Powered by Deep Web Technologies
Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Magnetic soft x-ray microscopy of the domain wall depinning process in permalloy magnetic nanowires  

E-Print Network [OSTI]

R P 2002 Magnetic domain-wall logic Science 296 1688 [2]magnetic domain»wall nanowire shift register Science 320

Im, Mi-Young

2014-01-01T23:59:59.000Z

2

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning Stochastic Domain-Wall Depinning in Magnetic Nanowires Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Wednesday, 29 July 2009 00:00 Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

3

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

4

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

5

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

6

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

7

Stochastic Domain-Wall Depinning in Magnetic Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Stochastic Domain-Wall Depinning in Magnetic Nanowires Print Reliably controlling the motion of magnetic domain walls along magnetic nanowires is a key requirement for current technological development of novel classes of logic and storage devices, but understanding the nature of non-deterministic domain-wall motion remains a scientific challenge. A statistical analysis of high-resolution magnetic soft x-ray microscopy images by a Berkeley Lab-University of Hamburg group has now revealed that the stochastic behavior of the domain-wall depinning field in notch-patterned Ni80Fe20 (permalloy) nanowires depends strongly on the wire width and the notch depth. This result both provides valuable insight into the motion of magnetic-domain walls and opens a path to further technological developments in spintronics applications.

8

Spin-polarized transport through domain wall in magnetized graphene  

E-Print Network [OSTI]

Atomically thin two-dimensional layer of honeycomb crystalline carbon known as graphene is a promising system for electronics. It has a point-like Fermi surface, which is very sensitive to external potentials. In particular, Zeeman magnetic field parallel to the graphene layer splits electron bands and creates fully spin-polarized and geometrically congruent circular Fermi surfaces of particle and hole type. In the presence of electric field, particles and holes with opposite spins drift in opposite direction. These phenomena are likely to be of interest for developing graphene-based spintronic devices. A domain wall (DW) separating regions with opposite spin polarizations is a basic element of such a device. Here we consider a ballistic passage of spin-polarized charge carriers through DW in graphene. We also discuss the analogy between the generation of spin currents in graphene and in relativistic quark-gluon plasma, where the spin-polarized current is responsible for the phenomenon of charge separation studied recently at RHIC.

M. Khodas; I. A. Zaliznyak; D. E. Kharzeev

2009-04-08T23:59:59.000Z

9

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

10

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

11

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

12

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

13

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

14

Enhanced current-induced domain wall motion by tuning perpendicular magnetic anisotropy  

E-Print Network [OSTI]

The effect of perpendicular magnetic anisotropy (PMA) on current-induced domain wall (DW) motion is investigated by micromagnetic simulations. The critical current density J[subscript C] to drive DWs into periodic ...

Emori, Satoru

15

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean,...

16

Domain-wall structure in thin films with perpendicular anisotropy: Magnetic force microscopy and polarized neutron reflectometry study  

E-Print Network [OSTI]

Ferromagnetic domain patterns and three-dimensional domain-wall configurations in thin CoCrPt films with perpendicular magnetic anisotropy were studied in detail by combining magnetic force microscopy and polarized neutron ...

Navas, David

17

Metallic Interface Emerging at Magnetic Domain Wall of Antiferromagnetic Insulator---Fate of Extinct Weyl Electrons  

E-Print Network [OSTI]

Topological insulators, in contrast to ordinary semiconductors, accompany protected metallic surfaces described by Dirac-type fermions. Here, we theoretically show another emergent two-dimensional metal embedded in the bulk insulator is realized at a magnetic domain wall. The domain wall has long been studied as ingredients of both old-fashioned and leading-edge spintronics. The domain wall here, as an interface of seemingly trivial antiferromagnetic insulators, emergently realizes a functional interface preserved by zero modes with robust two-dimensional Fermi surfaces, where pyrochlore iridium oxides proposed to host condensed-matter realization of Weyl fermions offer such examples at low temperatures. The existence of ingap states pinned at domain walls, theoretically resembling spin/charge solitons in polyacetylene, and protected as the edge of hidden one-dimensional weak Chern insulators characterized by a zero-dimensional class A topological invariant, solves experimental puzzles observed in R2Ir2O7 with rare earth elements R. The domain wall realizes a novel quantum confinement of electrons and embosses a net uniform magnetization, which enables magnetic control of electronic interface transports beyond semiconductor paradigm.

Youhei Yamaji; Masatoshi Imada

2014-03-12T23:59:59.000Z

18

X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-Ray Imaging Current-Driven X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print Wednesday, 26 September 2007 00:00 The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be moved at high speed by injecting nanosecond pulses of spin-polarized currents into the wires, but the motion is largely stochastic. This result will have an impact on the current development of magnetic storage devices in which data is moved electronically rather than mechanically as in computer disk drives.

19

Domain walls in SU(5)  

Science Journals Connector (OSTI)

We consider the grand unified SU(5) model with a small or vanishing cubic term in the adjoint scalar field in the potential. This gives the model an approximate or exact Z2 symmetry whose breaking leads to domain walls. The simplest domain wall has the structure of a kink across which the Higgs field changes sign (??-?) and inside which the full SU(5) is restored. The kink is shown to be perturbatively unstable for all parameters. We then construct a domain wall solution that is lighter than the kink and show it to be perturbatively stable for a range of parameters. The symmetry in the core of this domain wall is smaller than that outside. The interactions of the domain wall with magnetic monopoles are discussed and it is shown that magnetic monopoles with certain internal space orientations relative to the wall pass through the domain wall. Magnetic monopoles in other relative internal space orientations are likely to be swept away on collision with the domain walls, suggesting a scenario where the domain walls might act like optical polarization filters, allowing certain monopole “polarizations” to pass through but not others. As SU(5) domain walls will also be formed at small values of the cubic coupling, this leads to a very complicated picture of the evolution of defects after the grand unified phase transition.

Levon Pogosian and Tanmay Vachaspati

2000-11-21T23:59:59.000Z

20

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Soft magnetic, micron-sized thin-film structures with magnetic vortices are intriguing systems that may one day be used in ultrafast computer memories. In such systems, the otherwise in-plane magnetization turns perpendicular to the plane at the center of the vortex, forming the vortex core. Because such a core has two possible polarizations (up or down) and can be switched between these two states by a small alternating magnetic field, it could serve as a memory bit in future magnetic memory devices. However, these magnetic structures often contain numerous imperfections such as domain wall pinning sites, which have to be taken into account for the practical application of such systems. To study how these defects affect the dynamics of magnetic vortices, researchers from Belgium, Germany, and the United States investigated square-shaped and disk-shaped thin-film structures with artificially introduced imperfections in the form of nanometer-sized holes. They used time-resolved scanning transmission x-ray microscopy (STXM) at ALS Beamline 11.0.2 to determine the frequency at which these vortices vibrate (their eigenfrequency). The imperfections were found to cause a higher vibrational frequency in square-shaped structures, but did not influence the disk-shaped structures. Knowledge of the frequency is crucial for vortex-based memories, since the electric signal for writing data needs to be precisely tuned to it.

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Soft magnetic, micron-sized thin-film structures with magnetic vortices are intriguing systems that may one day be used in ultrafast computer memories. In such systems, the otherwise in-plane magnetization turns perpendicular to the plane at the center of the vortex, forming the vortex core. Because such a core has two possible polarizations (up or down) and can be switched between these two states by a small alternating magnetic field, it could serve as a memory bit in future magnetic memory devices. However, these magnetic structures often contain numerous imperfections such as domain wall pinning sites, which have to be taken into account for the practical application of such systems. To study how these defects affect the dynamics of magnetic vortices, researchers from Belgium, Germany, and the United States investigated square-shaped and disk-shaped thin-film structures with artificially introduced imperfections in the form of nanometer-sized holes. They used time-resolved scanning transmission x-ray microscopy (STXM) at ALS Beamline 11.0.2 to determine the frequency at which these vortices vibrate (their eigenfrequency). The imperfections were found to cause a higher vibrational frequency in square-shaped structures, but did not influence the disk-shaped structures. Knowledge of the frequency is crucial for vortex-based memories, since the electric signal for writing data needs to be precisely tuned to it.

22

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Soft magnetic, micron-sized thin-film structures with magnetic vortices are intriguing systems that may one day be used in ultrafast computer memories. In such systems, the otherwise in-plane magnetization turns perpendicular to the plane at the center of the vortex, forming the vortex core. Because such a core has two possible polarizations (up or down) and can be switched between these two states by a small alternating magnetic field, it could serve as a memory bit in future magnetic memory devices. However, these magnetic structures often contain numerous imperfections such as domain wall pinning sites, which have to be taken into account for the practical application of such systems. To study how these defects affect the dynamics of magnetic vortices, researchers from Belgium, Germany, and the United States investigated square-shaped and disk-shaped thin-film structures with artificially introduced imperfections in the form of nanometer-sized holes. They used time-resolved scanning transmission x-ray microscopy (STXM) at ALS Beamline 11.0.2 to determine the frequency at which these vortices vibrate (their eigenfrequency). The imperfections were found to cause a higher vibrational frequency in square-shaped structures, but did not influence the disk-shaped structures. Knowledge of the frequency is crucial for vortex-based memories, since the electric signal for writing data needs to be precisely tuned to it.

23

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Influence of Domain Wall Pinning on the Dynamic Behavior of Magnetic Vortices Print Soft magnetic, micron-sized thin-film structures with magnetic vortices are intriguing systems that may one day be used in ultrafast computer memories. In such systems, the otherwise in-plane magnetization turns perpendicular to the plane at the center of the vortex, forming the vortex core. Because such a core has two possible polarizations (up or down) and can be switched between these two states by a small alternating magnetic field, it could serve as a memory bit in future magnetic memory devices. However, these magnetic structures often contain numerous imperfections such as domain wall pinning sites, which have to be taken into account for the practical application of such systems. To study how these defects affect the dynamics of magnetic vortices, researchers from Belgium, Germany, and the United States investigated square-shaped and disk-shaped thin-film structures with artificially introduced imperfections in the form of nanometer-sized holes. They used time-resolved scanning transmission x-ray microscopy (STXM) at ALS Beamline 11.0.2 to determine the frequency at which these vortices vibrate (their eigenfrequency). The imperfections were found to cause a higher vibrational frequency in square-shaped structures, but did not influence the disk-shaped structures. Knowledge of the frequency is crucial for vortex-based memories, since the electric signal for writing data needs to be precisely tuned to it.

24

Domain wall roughening in three dimensional magnets at the depinning transition M. Jost \\Lambda and K. D. Usadel \\Pi  

E-Print Network [OSTI]

Domain wall roughening in three dimensional magnets at the depinning transition M. Jost \\Lambda roughening of a driven interface between three dimensional spin­up and spin­down domains in a model with non to the depinning transition. I. INTRODUCTION A variety of interface roughening models with quenched disorder have

Usadel, K. D.

25

Domain walls riding the wave.  

SciTech Connect (OSTI)

Recent years have witnessed a rapid proliferation of electronic gadgets around the world. These devices are used for both communication and entertainment, and it is a fact that they account for a growing portion of household energy consumption and overall world consumption of electricity. Increasing the energy efficiency of these devices could have a far greater and immediate impact than a gradual switch to renewable energy sources. The advances in the area of spintronics are therefore very important, as gadgets are mostly comprised of memory and logic elements. Recent developments in controlled manipulation of magnetic domains in ferromagnet nanostructures have opened opportunities for novel device architectures. This new class of memories and logic gates could soon power millions of consumer electronic devices. The attractiveness of using domain-wall motion in electronics is due to its inherent reliability (no mechanical moving parts), scalability (3D scalable architectures such as in racetrack memory), and nonvolatility (retains information in the absence of power). The remaining obstacles in widespread use of 'racetrack-type' elements are the speed and the energy dissipation during the manipulation of domain walls. In their recent contribution to Physical Review Letters, Oleg Tretiakov, Yang Liu, and Artem Abanov from Texas A&M University in College Station, provide a theoretical description of domain-wall motion in nanoscale ferromagnets due to the spin-polarized currents. They find exact conditions for time-dependent resonant domain-wall movement, which could speed up the motion of domain walls while minimizing Ohmic losses. Movement of domain walls in ferromagnetic nanowires can be achieved by application of external magnetic fields or by passing a spin-polarized current through the nanowire itself. On the other hand, the readout of the domain state is done by measuring the resistance of the wire. Therefore, passing current through the ferromagnetic wire is the preferred method, as it combines manipulation and readout of the domain-wall state. The electrons that take part in the process of readout and manipulation of the domain-wall structure in the nanowire do so through the so-called spin transfer torque: When spin-polarized electrons in the ferromagnet nanowire pass through the domain wall they experience a nonuniform magnetization, and they try to align their spins with the local magnetic moments. The force that the electrons experience has a reaction force counterpart that 'pushes' the local magnetic moments, resulting in movement of the domain wall in the direction of the electron flow through the spin-transfer torque. The forces between the electrons and the local magnetic moments in the ferromagnet also create additional electrical resistance for the electrons passing through the domain wall. By measuring resistance across a segment of the nanowire, one determines if a domain wall is present; i.e., one can read the stored information. The interaction of the spin-polarized electrons with the domain wall in the ferromagnetic nanowire is not very efficient. Even for materials achieving high polarization of the free electrons, it is very difficult to move the magnetic domain wall. Several factors contribute to this problem, with imperfections of the ferromagnetic nanowire that cause domain-wall pinning being the dominant one. Permalloy nanowires, one of the best candidates for domain-wall-based memory and logic devices, require current densities of the order of 10{sup 8} A/cm{sup 2} in order to move a domain wall from a pinning well. Considering that this current has to pass through a relatively long wire, it is not very difficult to imagine that most of the energy will go to Joule heating. The efficiency of the process - the ratio of the energy converted to domain-wall motion to the total energy consumed - is comparable to that of an incandescent light bulb converting electricity to light. A step towards more efficient domain-wall-based memory devices is the advance of using alternating currents or curren

Karapetrov, G.; Novosad, V.; Materials Science Division

2010-11-01T23:59:59.000Z

26

Domain Walls in Gapped Graphene  

Science Journals Connector (OSTI)

The electronic properties of a particular class of domain walls in gapped graphene are investigated. We show that they can support midgap states which are localized in the vicinity of the domain wall and propagate along its length. With a finite density of domain walls, these states can alter the electronic properties of gapped graphene significantly. If the midgap band is partially filled, the domain wall can behave like a one-dimensional metal embedded in a semiconductor and could potentially be used as a single-channel quantum wire.

