Magnetism in Transition Metals  

Science Journals Connector (OSTI)

An attempt is made to distinguish "band-type magnetization" from "alignment-type magnetization" on the basis of whether the local moments associated with the Wannier functions on the atom sites are "induced" or "permanent." In general, the local moment is partially induced and partially permanent, and a criterion is suggested: A local moment is defined to be of the permanent variety if in the presence of magnetic forces (supposed characteristic of the crystal in a given circumstance) tending to produce a moment in one sense (z^, say) of a direction, it can maintain itself (perhaps altered in magnitude, however) in the opposite sense (-z^), as well as in z^. The internal mechanisms tending to produce permanent moments are simplified to just the Hcorr of Anderson, and the external inducing mechanism are the Heisenberg interaction and a magnetic field, Hspin, say. If Hcorr dominates Hspin, then it is shown that a local moment can maintain itself to the polarizing tendencies (whence an alignment type of magnetization calculation is appropriate), but if Hspin dominates Hcorr, then the local moment has only one sense possible in this environment (and a band type of calculation is appropriate). It is suggested that this distinction is relevant to transition metals.

M. Bailyn



Magnetic Techniques | Open Energy Information  

Open Energy Info (EERE)

Magnetic Techniques Magnetic Techniques Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Magnetic Techniques Details Activities (0) Areas (0) Regions (0) NEPA(1) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Magnetic Techniques Parent Exploration Technique: Geophysical Techniques Information Provided by Technique Lithology: Presence of magnetic minerals such as magnetite. Stratigraphic/Structural: Mapping of basement structures, horst blocks, fault systems, fracture zones, dykes and intrusions. Hydrological: The circulation of hydrothermal fluid may impact the magnetic susceptibility of rocks. Thermal: Rocks lose their magnetic properties at the Curie temperature (580° C for magnetite) [1] and, upon cooling, remagnetize in the present magnetic field orientation. The Curie point depth in the subsurface may be determined in a magnetic survey to provide information about hydrothermal activity in a region.


Magnetic neutron scattering (invited)  

Science Journals Connector (OSTI)

The application of neutron scattering techniques to magnetic problems is reviewed. We will first discuss diffraction techniques used to solve magnetic structures as well as to measure magnetic form factors order parameters critical phenomena and the scattering from low?dimensional systems. We will also discuss inelastic scattering techniques including polarized beam methods utilized to determine the spin dynamics of various materials. Information will be provided about the types of spectrometers available at the user?oriented national facilities located at Argonne National Laboratory Brookhaven National Laboratory Los Alamos National Laboratory The National Institute of Standards and Technology and Oak Ridge National Laboratory as well as the spectrometers at the Missouri University Research Reactor.

J. W. Lynn



Measurements of static electrical conductivity of a dense plasma in a magnetic field  

Science Journals Connector (OSTI)

New experimental setup for generation of a non-ideal plasma, placed in a magnetic field of up to 25 T, is presented. The plasma generation technique is based on gas compression and heating behind the front of a shock wave with the use of an explosively driven linear generator. The magnetic field is produced by a discharge of a capacitor through a solenoid reeled on the generator channel. DC electrical conductivity of the plasma is determined by two and four contact techniques. Possibilities of magnetized dense plasma generation are discussed.

N S Shilkin; D S Yuriev; S V Dudin; V B Mintsev; V E Fortov