G. W. Semenoff; V. Semenoff; Fei Zhou

2008-08-21T23:59:59.000Z

27

Domain Walls, Triples and Acceleration  

E-Print Network [OSTI]

We present a construction of domain walls in string theory. The domain walls can bridge both Minkowski and AdS string vacua. A key ingredient in the construction are novel classical Yang-Mills configurations, including instantons, which interpolate between toroidal Yang-Mills vacua. Our construction provides a concrete framework for the study of inflating metrics in string theory. In some cases, the accelerating space-time comes with a holographic description. The general form of the holographic dual is a field theory with parameters that vary over space-time.

Travis Maxfield; Savdeep Sethi

2014-04-09T23:59:59.000Z

28

Dynamics of Domain Wall Networks  

E-Print Network [OSTI]

Networks or webs of domain walls are admitted in Abelian or non-Abelian gauge theory coupled to fundamental Higgs fields with complex masses. We examine the dynamics of the domain wall loops by using the moduli approximation and find a phase rotation induces a repulsive force which can be understood as a Noether charge of Q-solitons. Non-Abelian gauge theory allows different types of loops which can be deformed to each other by changing a modulus. This admits the moduli geometry like a sandglass made by gluing the tips of the two cigar-(cone-)like metrics of a single triangle loop. We conclude that the sizes of all loops tend to grow for a late time in general models with complex Higgs masses, while the sizes are stabilized at some values once triplet masses are introduced for the Higgs fields. We also show that the stationary motion on the moduli space of the domain wall webs represents 1/4 BPS Q-webs of walls.

Minoru Eto; Toshiaki Fujimori; Takayuki Nagashima; Muneto Nitta; Keisuke Ohashi; Norisuke Sakai

2007-07-22T23:59:59.000Z

29

Dynamics of domain wall networks  

SciTech Connect (OSTI)

Networks or webs of domain walls are admitted in Abelian or non-Abelian gauge theory coupled to fundamental Higgs fields with complex masses. We examine the dynamics of the domain wall loops by using the moduli approximation and find a phase rotation induces a repulsive force which can be understood as a Noether charge of Q-solitons. Non-Abelian gauge theory allows different types of loops which can be deformed to each other by changing a modulus. This admits the moduli geometry like a sandglass made by gluing the tips of the two cigar-(cone-)like metrics of a single triangle loop. We conclude that the sizes of all loops tend to grow for a late time in general models with complex Higgs masses, while the sizes are stabilized at some values once triplet masses are introduced for the Higgs fields. We also show that the stationary motion on the moduli space of the domain wall webs represents 1/4 Bogomol'nyi-Prasad-Sommerfield Q-webs of walls.

Eto, Minoru [INFN, Sezione di Pisa, Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Department of Physics, University of Pisa Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Fujimori, Toshiaki; Nagashima, Takayuki; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Nitta, Muneto [Department of Physics, Keio University, Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan); Ohashi, Keisuke [Department of Applied Mathematics and Theoretical Physics, University of Cambridge, CB3 0WA (United Kingdom)

2007-12-15T23:59:59.000Z

30

Domain wall induced magnetoresistance in a superconductor/ferromagnet nanowire  

E-Print Network [OSTI]

In a nanowire consisting of a ferromagnet/insulator/superconductor multilayer structure, the superconductivity is shown to depend strongly on the configuration of the magnetic domain walls in the neighboring ferromagnetic ...

Miao, G. X.

31

Journal of Magnetism and Magnetic Materials 272276 (2004) e1347e1348 Domain wall drag due to dc current injection into  

E-Print Network [OSTI]

, was fabricated by a conventional lift-off technique. In this system, a domain wall is generally nucleated [3]. The resistivity measurements were performed at 3 K using a four- terminal DC measurement system current at the bias field of 160 Oe: Here In and Vn are the current and the voltage at nth measured point

Otani, Yoshichika

32

Skyrmions from Instantons inside Domain Walls  

SciTech Connect (OSTI)

Some years ago, Atiyah and Manton described a method to construct approximate Skyrmion solutions from Yang-Mills instantons. Here we present a dynamical realization of this construction using domain walls in a five-dimensional gauge theory. The non-Abelian gauge symmetry is broken in each vacuum but restored in the core of the domain wall, allowing instantons to nestle inside the wall. We show that the world volume dynamics of the wall is given by the Skyrme model, including the four-derivative term, and the instantons appear as domain wall Skyrmions.

Eto, Minoru; Nitta, Muneto; Ohashi, Keisuke [Department of Physics, Tokyo Institute of Technology, Tokyo, 152-8551 (Japan); Tong, David [Department of Applied Mathematics and Theoretical Physics, University of Cambridge, Cambridge CB3 0WA (United Kingdom)

2005-12-16T23:59:59.000Z

33

Skyrmions from Instantons inside Domain Walls  

E-Print Network [OSTI]

Some years ago, Atiyah and Manton described a method to construct approximate Skyrmion solutions from Yang-Mills instantons. Here we present a dynamical realization of this construction using domain walls in a five-dimensional gauge theory. The non-abelian gauge symmetry is broken in each vacuum but restored in the core of the domain wall, allowing instantons to nestle inside the wall. We show that the worldvolume dynamics of the wall is given by the Skyrme model, including the four-derivative term, and the instantons appear as Skyrmions.

Minoru Eto; Muneto Nitta; Keisuke Ohashi; David Tong

2005-08-18T23:59:59.000Z

34

Quantum Fusion of Domain Walls with Fluxes  

E-Print Network [OSTI]

We study how fluxes on the domain wall world volume modify quantum fusion of two distant parallel domain walls into a composite wall. The elementary wall fluxes can be separated into parallel and antiparallel components. The parallel component affects neither the binding energy nor the process of quantum merger. The antiparallel fluxes, instead, increase the binding energy and, against naive expectations, suppress quantum fusion. In the small flux limit we explicitly find the bounce solution and the fusion rate as a function of the flux. We argue that at large (antiparallel) fluxes there exists a critical value of the flux (versus the difference in the wall tensions), which switches off quantum fusion altogether. This phenomenon of flux-related wall stabilization is rather peculiar: it is unrelated to any conserved quantity. Our consideration of the flux-related all stabilization is based on substantiated arguments that fall short of complete proof.

S. Bolognesi; M. Shifman; M. B. Voloshin

2009-07-20T23:59:59.000Z

35

Thermodynamics of free Domain Wall fermions  

E-Print Network [OSTI]

Studying various thermodynamic quantities for the free domain wall fermions for both finite and infinite fifth dimensional extent N_5, we find that the lattice corrections are minimum for $N_T\\geq10$ for both energy density and susceptibility, for its irrelevant parameter M in the range 1.45-1.50. The correction terms are, however, quite large for small lattice sizes of $N_T\\leq8$. We propose modifications of the domain wall operator, as well as the overlap operator, to reduce the finite cut-off effects to within 10% of the continuum results of the thermodynamic quantities for the currently used N_T=6-8 lattices. Incorporating chemical potential, we show that \\mu^2 divergences are absent for a large class of such domain wall fermion actions although the chiral symmetry is broken for $\\mu\

R. V. Gavai; Sayantan Sharma

2008-11-19T23:59:59.000Z

36

Domain walls with non-Abelian clouds  

SciTech Connect (OSTI)

Domain walls in U(N) gauge theories, coupled to Higgs scalar fields with degenerate masses, are shown to possess normalizable non-Abelian Nambu-Goldstone (NG) modes, which we call non-Abelian clouds. We construct the moduli space metric and its Kaehler potential of the effective field theory on the domain walls by focusing on two models: a U(1) gauge theory with several charged Higgs fields, and a U(N) gauge theory with 2N Higgs fields in the fundamental representation. We find that non-Abelian clouds spread between two domain walls and that their rotation induces a long-range repulsive force, in contrast to a U(1) mode in models with fully nondegenerate masses which gives a short-range force. We also construct a bound state of dyonic domain walls by introducing the imaginary part of the Higgs masses. In the latter model we find that when all walls coincide, SU(N){sub L}xSU(N){sub R}xU(1) symmetry is broken down to SU(N){sub V}, and U(N){sub A} NG modes and the same number of quasi-NG modes are localized on the wall. When n walls separate, off-diagonal elements of U(n) NG modes have wave functions spreading between two separated walls (non-Abelian clouds), whereas some quasi-NG modes turn to NG bosons as a result of further symmetry breaking U(n){sub V}{yields}U(1){sub V}{sup n}. In the case of 4+1-dimensional bulk, we can dualize the effective theory to the supersymmetric Freedman-Townsend model of non-Abelian 2-form fields.

Eto, Minoru [INFN, Sezione di Pisa, Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Department of Physics, University of Pisa Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Fujimori, Toshiaki; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Nitta, Muneto [Department of Physics, Keio University, Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan); Ohashi, Keisuke [Department of Applied Mathematics and Theoretical Physics, University of Cambridge, CB3 0WA (United Kingdom)

2008-06-15T23:59:59.000Z

37

Effective Action of Domain Wall Networks  

E-Print Network [OSTI]

U(Nc) gauge theory with Nf fundamental scalars admits BPS junctions of domain walls. When the networks/webs of these walls contain loops, their size moduli give localized massless modes. We construct Kahler potential of their effective action. In the large size limit Kahler metric is well approximated by kinetic energy of walls and junctions, which is understood in terms of tropical geometry. Kahler potential can be expressed in terms of hypergeometric functions which are useful to understand small size behavior. Even when the loop shrinks, the metric is regular with positive curvature. Moduli space of a single triangle loop has a geometry between a cone and a cigar.

Minoru Eto; Toshiaki Fujimori; Takayuki Nagashima; Muneto Nitta; Keisuke Ohashi; Norisuke Sakai

2006-12-01T23:59:59.000Z

38

Conserved currents for Mobius Domain Wall Fermions  

E-Print Network [OSTI]

We derive the exactly conserved vector, and almost conserved axial currents for rational approximations to the overlap operator with a general Mobius kernel. The approach maintains manifest Hermiticity, and allows matrix elements of the currents to be constructed at no extra cost after solution of the usual 5d system of equations, similar to the original approach of Furman and Shamir for domain wall Fermions.

P. A. Boyle

2014-11-20T23:59:59.000Z

39

Effective action of domain wall networks  

SciTech Connect (OSTI)

U(N{sub C}) gauge theory with N{sub F} fundamental scalars admits BPS junctions of domain walls. When the networks/webs of these walls contain loops, their size moduli give localized massless modes. We construct Kaehler potential of their effective action. In the large size limit Kaehler metric is well approximated by kinetic energy of walls and junctions, which is understood in terms of tropical geometry. Kaehler potential can be expressed in terms of hypergeometric functions that are useful to understand small size behavior. Even when the loop shrinks, the metric is regular with positive curvature. Moduli space of a single triangle loop has a geometry between a cone and a cigar.

Eto, Minoru [Institute of Physics, University of Tokyo, Komaba 3-8-1, Tokyo 153-8902 (Japan); Fujimori, Toshiaki; Nagashima, Takayuki; Ohashi, Keisuke; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Nitta, Muneto [Department of Physics, Keio University, Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan)

2007-02-15T23:59:59.000Z

40

Domain Walls and Vortices in Chiral Symmetry Breaking  

E-Print Network [OSTI]

We study domain walls and vortices in chiral symmetry breaking in a QCD-like theory with N flavors in the chiral limit. If the axial anomaly is absent, there exist stable Abelian axial vortices winding around the spontaneously broken U(1)_A symmetry and non-Abelian axial vortices winding around both the U(1)_A and non-Abelian SU(N) chiral symmetries. In the presence of the axial anomaly term, metastable domain walls are present and Abelian axial vortices must be attached by N domain walls, forming domain wall junctions. We show that a domain wall junction decays into N non-Abelian vortices attached by domain walls, implying its metastability. We also show that domain walls decay through the quantum tunneling by creating a hole bounded by a closed non-Abelian vortex.

Minoru Eto; Yuji Hirono; Muneto Nitta

2013-09-18T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Melting Instantons, Domain Walls, and Large N  

E-Print Network [OSTI]

Monte Carlo studies of $CP^{N-1}$ sigma models have shown that the structure of topological charge in these models undergoes a sharp transition at $N=N_c\\approx 4$. For $NN_c$ it is dominated by extended, thin, 1-dimensionally coherent membranes of topological charge, which can be interpreted as domain walls between discrete quasi-stable vacua. These vacua differ by a unit of background electric flux. The transition can be identified as the delocalization of topological charge, or "instanton melting," a phenomenon first suggested by Witten to resolve the conflict between instantons and large $N$ behavior. Implications for $QCD$ are discussed.

H. B. Thacker

2008-10-22T23:59:59.000Z

42

Phase-field simulation of strain-induced domain switching in magnetic thin films  

E-Print Network [OSTI]

Phase-field simulation of strain-induced domain switching in magnetic thin films Jia-Mian Hu, G of the Bloch point in a magnetic film with strong uniaxial magnetic anisotropy Low Temp. Phys. 37, 690 (2011) Evolution of magnetic bubble domains in manganite films Appl. Phys. Lett. 99, 042503 (2011) 360° domain wall

Chen, Long-Qing

43

D-brane Configurations for Domain Walls and Their Webs  

SciTech Connect (OSTI)

Supersymmetric U(NC) gauge theory with NF massive hypermultiplets in the fundamental representation admits various BPS solitons like domain walls and their webs. In the first part we show as a review of the previous paper that domain walls are realized as kinky fractional D3-branes interpolating between separated D7-branes. In the second part we discuss brane configurations for domain wall webs. This is a contribution to the conference based on the talk given by MN.

Eto, Minoru; Isozumi, Youichi; Nitta, Muneto; Ohashi, Keisuke; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Ohta, Kazutoshi [Theoretical Physics Laboratory, Institute of Physical and Chemical Research (RIKEN), 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan)

2005-12-02T23:59:59.000Z

44

Domain wall QCD with physical quark masses  

E-Print Network [OSTI]

We present results for several light hadronic quantities ($f_\\pi$, $f_K$, $B_K$, $m_{ud}$, $m_s$, $t_0^{1/2}$, $w_0$) obtained from simulations of 2+1 flavor domain wall lattice QCD with large physical volumes and nearly-physical pion masses at two lattice spacings. We perform a short, O(3)%, extrapolation in pion mass to the physical values by combining our new data in a simultaneous chiral/continuum `global fit' with a number of other ensembles with heavier pion masses. We use the physical values of $m_\\pi$, $m_K$ and $m_\\Omega$ to determine the two quark masses and the scale - all other quantities are outputs from our simulations. We obtain results with sub-percent statistical errors and negligible chiral and finite-volume systematics for these light hadronic quantities, including: $f_\\pi$ = 130.2(9) MeV; $f_K$ = 155.5(8) MeV; the average up/down quark mass and strange quark mass in the $\\overline {\\rm MS}$ scheme at 3 GeV, 2.997(49) and 81.64(1.17) MeV respectively; and the neutral kaon mixing parameter, $B_K$, in the RGI scheme, 0.750(15) and the $\\overline{\\rm MS}$ scheme at 3 GeV, 0.530(11).

RBC; UKQCD collaborations; :; T. Blum; P. A. Boyle; N. H. Christ; J. Frison; N. Garron; R. J. Hudspith; T. Izubuchi; T. Janowski; C. Jung; A. Juettner; C. Kelly; R. D. Kenway; C. Lehner; M. Marinkovic; R. D. Mawhinney; G. McGlynn; D. J. Murphy; S. Ohta; A. Portelli; C. T. Sachrajda; A. Soni

2014-11-25T23:59:59.000Z

45

Dynamics of domain wall networks with junctions  

SciTech Connect (OSTI)

We use a combination of analytic tools and an extensive set of the largest and most accurate three-dimensional field theory numerical simulations to study the dynamics of domain wall networks with junctions. We build upon our previous work and consider a class of models which, in the limit of large number N of coupled scalar fields, approaches the so-called ''ideal'' model (in terms of its potential to lead to network frustration). We consider values of N between N=2 and N=20, and a range of cosmological epochs, and we also compare this class of models with other toy models used in the past. In all cases we find compelling evidence for a gradual approach to scaling, strongly supporting our no-frustration conjecture. We also discuss the various possible types of junctions (including cases where there is a hierarchy of them) and their roles in the dynamics of the network. Finally, we provide a cosmological Zel'dovich-type bound on the energy scale of this kind of defect network: it must be lower than 10 keV.

Avelino, P. P.; Oliveira, J. C. R. E. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica da Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Martins, C. J. A. P. [Centro de Astrofisica da Universidade do Porto, Rua das Estrelas s/n, 4150-762 Porto (Portugal); DAMTP, University of Cambridge, Wilberforce Road, Cambridge CB3 0WA (United Kingdom); Menezes, J. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Centro de Astrofisica da Universidade do Porto, Rua das Estrelas s/n, 4150-762 Porto (Portugal); Departamento de Fisica, Universidade Federal da Paraiba, Caixa Postal 5008, 58051-970 Joao Pessoa, Paraiba (Brazil); Menezes, R. [Departamento de Fisica, Universidade Federal da Paraiba, Caixa Postal 5008, 58051-970 Joao Pessoa, Paraiba (Brazil)

2008-11-15T23:59:59.000Z

46

Electric and Magnetic Walls on Dielectric Interfaces  

E-Print Network [OSTI]

Sufficient conditions of the existence of electric or magnetic walls on dielectric interfaces are given for a multizone uniform dielectric waveguiding system. If one of two adjacent dielectric zones supports a TEM field distribution while the other supports a TM (TE) field distribution, then the common dielectric interface behaves as an electric (magnetic) wall, that is, the electric (magnetic) field line is perpendicular to the interface while the magnetic (electric) field line is parallel to the interface.

Changbiao Wang

2010-07-20T23:59:59.000Z

47

Domain walls and long-range triplet correlations in SFS Josephson junctions  

Science Journals Connector (OSTI)

We study the contribution of domain walls to the Josephson current through a ferromagnetic metal both in clean and diffusive limits. Our consideration of these limits is based on the quasiclassical version of the Bogoliubov–de Gennes equations and the Usadel theory, correspondingly. In the clean limit, the domain walls connecting superconducting leads are shown to be responsible for strong enhancement of the Josephson current, even for a domain structure with collinear magnetic moments. In the dirty limit, a noticeable increase in the critical current appears only for a system with noncollinear magnetic moments. We demonstrate that a thin domain wall in this case may serve as an efficient source of the long-range triplet proximity effect.

A. I. Buzdin; A. S. Mel’nikov; N. G. Pugach

2011-04-19T23:59:59.000Z

48

Argonne CNM News: Study of Ferroelectric Domain Walls Offers a New  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Study of Ferroelectric Domain Walls Offers a New Nanoscale Conduction Path Study of Ferroelectric Domain Walls Offers a New Nanoscale Conduction Path Scanning tunneling microscopy tips SPM images of the (110) surface of cleaved h-HoMnO3. (top) PFM image showing in-plane ferroelectric domains (oriented vertically, red arrows). (bottom) cAFM image showing enhanced conduction along tail-to-tail domain walls; images are 4 microns per side. Facility users from Rutgers University together with the Center for Nanoscale Materials' Electronic & Magnetic Materials & Devices Group have identified two-dimensional sheets of charge formed at the boundaries of ferroelectric domains in a multiferroic material. These two-dimensional charged sheets are not pinned by unstable defects, chemical dopants, or structural interface, but are formed naturally as the inevitable

49

SUBCRITICAL BUBBLES NEAR THE PHASE SPACE DOMAIN WALL  

E-Print Network [OSTI]

We study the subcritical bubble formation near the phase space domain wall. We take into account that the phase of the scalar field can vary using complex U(1) symmetric field and a phenomenological potential with cubic term responsible to symmetry breaking. We show that the presence of the domain wall induces subcritical bubbles so that their formation rate near the wall is considerably larger than far of it. The allowed deviations of the phases of new bubbles are so large that they prevent the system from induced nucleation.

J. Sirkka; I. Vilja

1995-03-31T23:59:59.000Z

50

Magnetic field in a finite toroidal domain  

SciTech Connect (OSTI)

The magnetic field structure in a domain surrounded by a closed toroidal magnetic surface is analyzed. It is shown that ergodization of magnetic field lines is possible even in a regular field configuration (with nonvanishing toroidal component). A unified approach is used to describe magnetic fields with nested toroidal (possibly asymmetric) flux surfaces, magnetic islands, and ergodic field lines.

Ilgisonis, V. I.; Skovoroda, A. A., E-mail: skovorod@nfi.kiae.r [Russian Research Centre Kurchatov Institute (Russian Federation)

2010-05-15T23:59:59.000Z

51

Magnetically multiplexed heating of single domain nanoparticles  

E-Print Network [OSTI]

Selective hysteretic heating of multiple collocated types of single domain magnetic nanoparticles (SDMNPs) by alternating magnetic fields (AMFs) may offer a useful tool for biomedical applications. The possibility of ...

Romero, G.

52

Webs of domain walls in supersymmetric gauge theories  

SciTech Connect (OSTI)

Webs of domain walls are constructed as 1/4 Bogomol'nyi-Prasad-Sommerfield (BPS) states in d=4, N=2 supersymmetric U(N{sub C}) gauge theories with N{sub F} hypermultiplets in the fundamental representation. Webs of walls can contain any numbers of external legs and loops like (p,q) string/5-brane webs. We find the moduli space M of a 1/4 BPS equation for wall webs to be the complex Grassmann manifold. When moduli spaces of 1/2 BPS states (parallel walls) and the vacua are removed from M, the noncompact moduli space of genuine 1/4 BPS wall webs is obtained. All the solutions are obtained explicitly and exactly in the strong gauge coupling limit. In the case of Abelian gauge theory, we work out the correspondence between configurations of wall web and the moduli space CP{sup N{}sub F}{sup -1}.

Eto, Minoru; Isozumi, Youichi; Nitta, Muneto; Ohashi, Keisuke; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan)

2005-10-15T23:59:59.000Z

53

Long-range strains and the effects of applied field at 180 ferroelectric domain walls in lithium niobate  

E-Print Network [OSTI]

to applied fields are present around domain walls long before permanent changes are induced. DOI: 10 the magnetic polarization can rotate continuously across a Bloch wall from one orientation to another, the strong coupling between ferroelectric polarization and lattice strain restricts the polarization

Gopalan, Venkatraman

54

Hidden Rotational Symmetries in Magnetic Domain Patterns  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hidden Rotational Symmetries in Magnetic Domain Patterns Print Hidden Rotational Symmetries in Magnetic Domain Patterns Print Magnetic thin films have complicated domain patterns that may or may not repeat with each cycle through a hysteresis loop. A magnetic thin film with perpendicular anisotropy, such as that used in computer hard drives, for example, commonly exhibits labyrinthine domain patterns. These patterns are disordered over a macroscopic length scale, and intuitively we do not expect to observe any symmetry in such systems. Scientists at the ALS, the University of Oregon, and the University of California, San Diego, have recently used coherent soft x-ray scattering with angular Fourier analysis to discover that the disordered domain patterns do, in fact, exhibit rotational symmetries, which can be as small as two-fold or as large as 30-fold. Their study of magnetic symmetries gives scientists a toolbox for discovering hidden symmetries in diverse material systems.

55

Hidden Rotational Symmetries in Magnetic Domain Patterns  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hidden Rotational Symmetries in Hidden Rotational Symmetries in Magnetic Domain Patterns Hidden Rotational Symmetries in Magnetic Domain Patterns Print Wednesday, 27 June 2012 00:00 Magnetic thin films have complicated domain patterns that may or may not repeat with each cycle through a hysteresis loop. A magnetic thin film with perpendicular anisotropy, such as that used in computer hard drives, for example, commonly exhibits labyrinthine domain patterns. These patterns are disordered over a macroscopic length scale, and intuitively we do not expect to observe any symmetry in such systems. Scientists at the ALS, the University of Oregon, and the University of California, San Diego, have recently used coherent soft x-ray scattering with angular Fourier analysis to discover that the disordered domain patterns do, in fact, exhibit rotational symmetries, which can be as small as two-fold or as large as 30-fold. Their study of magnetic symmetries gives scientists a toolbox for discovering hidden symmetries in diverse material systems.

56

Spin torque and heating effects in current-induced domain wall motion probed by transmission electron microscopy  

E-Print Network [OSTI]

Spin torque and heating effects in current-induced domain wall motion probed by transmission- ternative to the use of conventional external magnetic fields, therefore opening up a route for simple device fabrication, where no field-generating strip lines are necessary. While current-induced domain

Dunin-Borkowski, Rafal E.

57

Evaluation of magnetic flux distribution from magnetic domains in [Co/Pd] nanowires by magnetic domain scope method using contact-scanning of tunneling magnetoresistive sensor  

SciTech Connect (OSTI)

Current-driven magnetic domain wall motions in magnetic nanowires have attracted great interests for physical studies and engineering applications. The magnetic force microscope (MFM) is widely used for indirect verification of domain locations in nanowires, where relative magnetic force between the local domains and the MFM probe is used for detection. However, there is an occasional problem that the magnetic moments of MFM probe influenced and/or rotated the magnetic states in the low-moment nanowires. To solve this issue, the “magnetic domain scope for wide area with nano-order resolution (nano-MDS)” method has been proposed recently that could detect the magnetic flux distribution from the specimen directly by scanning of tunneling magnetoresistive field sensor. In this study, magnetic domain structure in nanowires was investigated by both MFM and nano-MDS, and the leakage magnetic flux density from the nanowires was measured quantitatively by nano-MDS. Specimen nanowires consisted from [Co (0.3)/Pd (1.2)]{sub 21}/Ru(3) films (units in nm) with perpendicular magnetic anisotropy were fabricated onto Si substrates by dual ion beam sputtering and e-beam lithography. The length and the width of the fabricated nanowires are 20??m and 150?nm. We have succeeded to obtain not only the remanent domain images with the detection of up and down magnetizations as similar as those by MFM but also magnetic flux density distribution from nanowires directly by nano-MDS. The obtained value of maximum leakage magnetic flux by nano-MDS is in good agreement with that of coercivity by magneto-optical Kerr effect microscopy. By changing the protective diamond-like-carbon film thickness on tunneling magnetoresistive sensor, the three-dimensional spatial distribution of leakage magnetic flux could be evaluated.

Okuda, Mitsunobu, E-mail: okuda.m-ky@nhk.or.jp; Miyamoto, Yasuyoshi; Miyashita, Eiichi; Hayashi, Naoto [NHK Science and Technology Research Laboratories, 1-10-11 Kinuta Setagaya, Tokyo 157-8510 (Japan)

2014-05-07T23:59:59.000Z

58

BPS domain wall junctions in infinitely large extra dimensions  

Science Journals Connector (OSTI)

We consider models of scalar fields coupled to gravity which are higher-dimensional generalizations of four dimensional supergravity. We use these models to describe domain wall junctions in an anti–de Sitter background. We derive Bogomol’nyi equations for the scalar fields from which the walls are constructed and for the metric. From these equations a BPS-like formula for the junction energy can be derived. We demonstrate that such junctions localize gravity in the presence of more than one uncompactified extra dimension.

Sean M. Carroll; Simeon Hellerman; Mark Trodden

2000-07-27T23:59:59.000Z

59

Domain-growth kinetics of systems with soft walls  

Science Journals Connector (OSTI)

It has recently been suggested by Mouritsen on the basis of computer simulations that systems with soft domain walls exhibit slower domain growth than the R?t1/2 growth law predicted by Lifshitz and Allen and Cahn. We underscore the reasons to believe this interpretation of the data to be incorrect and draw attention to an experiment by Pindak, Young, Meyer, and Clark, whose results are in complete agreement with the predictions of Allen and Cahn. The reason for the unexpected growth dynamics observed in Mouritsen’s simulations is suggested.

Wim van Saarloos and Martin Grant

1988-02-01T23:59:59.000Z

60

Phenomenological theory of a single domain wall in uniaxial trigonal ferroelectrics: Lithium niobate and lithium tantalate  

E-Print Network [OSTI]

Phenomenological theory of a single domain wall in uniaxial trigonal ferroelectrics: Lithium niobate and lithium tantalate David A. Scrymgeour and Venkatraman Gopalan Department of Materials Science, lithium niobate and lithium tantalate. The contributions to the domain- wall energy from polarization

Gopalan, Venkatraman

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Domain wall network evolution in (N+1)-dimensional FRW universes  

SciTech Connect (OSTI)

We develop a velocity-dependent one-scale model for the evolution of domain wall networks in flat expanding or collapsing homogeneous and isotropic universes with an arbitrary number of spatial dimensions, finding the corresponding scaling laws in frictionless and friction dominated regimes. We also determine the allowed range of values of the curvature parameter and the expansion exponent for which a linear scaling solution is possible in the frictionless regime.

Avelino, P. P. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica da Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica, Universidade Federal da Paraiba 58051-970 Joao Pessoa, Paraiba (Brazil); Sousa, L. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica da Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal)

2011-02-15T23:59:59.000Z

62

Dynamics of biased domain walls and the devaluation mechanism  

SciTech Connect (OSTI)

We study the evolution of biased domain walls in the early universe. We explicitly discuss the roles played by the surface tension and volume pressure in the evolution of the walls, and quantify their effects by looking at the collapse of spherical wall solutions. We then apply our results to a particular mechanism, known as the devaluation scenario, in which the dynamics of biased domain walls was suggested as a possible solution to the cosmological constant problem. Our results indicate that devaluation will, in general, lead to values of the cosmological constant that differ by several orders of magnitude from the observationally inferred value, {rho}{sub vac}{sup 1/4}{approx}10{sup -3} eV. We also argue that the reasons behind this are not specific to a particular realization, and are expected to persist in any scenario of this kind, except if a low-energy cutoff on the spectra of vacuum energy densities, of the order of the critical density at the present time, is postulated. This implies that any such scenario will require a fine-tuning similar to the usual one.

Avelino, P. P.; Sousa, L. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica da Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Martins, C. J. A. P. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas s/n, 4150-762 Porto (Portugal); DAMTP, University of Cambridge, Wilberforce Road, Cambridge CB3 0WA (United Kingdom)

2008-08-15T23:59:59.000Z

63

Propagating and reflecting of spin wave in permalloy nanostrip with 360° domain wall  

SciTech Connect (OSTI)

By micromagnetic simulation, we investigated the interaction between propagating spin wave (or magnonic) and a 360° domain wall in a nanostrip. It is found that propagating spin wave can drive a 360° domain wall motion, and the velocity and direction are closely related to the transmission coefficient of the spin wave of the domain wall. When the spin wave passes through the domain wall completely, the 360° domain wall moves toward the spin wave source. When the spin wave is reflected by the domain wall, the 360° domain wall moves along the spin wave propagation direction. Moreover, when the frequency of the spin wave is coincident with that of the 360° domain wall normal mode, the 360° domain wall velocity will be resonantly enhanced no matter which direction the 360 DW moves along. On the other hand, when the spin wave is reflected from the moving 360° domain wall, we observed the Doppler effect clearly. After passing through a 360° domain wall, the phase of the spin wave is changed, and the phase shift is related to the frequency. Nevertheless, phase shift could be manipulated by the number of 360° domain walls that spin wave passing through.

Zhang, Senfu; Mu, Congpu; Zhu, Qiyuan; Zheng, Qi; Liu, Xianyin; Wang, Jianbo; Liu, Qingfang, E-mail: liuqf@lzu.edu.cn [Key Laboratory for Magnetism and Magnetic Materials of Ministry of Education, Lanzhou University, Lanzhou 730000 (China)

2014-01-07T23:59:59.000Z

64

Magnetic spectral bounds on starlike plane domains  

E-Print Network [OSTI]

We develop sharp upper bounds for energy levels of the magnetic Laplacian on starlike plane domains, under either Dirichlet or Neumann boundary conditions and assuming a constant magnetic field in the transverse direction. Our main result says that $\\sum_{j=1}^n \\Phi \\big( \\lambda_j A/G \\big)$ is maximal for a disk whenever $\\Phi$ is concave increasing, $n \\geq 1$, the domain has area $A$, and $\\lambda_j$ is the $j$-th Dirichlet eigenvalue of the magnetic Laplacian $\\big( i\

R. S. Laugesen; B. A. Siudeja

2014-01-04T23:59:59.000Z

65

Energy-momentum balance in particle - domain wall perforating collision  

E-Print Network [OSTI]

We investigate the energy-momentum balance in the perforating collision of a point particle with an infinitely thin planar domain wall within the linearized gravity in arbitrary dimensions. Since the metric of the wall increases with distance, the wall and the particle are never free, and their energy-momentum balance involves not only the instantaneous kinetic momenta, but also the non-local contribution of gravitational stresses. However, careful analysis shows that the stresses can be unambiguously divided between the colliding objects leading to definition of the gravitationally dressed momenta. These take into account for gravity in the same way as the potential energy does in the non-relativistic theory, but our treatment is fully relativistic. Another unusual feature of our problem is the non-vanishing flux of the total energy-momentum tensor through the lateral surface of the world tube. In this case the zero divergence of the energy-momentum tensor does not imply conservation of the total momentum defined as the integral over the space-like section of the tube. But one can still define the conservation low infinitesimally, passing to time derivatives of the momenta. Using this definition we establish the momentum balance in terms of the dressed particle and wall momenta.

D. V. Gal'tsov; E. Yu. Melkumova; P. A. Spiirin

2014-11-01T23:59:59.000Z

66

Energy-momentum balance in particle - domain wall perforating collision  

E-Print Network [OSTI]

We investigate the energy-momentum balance in the perforating collision of a point particle with an infinitely thin planar domain wall within the linearized gravity in arbitrary dimensions. Since the metric of the wall increases with distance, the wall and the particle are never free, and their energy-momentum balance involves not only the instantaneous kinetic momenta, but also the non-local contribution of gravitational stresses. However, careful analysis shows that the stresses can be unambiguously divided between the colliding objects leading to definition of the gravitationally dressed momenta. These take into account for gravity in the same way as the potential energy does in the non-relativistic theory, but our treatment is fully relativistic. Another unusual feature of our problem is the non-vanishing flux of the total energy-momentum tensor through the lateral surface of the world tube. In this case the zero divergence of the energy-momentum tensor does not imply conservation of the total momentum de...

Gal'tsov, D V; Spiirin, P A

2014-01-01T23:59:59.000Z

67

Interface Magnetism in Multiferroics  

E-Print Network [OSTI]

1.2.1 Magnetism . . . . . . . . . . . . . . . . . . . 1.2.2domain walls . . . . . 3 Magnetism of domain walls in BiFeOof electrical control of magnetism in mixed phase BiFeO 3

He, Qing

2011-01-01T23:59:59.000Z

68

Investigation of dominant spin wave modes by domain walls collision  

SciTech Connect (OSTI)

Spin wave emission due to field-driven domain wall (DW) collision has been investigated numerically and analytically in permalloy nanowires. The spin wave modes generated are diagonally symmetric with respect to the collision point. The non-propagating mode has the highest amplitude along the middle of the width. The frequency of this mode is strongly correlated to the nanowire geometrical dimensions and is independent of the strength of applied field within the range of 0.1?mT to 1?mT. For nanowire with film thickness below 5?nm, a second spin wave harmonic mode is observed. The decay coefficient of the spin wave power suggests that the DWs in a memory device should be at least 300?nm apart for them to be free of interference from the spin waves.

Ramu, M.; Purnama, I.; Goolaup, S.; Chandra Sekhar, M.; Lew, W. S., E-mail: wensiang@ntu.edu.sg [School of Physical and Mathematical Sciences, Nanyang Technological University, 21 Nanyang Link, Singapore 637371 (Singapore)

2014-06-28T23:59:59.000Z

69

Existence and uniqueness of domain wall solitons in a Maxwell–Chern–Simons model  

SciTech Connect (OSTI)

We present some sharp existence and uniqueness theorems for the domain wall solutions of the basic governing equations of a self-dual Maxwell–Chern–Simons model.

Zhang, Ruifeng [Institute of Contemporary Mathematics, Henan University, Kaifeng 475001 (China) [Institute of Contemporary Mathematics, Henan University, Kaifeng 475001 (China); College of Mathematics and Information Science, Henan University, Kaifeng 475001 (China); Li, Fangfang [College of Mathematics and Information Science, Henan University, Kaifeng 475001 (China)] [College of Mathematics and Information Science, Henan University, Kaifeng 475001 (China)

2014-02-15T23:59:59.000Z

70

DOMAIN WALL ROUGHENING IN DISORDERED MEDIA: FROM LOCAL SPIN DYNAMICS TO A  

E-Print Network [OSTI]

DOMAIN WALL ROUGHENING IN DISORDERED MEDIA: FROM LOCAL SPIN DYNAMICS TO A CONTINUUM DESCRIPTION­Mercator­Universit¨at Duisburg, Lotharstr. 1, 47048 Duisburg, Germany We study the kinetic roughening of a driven domain wall it theoretically. Contribution to Chaos and Fractals in Chemical Engineering, Rome 1996 1 Introduction Roughening

Usadel, K. D.

71

Exploration of GPGPU Register File Architecture Using Domain-wall-shift-write based Racetrack Memory  

Science Journals Connector (OSTI)

SRAM based register file (RF) is one of the major factors limiting the scaling of GPGPU. In this work, we propose to use the emerging nonvolatile domain-wall-shift-write based racetrack memory (DWSW-RM) to implement a power-efficient GPGPU RF, of which ... Keywords: Domain-wall, GPGPU, Racetrack memory, Register file

Mengjie Mao; Wujie Wen; Yaojun Zhang; Yiran Chen; Hai (Helen) Li

2014-06-01T23:59:59.000Z

72

Local Electromechanical Response at a Single Ferroelectric Domain Wall in Lithium Niobate  

E-Print Network [OSTI]

-antisites (which are excess Nb atoms at Li locations), and lithium vacancies denoted by Li. The defect equilibriumLocal Electromechanical Response at a Single Ferroelectric Domain Wall in Lithium Niobate DAVID A electromechanical response across a single ferroelectric domain wall in congruent lithium niobate at room

Gopalan, Venkatraman

73

Evolution of domain wall networks: The Press-Ryden-Spergel algorithm  

SciTech Connect (OSTI)

The Press-Ryden-Spergel (PRS) algorithm is a modification to the field theory equations of motion, parametrized by two parameters ({alpha} and {beta}), implemented in numerical simulations of cosmological domain wall networks, in order to ensure a fixed comoving resolution. In this paper we explicitly demonstrate that the PRS algorithm provides the correct domain wall dynamics in (N+1)-dimensional Friedmann-Robertson-Walker universes if {alpha}+{beta}/2=N, fully validating its use in numerical studies of cosmic domain evolution. We further show that this result is valid for generic thin featureless domain walls, independently of the Lagrangian of the model.

Sousa, L.; Avelino, P. P. [Centro de Fisica do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Departamento de Fisica da Faculdade de Ciencias da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal)

2010-04-15T23:59:59.000Z

74

Helium ion beam milling to create a nano-structured domain wall magnetoresistance spin valve  

Science Journals Connector (OSTI)

We have fabricated and measured single domain wall magnetoresistance devices with sub-20 nm gap widths using a novel combination of electron beam lithography and helium ion beam milling. The measurement wires and external profile of the spin valve are fabricated by electron beam lithography and lift-off. The critical bridge structure is created using helium ion beam milling, enabling the formation of a thinner gap (and so a narrower domain wall) than that which is possible with electron beam techniques alone. Four-point probe resistance measurements and scanning electron microscopy are used to characterize the milled structures and optimize the He ion dose. Successful operation of the device as a spin valve is demonstrated, with a 0.2% resistance change as the external magnetic field is cycled. The helium ion beam milling efficiency as extracted from electrical resistance measurements is 0.044 atoms/ion, about half the theoretical value. The gap in the device is limited to a maximum of 20 nm with this technique due to sub-surface swelling caused by injected ions which can induce catastrophic failure in the device. The fine patterning capabilities of the helium ion microscope milling technique indicate that sub-5 nm constriction widths could be possible.

Yudong Wang; S A Boden; D M Bagnall; H N Rutt; C H de Groot

2012-01-01T23:59:59.000Z

75

Domain Wall QCD with Near-Physical Pions  

E-Print Network [OSTI]

We present physical results for a variety of light hadronic quantities obtained via a combined analysis of three 2+1 flavour domain wall fermion ensemble sets. For two of our ensemble sets we used the Iwasaki gauge action with beta=2.13 (a^-1=1.75(4) GeV) and beta=2.25 (a^-1=2.31(4) GeV) and lattice sizes of 24^3 x 64 and 32^3 x 64 respectively, with unitary pion masses in the range 293(5)-417(10) MeV. The extent L_s for the 5^th dimension of the domain wall fermion formulation is L_s=16 in these ensembles. In this analysis we include a third ensemble set that makes use of the novel Iwasaki+DSDR (Dislocation Suppressing Determinant Ratio) gauge action at beta = 1.75 (a^-1=1.37(1) GeV) with a lattice size of 32^3 x 64 and L_s=32 to reach down to partially-quenched pion masses as low as 143(1) MeV and a unitary pion mass of 171(1) MeV, while retaining good chiral symmetry and topological tunneling. We demonstrate a significant improvement in our control over the chiral extrapolation, resulting in much improved continuum predictions for the above quantities. The main results of this analysis include the pion and kaon decay constants, f_\\pi=127(3)_{stat}(3)_{sys} MeV and f_K = 152(3)_{stat}(2)_{sys} MeV respectively (f_K/f_\\pi = 1.199(12)_{stat}(14)_{sys}); the average up/down quark mass and the strange-quark mass in the MSbar-scheme at 3 GeV, m_{ud}(MSbar, 3 GeV) = 3.05(8)_{stat}(6)_{sys} MeV and m_s(MSbar, 3 GeV) = 83.5(1.7)_{stat}(1.1)_{sys}; the neutral kaon mixing parameter in the MSbar-scheme at 3 GeV, B_K(MSbar,3 GeV) = 0.535(8)_{stat}(13)_{sys}, and in the RGI scheme, \\hat B_K = 0.758(11)_{stat}(19)_{sys}; and the Sommer scales r_1 = 0.323(8)_{stat}(4)_{sys} fm and r_0 = 0.480(10)_{stat}(4)_{sys} (r_1/r_0 = 0.673(11)_{stat}(3)_{sys}). We also obtain values for the SU(2) ChPT effective couplings, \\bar{l_3} = 2.91(23)_{stat}(7)_{sys}$ and \\bar{l_4} = 3.99(16)_{stat}(9)_{sys}.

RBC Collaboration; UKQCD Collaboration; R. Arthur; T. Blum; P. A. Boyle; N. H. Christ; N. Garron; R. J. Hudspith; T. Izubuchi; C. Jung; C. Kelly; A. T. Lytle; R. D. Mawhinney; D. Murphy; S. Ohta; C. T. Sachrajda; A. Soni; J. Yu; J. M. Zanotti

2014-04-18T23:59:59.000Z

76

Domain wall model in the galactic Bose-Einstein condensate halo  

SciTech Connect (OSTI)

We assume that the galactic dark matter halo, considered composed of an axionlike particles Bose-Einstein condensate [1], can present topological defects, namely domain walls, arising as the dark soliton solution for the Gross-Pitaevskii equation in a self-graviting potential. We investigate the influence that such substructures would have in the gravitational interactions within a galaxy. We find that, for the simple domain wall model proposed, the effects are too small to be identified, either by means of a local measurement of the gradient of the gravitational field or by analysing galaxy rotation curves. In the first case, the gradient of the gravitational field in the vicinity of the domain wall would be 10{sup ?31} (m/s{sup 2})/m. In the second case, the ratio of the tangential velocity correction of a star due to the presence of the domain wall to the velocity in the spherical symmetric case would be 10{sup ?8}.

Souza, J.C.C. de; Pires, M.O.C., E-mail: jose.souza@ufabc.edu.br, E-mail: marcelo.pires@ufabc.edu.br [Centro de Ciências Naturais e Humanas, Universidade Federal do ABC, Rua Santa Adélia 166, 09210-170, Santo André, SP (Brazil)

2013-05-01T23:59:59.000Z

77

Domain wall of the totally asymmetric exclusion process without particle number conservation  

E-Print Network [OSTI]

In this research, the totally asymmetric exclusion process without particle number conservation is discussed. Based on the mean field approximation and the Rankine-Hugoniot condition, the necessary and sufficient conditions of the existence of the domain wall have been obtained. Moreover, the properties of the domain wall, including the location and height, have been studied theoretically. All the theoretical results are demonstrated by the computer simulations.

Yunxin Zhang

2008-10-07T23:59:59.000Z

78

Definition: Controlled Source Frequency-Domain Magnetics | Open Energy  

Open Energy Info (EERE)

Frequency-Domain Magnetics Frequency-Domain Magnetics Jump to: navigation, search Dictionary.png Controlled Source Frequency-Domain Magnetics AquaTrackTM, a controlled-source frequency domain magnetics tool (CS-FDM), is a patented invention by Willowstick Technologies. This technique is meant to characterize groundwater conditions and flow patterns up to 1,000 m depth.[1] References ↑ http://pangea.stanford.edu/ERE/pdf/IGAstandard/SGW/2006/kofoed.pdf Ret LikeLike UnlikeLike You like this.Sign Up to see what your friends like. rieved from "http://en.openei.org/w/index.php?title=Definition:Controlled_Source_Frequency-Domain_Magnetics&oldid=590084" Category: Definitions What links here Related changes Special pages Printable version Permanent link Browse properties 429 Throttled (bot load)

79

Controlled Source Frequency-Domain Magnetics At Salt Wells Area  

Open Energy Info (EERE)

Controlled Source Frequency-Domain Magnetics At Salt Wells Area Controlled Source Frequency-Domain Magnetics At Salt Wells Area (Montgomery, Et Al., 2005) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Controlled Source Frequency-Domain Magnetics At Salt Wells Area (Montgomery, Et Al., 2005) Exploration Activity Details Location Salt Wells Area Exploration Technique Controlled Source Frequency-Domain Magnetics Activity Date 2004 - 2004 Usefulness useful DOE-funding Unknown Exploration Basis AMP Resource contracted Willowstick Technologies, LLC to conduct a Controlled Source-Frequency Domain Magnetics (CS-FDM) geophysical investigation at Salt Wells in order to characterize and delineate areas showing the greatest concentrations and highest temperatures of geothermal groundwater. The investigation also sought to map blind faults beneath the

80

BiFeO3 Domain Wall Energies and Structures: A Combined Experimental and Density Functional Theory+U Study  

DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

We determined the atomic structures and energies of 109°, 180°, and 71° domain walls in BiFeO3, combining density functional theory+U calculations and aberration-corrected transmission electron microscopy images. We find a substantial Bi sublattice shift and a rather uniform Fe sublattice across the walls. The calculated wall energies (?) follow the sequence ?109 180 71 for the 109°, 180°, and 71° walls. We attribute the high 71° wall energy to an opposite tilting rotation of the oxygen octahedra and the low 109° wall energy to the opposite twisting rotation of the oxygen octahedra across the domain walls.

Wang, Yi; Nelson, Chris; Melville, Alexander; Winchester, Benjamin; Shang, Shunli; Liu, Zi-Kui; Schlom, Darrell G.; Pan, Xiaoqing; Chen, Long-Qing

2013-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Controlled nucleation of topological defects in the stripe domain patterns of lateral multilayers with perpendicular magnetic anisotropy  

Science Journals Connector (OSTI)

Magnetic lateral multilayers have been fabricated on weak perpendicular magnetic anisotropy amorphous Nd-Co films in order to perform a systematic study on the conditions for controlled nucleation of topological defects within their magnetic stripe domain pattern. A lateral thickness modulation of period w is defined on the nanostructured samples that, in turn, induces a lateral modulation of both magnetic stripe domain periods ? and average in-plane magnetization component Min-plane. Depending on lateral multilayer period and in-plane applied field, thin and thick regions switch independently during in-plane magnetization reversal and domain walls are created within the in-plane magnetization configuration coupled to variable angle grain boundaries and disclinations within the magnetic stripe domain patterns. This process is mainly driven by the competition between rotatable anisotropy (that couples the magnetic stripe pattern to in-plane magnetization) and in-plane shape anisotropy induced by the periodic thickness modulation. However, as the structural period w becomes comparable to magnetic stripe period ?, the nucleation of topological defects at the interfaces between thin and thick regions is hindered by a size effect and stripe domains in the different thickness regions become strongly coupled.

A. Hierro-Rodriguez, M. Vélez, R. Morales, N. Soriano, G. Rodríguez-Rodríguez, L. M. Álvarez-Prado, J. I. Martín, and J. M. Alameda

2013-11-15T23:59:59.000Z

82

Controlled Source Frequency-Domain Magnetics | Open Energy Information  

Open Energy Info (EERE)

Controlled Source Frequency-Domain Magnetics Controlled Source Frequency-Domain Magnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Controlled Source Frequency-Domain Magnetics Details Activities (2) Areas (2) Regions (0) NEPA(0) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Magnetic Techniques Parent Exploration Technique: Magnetic Techniques Information Provided by Technique Lithology: Stratigraphic/Structural: Hydrological: Locate geothermal groundwater and flow patterns. Thermal: Cost Information Low-End Estimate (USD): 12,000.001,200,000 centUSD 12 kUSD 0.012 MUSD 1.2e-5 TUSD / mile Median Estimate (USD): 18,000.001,800,000 centUSD 18 kUSD 0.018 MUSD 1.8e-5 TUSD / mile High-End Estimate (USD): 25,000.002,500,000 centUSD

83

Light hadron spectroscopy using domain wall valence quarks on an asqtad sea  

E-Print Network [OSTI]

We calculate the light hadron spectrum in full QCD using two plus one flavor asqtad sea quarks and domain wall valence quarks. Meson and baryon masses are calculated on a lattice of spatial size L?2.5??fm, and a lattice ...

Walker-Loud, A.

84

Computational modeling of domain wall interactions with dislocations in ferroelectric crystals  

E-Print Network [OSTI]

harness the rich potential of ferroelectrics it is impor- tant to investigate their constitutive behavior of dislocations in the case that domain walls move due the application of external electric field and shear stress, and therefore affect the ferro- electric material behavior. Ã? 2008 Elsevier Ltd. All rights reserved. 1

85

A time-domain estimation of wall conduction transfer function coefficients  

SciTech Connect (OSTI)

The wall and roof transfer function coefficients, b{sub n} and d{sub n}, listed in the 1993 ASHRAE Fundamentals Handbook, have up to now been derived using laplace and Z-transform methods. This paper shows that they can be readily evaluated using straightforward time-domain solutions of the Fourier continuity equation. These include the response of a wall to a ramp increase in temperature and its transient response. The values of d{sub n} can be found from the first few terms in the series of wall decay times in the transient solution. The solutions are combined using a form of Fourier analysis. Appropriate layer transmission matrices enable one to find the wall`s overall characteristics readily. The wall response factors {phi}{sub j} can thus be found. The b{sub n} transfer coefficients are related to the {phi}{sub j} and d{sub n} values. The approach is illustrated using the data for wall group 6. Allowing for conversion from I-P to SI units, the present approach gives results that are almost identical to those listed. It shows, however, that the performance of the coefficients is very specific to the wall from which they were derived. The b{sub n} and d{sub n} values listed in the Handbook permit an estimate to be made of the wall response factors, including the time of peak flow and the first decay time. For heavy walls, however, values beyond d{sub 6} may be needed.

Davies, M.G. [Univ. of Liverpool (United Kingdom). School of Architecture and Building Engineering

1996-11-01T23:59:59.000Z

86

Resonant amplification of vortex-core oscillations by coherent magnetic-field pulses  

E-Print Network [OSTI]

structure of magnetic vortex cores. Science 298, 577–580 (D. A. et al. Magnetic domain-wall logic. Science 309, 1688 (L. Magnetic domain-wall racetrack memory. Science 320, 190–

Yu, Young-Sang

2014-01-01T23:59:59.000Z

87

$K\\to??$ Decays with Domain Wall Fermions: Lattice Matrix Elements  

E-Print Network [OSTI]

We present a lattice calculation of the $K\\to\\pi$ and $K\\to 0$ matrix elements of the $\\Delta S=1$ effective weak Hamiltonian which can be used to determine $\\epsilon^\\prime/\\epsilon$ and the $\\Delta I=1/2$ rule for $K$ decays in the Standard Model. The matrix elements for $K\\to\\pi\\pi$ decays are related to $K\\to\\pi$ and $K\\to 0$ using lowest order chiral perturbation theory. We also present results for the kaon $B$ parameter, $B_K$. Our quenched domain wall fermion simulation was done at $\\beta=6.0$ ($a^{-1}\\approx 2$ GeV), lattice size $16^3\\times 32\\times 16$, and domain wall height $M_5=1.8$.

T. Blum

2000-11-07T23:59:59.000Z

88

Localization and chiral symmetry in 2+1 flavor domain wall QCD  

SciTech Connect (OSTI)

We present results for the dependence of the residual mass of domain wall fermions (DWF) on the size of the fifth dimension and its relation to the density and localization properties of low-lying eigenvectors of the corresponding hermitian Wilson Dirac operator relevant to simulations of 2+1 flavor domain wall QCD. Using the DBW2 and Iwasaki gauge actions, we generate ensembles of configurations with a $16^3\\times 32$ space-time volume and an extent of 8 in the fifth dimension for the sea quarks. We demonstrate the existence of a regime where the degree of locality, the size of chiral symmetry breaking and the rate of topology change can be acceptable for inverse lattice spacings $a^{-1} \\ge 1.6$ GeV.

David J. Antonio; Kenneth C. Bowler; Peter A. Boyle; Norman H. Christ; Michael A. Clark; Saul D. Cohen; Chris Dawson; Alistair Hart; Balint Joó; Chulwoo Jung; Richard D. Kenway; Shu Li; Meifeng Lin; Robert D. Mawhinney; Christopher M. Maynard; Shigemi Ohta; Robert J. Tweedie; Azusa Yamaguchi

2008-01-01T23:59:59.000Z

89

LiWall Fusion - The New Concept of Magnetic Fusion  

SciTech Connect (OSTI)

Utilization of the outstanding abilities of a liquid lithium layer in pumping hydrogen isotopes leads to a new approach to magnetic fusion, called the LiWall Fusion. It relies on innovative plasma regimes with low edge density and high temperature. The approach combines fueling the plasma by neutral injection beams with the best possible elimination of outside neutral gas sources, which cools down the plasma edge. Prevention of cooling the plasma edge suppresses the dominant, temperature gradient related turbulence in the core. Such an approach is much more suitable for controlled fusion than the present practice, relying on high heating power for compensating essentially unlimited turbulent energy losses.

L.E. Zakharov

2011-01-12T23:59:59.000Z

90

PROCEEDINGS OF RIKEN BNL RESEARCH CENTER WORKSHOP ENTITLED - DOMAIN WALL FERMIONS AT TEN YEARS (VOLUME 84)  

SciTech Connect (OSTI)

The workshop was held to mark the 10th anniversary of the first numerical simulations of QCD using domain wall fermions initiated at BNL. It is very gratifying that in the intervening decade widespread use of domain wall and overlap fermions is being made. It therefore seemed appropriate at this stage for some ''communal introspection'' of the progress that has been made, hurdles that need to be overcome, and physics that can and should be done with chiral fermions. The meeting was very well attended, drawing about 60 registered participants primarily from Europe, Japan and the US. It was quite remarkable that pioneers David Kaplan, Herbert Neuberger, Rajamani Narayanan, Yigal Shamir, Sinya Aoki, and Pavlos Vranas all attended the workshop. Comparisons between domain wall and overlap formulations, with their respective advantages and limitations, were discussed at length, and a broad physics program including pion and kaon physics, the epsilon regime, nucleon structure, and topology, among others, emerged. New machines and improved algorithms have played a key role in realizing realistic dynamical fermion lattice simulations (small quark mass, large volume, and so on), so much in fact that measurements are now as costly. Consequently, ways to make the measurements more efficient were also discussed. We were very pleased to see the keen and ever growing interest in chiral fermions in our community and the significant strides our colleagues have made in bringing chiral fermions to the fore of lattice QCD calculations. Their contributions made the workshop a success, and we thank them deeply for sharing their time and ideas. Finally, we must especially acknowledge Norman Christ and Bob Mawhinney for their early and continued collaboration without which the success of domain wall fermions would not have been possible.

BLUM,T.; SONI,A.

2007-03-15T23:59:59.000Z

91

Nucleon structure from mixed action calculations using 2+1 flavors of asqtad sea and domain wall valence fermions  

E-Print Network [OSTI]

We present high statistics results for the structure of the nucleon from a mixed-action calculation using 2+1 flavors of asqtad sea and domain-wall valence fermions. We perform extrapolations of our data based on different ...

Bratt, Jonathan D.

92

Plasma-wall interaction in Hall thrusters with magnetic lens configuration  

SciTech Connect (OSTI)

Some recently developed Hall thrusters utilize a magnetic field configuration in which the field lines penetrate the thruster walls at a high incidence angle. This so-called magnetic lens leads to an electric field pointing away from the walls, which is expected to reduce ion losses and improve thruster efficiency. This configuration also introduces an interesting behavior in the sheath formation. At sufficiently large angles, ions are repelled from the wall, and sheath collapse is expected. We use a plasma simulation code to investigate this phenomenon in detail. We consider the role of the magnetic field incidence angle, secondary electron emission, and a magnetic mirror. Numerical study confirms the theoretical predictions, and at large angles, ions are seen to turn away from the wall. We also consider the role of the magnetic field geometry on ion wall flux and channel erosion, and observe reduction in both quantities as the magnetic field incidence angle is increased.

Brieda, Lubos; Keidar, Michael [Department of Mechanical and Aerospace Engineering, George Washington University, 801 22nd St., Washington, DC 20052 (United States)

2012-06-15T23:59:59.000Z

93

Direct Observation of Nanoscale Peltier and Joule Effects at Metal-Insulator Domain Walls in Vanadium Dioxide Nanobeams  

E-Print Network [OSTI]

Direct Observation of Nanoscale Peltier and Joule Effects at Metal- Insulator Domain Walls localized alternating Peltier heating and cooling as well as Joule heating concentrated at the M-I domain the monoclinic phase identification. KEYWORDS: Vanadium dioxide, thermoreflectance microscopy, Peltier effect

Wu, Junqiao

94

Cosmiclike domain walls in superfluid B3: Instantons and diabolical points in (k,r) space  

Science Journals Connector (OSTI)

The possible planar superfluid B-B boundaries between inequivalent B-phase vacua are considered; such B-B interfaces provide an analogy with the cosmic domain walls that are believed to have precipitated in the phase transitions of the early Universe. Several of them display nontrivial structure in (k,r) space (i.e., the union of the momentum and real spaces). Such a wall represents an instanton connecting two B-phase vacua with different k-space topology. The transition between the vacua occurs through the formation of a pointlike defect either in the (k,r) space, or in the (k,t) space. These defects are so-called diabolical points of codimension 4, at which the fermionic energy tends to zero, thus providing the fermionic zero modes. Such points are new examples (within condensed-matter physics) of the peculiar diabolical points, which are characterized by the occurrence of a contact between the different branches of the quasiparticle spectra; in the present case, the branches of particles and holes, respectively. These points are here discussed for the case of the superfluid phases of liquid He3 in close analogy with the quantum field theory of fermions interacting with classical bosonic fields. The cosmiclike domain walls in superfluid B3 are observable in principle; in particular, the motion of the superfluid A-B interface is governed at low temperatures by the periodical emission of these topological excitation planes. The edges of B-B interfaces serve to generate fractionally quantized pure and mixed mass and spin supercurrent vortices in B3, while holes in these surfaces may give rise to the corresponding vortex rings and combined vortex and/or spin-disclination rings.

M. M. Salomaa and G. E. Volovik

1988-06-01T23:59:59.000Z

95

Steady-state domain wall motion driven by adiabatic spin-transfer torque with assistance of microwave field  

SciTech Connect (OSTI)

We have studied the current-induced displacement of a 180° Bloch wall by means of micromagnetic simulation and analytical approach. It is found that the adiabatic spin-transfer torque can sustain a steady-state domain wall (DW) motion in the direction opposite to that of the electron flow without Walker Breakdown when a transverse microwave field is applied. This kind of motion is very sensitive to the microwave frequency and can be resonantly enhanced by exciting the domain wall thickness oscillation mode. A one-dimensional analytical model was established to account for the microwave-assisted wall motion. These findings may be helpful for reducing the critical spin-polarized current density and designing DW-based spintronic devices.

Wang, Xi-guang; Guo, Guang-hua, E-mail: guogh@mail.csu.edu.cn; Nie, Yao-zhuang; Xia, Qing-lin; Tang, Wei [School of Physics and Electronics, Central South University, Changsha 410083 (China)] [School of Physics and Electronics, Central South University, Changsha 410083 (China); Wang, D. [Department of Physics, National University of Defense Technology, Changsha 410073 (China)] [Department of Physics, National University of Defense Technology, Changsha 410073 (China); Zeng, Zhong-ming [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Sciences, Suzhou 215123 (China)] [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Sciences, Suzhou 215123 (China)

2013-12-23T23:59:59.000Z

96

Nonperturbative renormalization of overlap quark bilinears on 2+1-flavor domain wall fermion configurations  

Science Journals Connector (OSTI)

We present renormalization constants of overlap quark bilinear operators on 2+1-flavor domain wall fermion configurations. This setup is being used by the ?QCD Collaboration in calculations of physical quantities such as strangeness in the nucleon and the strange and charm quark masses. The scale-independent renormalization constant for the axial-vector current is computed using the Ward identity. The renormalization constants for scalar, pseudoscalar, and vector currents are calculated in the RI-MOM scheme. Results in the MS¯ scheme are also given. The step scaling function of quark masses in the RI-MOM scheme is computed as well. The analysis uses, in total, six different ensembles of three sea quarks, each on two lattices with sizes 243×64 and 323×64 at spacings a=(1.73??GeV)?1 and (2.28??GeV)?1, respectively.

Zhaofeng Liu; Ying Chen; Shao-Jing Dong; Michael Glatzmaier; Ming Gong; Anyi Li; Keh-Fei Liu; Yi-Bo Yang; Jian-Bo Zhang (?QCD Collaboration)

2014-08-19T23:59:59.000Z

97

Quantification of Magnetic Domain Disorder and Correlations in Antiferromagnetically Coupled Multilayers by Neutron Reflectometry  

Science Journals Connector (OSTI)

The in-plane correlation lengths and angular dispersion of magnetic domains in a transition metal multilayer have been studied using off-specular neutron reflectometry techniques. A theoretical framework considering both structural and magnetic disorder has been developed, quantitatively connecting the observed scattering to the in-plane correlation length and the dispersion of the local magnetization vector about the mean macroscopic direction. The antiferromagnetic domain structure is highly vertically correlated throughout the multilayer. We are easily able to relate the neutron determined magnetic domain dispersion to magnetization and magnetoresistance experiments.

Sean Langridge; Jörg Schmalian; C. H. Marrows; D. T. Dekadjevi; B. J. Hickey

2000-12-04T23:59:59.000Z

98

Domain wall roughening in CoPt alloy films M. Jost 1 , J. Heimel 2 and T. Kleinefeld 2  

E-Print Network [OSTI]

Domain wall roughening in CoPt alloy films M. Jost 1 , J. Heimel 2 and T. Kleinefeld 2 1 done to understand the phenomenon of interface roughening in a time independent (quenched) disordered while the noise term j(x; h(x; t)) roughens the interface and F denotes a homogenous driving force

Usadel, K. D.

99

Domain lines as fractional strings  

Science Journals Connector (OSTI)

We consider N=2 supersymmetric quantum electrodynamics with two flavors, the Fayet-Iliopoulos parameter, and a mass term ? which breaks the extended supersymmetry down to N=1. The bulk theory has two vacua; at ?=0 the Bogomol’nyi-Prasad-Sommerfield (BPS) monopoles-saturated domain wall interpolating between them has a moduli space parameterized by a U(1) phase ? which can be promoted to a scalar field in the effective low-energy theory on the wall world-volume. At small nonvanishing ? this field gets a sine-Gordon potential. As a result, only two discrete degenerate BPS domain walls survive. We find an explicit solitonic solution for domain lines—stringlike objects living on the surface of the domain wall which separate wall I from wall II. The domain line is seen as a BPS kink in the world-volume effective theory. We expect that the wall with the domain line on it saturates both the {1,0} and the {12,12} central charges of the bulk theory. The domain line carries a magnetic flux which is exactly 12 of the flux carried by the flux tube living in the bulk on each side of the wall. Thus, the domain lines on the wall confine charges living on the wall, resembling Polyakov’s three-dimensional confinement.

R. Auzzi; M. Shifman; A. Yung

2006-08-11T23:59:59.000Z

100

Domain Lines as Fractional Strings  

E-Print Network [OSTI]

We consider N=2 supersymmetric quantum electrodynamics (SQED) with 2 flavors, the Fayet--Iliopoulos parameter, and a mass term $\\beta$ which breaks the extended supersymmetry down to N=1. The bulk theory has two vacua; at $\\beta=0$ the BPS-saturated domain wall interpolating between them has a moduli space parameterized by a U(1) phase $\\sigma$ which can be promoted to a scalar field in the effective low-energy theory on the wall world-volume. At small nonvanishing $\\beta$ this field gets a sine-Gordon potential. As a result, only two discrete degenerate BPS domain walls survive. We find an explicit solitonic solution for domain lines -- string-like objects living on the surface of the domain wall which separate wall I from wall II. The domain line is seen as a BPS kink in the world-volume effective theory. We expect that the wall with the domain line on it saturates both the $\\{1,0\\}$ and the $\\{{1/2},{1/2}\\}$b central charges of the bulk theory. The domain line carries the magnetic flux which is exactly 1/2 of the flux carried by the flux tube living in the bulk on each side of the wall. Thus, the domain lines on the wall confine charges living on the wall, resembling Polyakov's three-dimensional confinement.

R. Auzzi; M. Shifman; A. Yung

2006-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Domain walls and bubble-droplets in immiscible binary Bose gases  

E-Print Network [OSTI]

The existence and stability of domain walls (DWs) and bubble-droplet (BD) states in binary mixtures of quasi-one-dimensional ultracold Bose gases with inter- and intra-species repulsive interactions is considered. Previously, DWs were studied by means of coupled systems of Gross-Pitaevskii equations (GPEs) with cubic terms, which model immiscible binary Bose-Einstein condensates (BECs). We address immiscible BECs with two- and three-body repulsive interactions, as well as binary Tonks--Girardeau (TG) gases, using systems of GPEs with cubic and quintic nonlinearities for the binary BEC, and coupled nonlinear Schr\\"{o}dinger equations with quintic terms for the TG gases. Exact DW\\ solutions are found for the symmetric BEC mixture, with equal intra-species scattering lengths. Stable asymmetric DWs in the BEC mixtures with dissimilar interactions in the two components, as well as of symmetric and asymmetric DWs in the binary TG gas, are found by means of numerical and approximate analytical methods. In the BEC sy...

Filatrella, G; Salerno, M

2014-01-01T23:59:59.000Z

102

Phase-field simulation of electric-field-induced in-plane magnetic domain switching in magnetic/ferroelectric layered heterostructures  

E-Print Network [OSTI]

Phase-field simulation of electric-field-induced in-plane magnetic domain switching in magnetic. Phys. Lett. 99, 182510 (2011) Quantum tunneling of the Bloch point in a magnetic film with strong uniaxial magnetic anisotropy Low Temp. Phys. 37, 690 (2011) Evolution of magnetic bubble domains

Chen, Long-Qing

103

Magnetic domain structures of focused ion beam-patterned cobalt films using scanning ion microscopy with polarization analysis  

E-Print Network [OSTI]

Magnetic domain structures of focused ion beam-patterned cobalt films using scanning ion microscopy Studies of magnetic domain distributions in patterned magnetic materials are of pivotal importance in the areas of ultrahigh density magnetic recording, MRAM design, and miniaturized magnetic sensor arrays

Rau, Carl

104

Power-law Behavior of Strings Scattered from Domain-wall at High Energies and Breakdown of their Linear Relations  

E-Print Network [OSTI]

In contrast to the common wisdom, we discover that, instead of the exponential fall-off of the form factors with Regge-pole structure, the high-energy scattering amplitudes of string scattered from Domain-wall behave as power-law with Regge-pole structure. This is to be compared with the well-known power-law form factors without Regge-pole structure of the D-instanton scatterings. This discovery makes Domain-wall scatterings an unique example of a hybrid of string and field theory scatterings. The calculation is done for bosonic string scatterings of arbitrary massive string states from D-24 brane. Moreover, we discover that the usual linear relations of high-energy string scattering amplitudes at each fixed mass level break down for the Domain-wall scatterings. This result gives a strong evidence that the existence of the infinite linear relations, or stringy symmetries, of high-energy string scattering amplitudes is responsible for the softer, exponential fall-off high-energy string scatterings than the power-law field theory scatterings.

Chuan Tsung Chan; Jen-Chi Lee; Yi Yang

2006-10-19T23:59:59.000Z

105

Increasing the length of single-wall carbon nanotubes in a magnetically enhanced arc discharge  

SciTech Connect (OSTI)

It is demonstrated that a magnetic field has a profound effect on the length of a single-wall carbon nanotube (SWCNT) synthesized in the arc discharge. The average length of SWCNT increases by a factor of 2 in discharge with magnetic field as compared with the discharge without magnetic field, and the yield of long nanotubes with lengths above 5 {mu}m also increases. A model of SWCNT growth on metal catalyst in arc plasma was developed. Monte-Carlo simulations confirm that the increase of the plasma density in the magnetic field leads to an increase in the nanotube growth rate and thus leads to longer nanotubes.

Keidar, Michael [Department of Mechanical and Aerospace Engineering, George Washington University, Washington, District of Columbia 20052 (United States); Levchenko, Igor; Ostrikov, Kostya [Plasma Nanoscience, School of Physics, The University of Sydney, Sydney, New South Wales 2006 (Australia); Arbel, Tamir [Department of Material Science, University of Michigan, Ann Arbor, Michigan 48109 (United States); Alexander, Myriam [Department of Geophysical Science, University of Chicago, Chicago, Illinois 60637 (United States); Waas, Anthony M. [Department of Aerospace Engineering, University of Michigan, Ann Arbor, Michigan 48109 (United States)

2008-01-28T23:59:59.000Z

106

Parameter analysis and design framework for magnetic adhesion wall climbing wheeled robot  

Science Journals Connector (OSTI)

Some robots need to climb ferromagnetic walls for performing important inspections and evaluations of the material properties of these walls. This paper aims to establish a design framework for magnetically adhering wheeled robots having magnets attached to the base of the robot. The different design parameters influencing the magnetic adhesion include the geometry of the flux concentrator, the variation of the air gap on adhesion and climbing performance in addition to various types of materials for magnetic flux concentration. These parameters shaping adhesion behaviour are simulated numerically using magnetostatic analysis in ANSYS Finite Elements Method (FEM) software. The results are evaluated and a set of rules and procedures are created as a framework that will enable a more efficient design and construction of this type of robots.

Salman Hussain; Tariq Sattar; Ener Salinas

2012-01-01T23:59:59.000Z

107

Temperature dependent nucleation, propagation, and annihilation of domain walls in all-perpendicular spin-valve nanopillars  

SciTech Connect (OSTI)

We present a study of the temperature dependence of the switching fields in Co/Ni-based perpendicularly magnetized spin-valves. While magnetization reversal of all-perpendicular Co/Ni spin valves at ambient temperatures is typically marked by a single sharp step change in resistance, low temperature measurements can reveal a series of resistance steps, consistent with non-uniform magnetization configurations. We propose a model that consists of domain nucleation, propagation, and annihilation to explain the temperature dependence of the switching fields. Interestingly, low temperature (<30?K) step changes in resistance that we associate with domain nucleation have a bimodal switching field and resistance step distribution, attributable to two competing nucleation pathways.

Gopman, D. B., E-mail: daniel.gopman@physics.nyu.edu; Kent, A. D. [Department of Physics, New York University, New York, New York 10003 (United States); Bedau, D. [Department of Physics, New York University, New York, New York 10003 (United States); HGST San Jose Research Center, San Jose, California 95135 (United States); Mangin, S. [Institut Jean Lamour, UMR CNRS 7198 Université de Lorraine, Nancy, France 54506 (France); Fullerton, E. E. [CMRR, University of California at San Diego, La Jolla, California 92093 (United States); Katine, J. A. [HGST San Jose Research Center, San Jose, California 95135 (United States)

2014-03-21T23:59:59.000Z

108

Chiral magnetic effect in the soft-wall AdS/QCD model  

SciTech Connect (OSTI)

The essence of the chiral magnetic effect is generation of an electric current along an external magnetic field. Recently it has been studied by Rebhan, Schmitt, and Stricker within the Sakai-Sugimoto model, where it was shown to be zero. As an alternative, we calculate the chiral magnetic effect in soft-wall AdS/QCD and find a nonzero result with the natural boundary conditions. The mechanism of the dynamical neutralization of the chiral chemical potential via the string production is discussed in the dual two-form representation.

Gorsky, A. [Institute of Theoretical and Experimental Physics, Bolshaya Cheremushkinskaya ulitsa 25, 117259 Moscow (Russian Federation); Kopnin, P. N. [Institute of Theoretical and Experimental Physics, Bolshaya Cheremushkinskaya ulitsa 25, 117259 Moscow (Russian Federation); Moscow Institute of Physics and Technology, Institutsky pereulok 9, 141 700 Dolgoprudny (Russian Federation); Zayakin, A. V. [Institute of Theoretical and Experimental Physics, Bolshaya Cheremushkinskaya ulitsa 25, 117259 Moscow (Russian Federation); Fakultaet fuer Physik der Ludwig-Maximillians-Universitaet Muenchen und Maier-Leibniz-Laboratory, Am Coulombwall 1, 85748 Garching (Germany)

2011-01-01T23:59:59.000Z

109

Construction of a two-parameter empirical model of left ventricle wall motion using cardiac tagged magnetic resonance imaging data  

E-Print Network [OSTI]

visualized using cardiac tagged magnetic resonance imaging (tMRI) covering the contraction and relaxation phases. Based on the characteristics of the overall dynamics of the LV wall, its motion was represented by a combination of two components - radial...

Shi, Jack J; Alenezy, Mohammed D.; Smirnova, Irina V.; Bilgen, Mehmet

2012-10-24T23:59:59.000Z

110

One-loop operator matching in the static heavy and domain-wall light quark system with O(a) improvement  

E-Print Network [OSTI]

We discuss perturbative O(g^2a) matching with static heavy quarks and domain-wall light quarks for lattice operators relevant to B-meson decays and $B^0$-$\\bar{B}^0$ mixing. The chiral symmetry of the light domain-wall quarks does not prohibit operator mixing at O(a) for these operators. The O(a) corrections to physical quantities are non-negligible and must be included to obtain high-precision simulation results for CKM physics. We provide results using plaquette, Symanzik, Iwasaki and DBW2 gluon actions and applying APE, HYP1 and HYP2 link-smearing for the static quark action.

Tomomi Ishikawa; Yasumichi Aoki; Jonathan M. Flynn; Taku Izubuchi; Oleg Loktik

2011-01-05T23:59:59.000Z

111

Ion Cyclotron Wall Conditioning Experiments on Tore Supra in Presence of the Toroidal Magnetic Field  

SciTech Connect (OSTI)

Wall conditioning techniques applicable in the presence of the high toroidal magnetic field will be required for the operation of ITER for tritium removal, isotopic ratio control and recovery to normal operation after disruptions. Recently ion cyclotron wall conditioning (ICWC) experiments have been carried out on Tore Supra in order to assess the efficiency of this technique in ITER relevant conditions. The ICRF discharges were operated in He/H{sub 2} mixtures at the Tore Supra nominal field (3.8 T) and a RF frequency of 48 MHz, i.e. within the ITER operational space. RF pulses of 60 s (max.) were applied using a standard Tore Supra two-strap resonant double loop antenna in ICWC mode, operated either in {pi} or 0-phasing with a noticeable improvement of the RF coupling in the latter case. In order to assess the efficiency of the technique for the control of isotopic ratio the wall was first preloaded using a D{sub 2} glow discharge. After 15 minutes of ICWC in He/H{sub 2} gas mixtures the isotopic ratio was altered from 4% to 50% at the price of an important H implantation into the walls. An overall analysis comparing plasma production and the conditioning efficiency as a function of discharge parameters is given.

Wauters, T.; Douai, D.; Bremond, S.; Lombard, G.; Pegourie, B.; Tsitrone, E. [CEA, IRFM, 13108 Saint-Paul-lez-Durance (France); de la Cal, E. [Laboratorio Nacional de Fusion-CIEMAT, 28040 Madrid (Spain); Lyssoivan, A.; Van Schoor, M. [ERM/KMS, LPP, 1000 Brussels (Belgium); Van Oost, G. [Ghent University, Department of Applied Physics, 9000 Ghent (Belgium)

2009-11-26T23:59:59.000Z

112

JOURNAL ut PHYSIQUE Colloque C7, supplement au n 12, Tome 38, decembre 1977, page C7-51 A MICROSCOPIC THEORY FOR DOMAIN WALL MOTION  

E-Print Network [OSTI]

the fact that the order parameter r\\ is not a conserved quantity. If the free energy is not at a minimum KINETICS J. W. CAHN Institute for Materials Research, National Bureau of Standards, Washington, D.C. 20234 to mean curvature. Unlike previous models, the velocity is not proportional to domain wall free energy

Paris-Sud XI, Université de

113

Mixed Bloch-Nel-Ising character of 180 ferroelectric domain walls Donghwa Lee ( ,1 Rakesh K. Behera,1 Pingping Wu,2 Haixuan Xu ( ,1 Y. L. Li,2 Susan B. Sinnott,1  

E-Print Network [OSTI]

Mixed Bloch-Néel-Ising character of 180° ferroelectric domain walls Donghwa Lee ( ,1 Rakesh K 2009 Ferroelectric 180° domain walls are well-known to be predominantly Ising-like. Using density Ising-like, they also manifest some Bloch- and Néel-like character. Phase-field calculations show

Chen, Long-Qing

114

Interplay between intrinsic and stacking-fault magnetic domains in bi-layered manganites  

SciTech Connect (OSTI)

We present a low temperature X-ray photoemission electron microscopy study of the bi-layered manganite compound La{sub 1.2}Sr{sub 1.8}Mn{sub 2}O{sub 7} (BL-LSMO) to investigate the influence of stacking faults, which are structurally and magnetically different from the bi-layered host. In BL-LSMO small magnetic moment persists to T* = 300K, well above the Curie temperature of 120K (T{sub C}). Our magnetic images show that 3D stacking faults are responsible for the T* transition. Furthermore, close to the T{sub C}, stacking faults are well coupled to the bi-layered host with latter magnetic domains controlling the spin direction of the stacking faults. Contrary to recent reports, we find that stacking faults do not seed magnetic domains in the host via an exchange spring mechanism and the intrinsic T{sub C} of the BL-LSMO is not lower than 120K.

Hossain, M.A; Burkhardt, Mark H.; Sarkar, S.; Ohldag, H.; Chuang, Y.-D.; Scholl, A.; Young, A.T.; Doran, A.; Dessau, D.S.; Zheng, H.; Mitchell, J.F.; Durr, H.A.; Stohr, J.

2012-09-11T23:59:59.000Z

115

Reversal modes in magnetic nanotubes  

E-Print Network [OSTI]

The magnetic switching of ferromagnetic nanotubes is investigated as a function of their geometry. Two independent methods are used: Numerical simulations and analytical calculations. It is found that for long tubes the reversal of magnetization is achieved by two mechanism: The propagation of a transverse or a vortex domain wall depending on the internal and external radii of the tube.

P. Landeros; S. Allende; J. Escrig; E. Salcedo; D. Altbir; E. E. Vogel

2006-11-08T23:59:59.000Z

116

Low-energy planar magnetic defects in BaFe2As2: Nanotwins, twins, antiphase, and domain boundaries  

SciTech Connect (OSTI)

In BaFe2As2, structural and magnetic planar defects begin to proliferate below the structural phase transition, affecting descriptions of magnetism and superconductivity. We study, using density-functional theory, the stability and magnetic properties of competing antiphase and domain boundaries, twins and isolated nanotwins (twin nuclei), and spin excitations proposed and/or observed. These nanoscale defects have a very low surface energy (22–210 m Jm?2), with twins favorable to the mesoscale. Defects exhibit smaller moments confined near their boundaries—making a uniform-moment picture inappropriate for long-range magnetic order in real samples. Nanotwins explain features in measured pair distribution functions so should be considered when analyzing scattering data. All these defects can be weakly mobile and/or can have fluctuations that lower assessed “ordered” moments from longer spatial and/or time averaging and should be considered directly.

Khan, Suffian N. [Ames Laboratory; Alam, Aftab [Ames Laboratory; Johnson, Duane D. [Ames Laboratory

2013-11-27T23:59:59.000Z

117

Method and apparatus to produce and maintain a thick, flowing, liquid lithium first wall for toroidal magnetic confinement DT fusion reactors  

DOE Patents [OSTI]

A system for forming a thick flowing liquid metal, in this case lithium, layer on the inside wall of a toroid containing the plasma of a deuterium-tritium fusion reactor. The presence of the liquid metal layer or first wall serves to prevent neutron damage to the walls of the toroid. A poloidal current in the liquid metal layer is oriented so that it flows in the same direction as the current in a series of external magnets used to confine the plasma. This current alignment results in the liquid metal being forced against the wall of the toroid. After the liquid metal exits the toroid it is pumped to a heat extraction and power conversion device prior to being reentering the toroid.

Woolley, Robert D. (Hillsborough, NJ)

2002-01-01T23:59:59.000Z

118

Study of magnetic configuration effects on plasma boundary and measurement of edge electron density in the spherical tokamak compact plasma wall interaction experimental device using Li sheet beam  

SciTech Connect (OSTI)

Two-dimensional lithium beam imaging technique has been applied in the spherical tokamak CPD (compact plasma wall interaction experimental device) to study the effects of magnetic field configurations on rf plasma boundary in the absence of any plasma current, and also for the measurement of a two-dimensional edge electron density profile. With the present working condition of the diagnostics, the minimum measured electron density can be {approx}1.0x10{sup 16} m{sup -3}; this is considered to be the definition for the plasma boundary. The performance of the lithium sheet beam is absolutely calibrated using a quartz crystal monitor. Experimental results reveal that magnetic field configuration, either mirror or so-called null, critically affects the rf plasma boundary. A sharp lower boundary is found to exist in magnetic null configuration, which is quite different from that in the weak mirror configuration. Theoretical calculations of particle drift orbit and magnetic connection length (wall-to-wall) suggest that only mirror trapped particles are confined within a region where the magnetic connection length is {approx}4.0 m or more. A two-dimensional edge electron density profile is obtained from the observed Li I intensity profile. Overdense plasma formation is discussed from the viewpoint of mode conversion of rf wave into electron Bernstein wave and its dependence on the electron density profile.

Bhattacharyay, R.; Inada, Y.; Kikukawa, T.; Watanabe, S.; Sasaki, K.; Ryoukai, T. [Interdisciplinary Graduate School of Engineering Science, Kyushu University, Kasuga, Fukuoka 816 8580 (Japan); Zushi, H.; Hasegawa, M.; Hanada, K.; Sato, K. N.; Nakamura, K.; Sakamoto, M.; Idei, H.; Yoshinaga, T.; Kawasaki, S.; Nakashima, H.; Higashijima, A. [Research Institute of Applied Mechanics, Kyushu University, Kasuga, Fukuoka 816 8580 (Japan); Morisaki, T. [National Institute for Fusion Science, Toki 509 5292 (Japan)

2008-02-15T23:59:59.000Z

119

Study of magnetic configuration effects on plasma boundary and measurement of edge electron density in the spherical tokamak compact plasma wall interaction experimental device using Li sheet beam  

Science Journals Connector (OSTI)

Two-dimensional lithium beam imaging technique has been applied in the spherical tokamak CPD (compact plasma wall interaction experimental device) to study the effects of magnetic field configurations on rf plasma boundary in the absence of any plasma current and also for the measurement of a two-dimensional edge electron density profile. With the present working condition of the diagnostics the minimum measured electron density can be ? 1.0 × 10 16 m ? 3 ; this is considered to be the definition for the plasma boundary. The performance of the lithium sheet beam is absolutely calibrated using a quartz crystal monitor. Experimental results reveal that magnetic field configuration either mirror or so-called null critically affects the rf plasma boundary. A sharp lower boundary is found to exist in magnetic null configuration which is quite different from that in the weak mirror configuration. Theoretical calculations of particle drift orbit and magnetic connection length (wall-to-wall) suggest that only mirror trapped particles are confined within a region where the magnetic connection length is ? 4.0 m or more. A two-dimensional edge electron density profile is obtained from the observed Li I intensity profile. Overdense plasma formation is discussed from the viewpoint of mode conversion of rf wave into electron Bernstein wave and its dependence on the electron density profile.

R. Bhattacharyay; H. Zushi; T. Morisaki; Y. Inada; T. Kikukawa; S. Watanabe; K. Sasaki; T. Ryoukai; M. Hasegawa; K. Hanada; K. N. Sato; K. Nakamura; M. Sakamoto; H. Idei; T. Yoshinaga; S. Kawasaki; H. Nakashima; A. Higashijima

2008-01-01T23:59:59.000Z

120

Simulating net particle production and chiral magnetic current in a CP-odd domain  

E-Print Network [OSTI]

We elucidate the numerical formulation to simulate net production of particles and anomalous currents with CP-breaking background fields which cause an imbalance between particles and anti-particles. For a concrete demonstration we numerically impose pulsed electric and magnetic fields to observe that the dynamical chiral magnetic current follows together with the net particle production. The produced particle density is quantitatively consistent with the axial anomaly, while the chiral magnetic current shows a delay before the onset, which leads to a suppression effect, and then approaches what is expected from the axial anomaly.

Kenji Fukushima

2015-01-29T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Simulating net particle production and chiral magnetic current in a CP-odd domain  

E-Print Network [OSTI]

We elucidate the numerical formulation to simulate net production of particles and anomalous currents with CP-breaking background fields which cause an imbalance of particles over anti-particles. For a concrete demonstration we numerically impose pulsed electric and magnetic fields to observe that the dynamical chiral magnetic current follows together with the net particle production. The produced particle density is quantitatively consistent with the axial anomaly, while the chiral magnetic current is suppressed by a delay before the the onset of the current generation.

Fukushima, Kenji

2015-01-01T23:59:59.000Z

122

Ferromagnetic neutron stars: axial anomaly, dense neutron matter, and pionic wall  

E-Print Network [OSTI]

We show that a chiral nonlinear sigma model coupled to degenerate neutrons exhibits a ferromagnetic phase at high density. The magnetization is due to the axial anomaly acting on the parallel layers of neutral pion domain walls spontaneously formed at high density. The emergent magnetic field would reach the QCD scale ~ 10^19 [G], which suggests that the quantum anomaly can be a microscopic origin of the magnetars (highly magnetized neutron stars).

Minoru Eto; Koji Hashimoto; Tetsuo Hatsuda

2012-09-21T23:59:59.000Z

123

Domain walls and double bubbles  

Science Journals Connector (OSTI)

...5, which are never double bubbles, that is, none is the global...transverse cylinder, torus bubble, inner tube and double hydrant...transverse cylinder and the stability of the cylinder cross. The...three-dimensional double bubbles and show that the method can...

2009-01-01T23:59:59.000Z

124

Model of thermally activated magnetization reversal in thin films of amorphous rare-earth-transition-metal alloys  

Science Journals Connector (OSTI)

Monte Carlo simulations on a two-dimensional lattice of magnetic dipoles have been performed to investigate the magnetic reversal by thermal activation in rare-earth-transition-metal (RE-TM) alloys. Three mechanisms of magnetization reversal were observed: nucleation dominated growth, nucleation followed by the growth of magnetic domains containing no seeds of unreversed magnetization, and nucleation followed by dendritic domain growth by successive branching in the motion of the domain walls. The domain structures are not fractal; however, the fractal dimension of the domain wall was found to be a good measure of the jaggedness of the domain boundary surface during the growth process. The effects of the demagnetizing field on the hysteretic and time-dependent properties of the thin films were studied and some limitations in the application of the Fatuzzo model on magneto-optic media are identified.

A. Lyberatos; J. Earl; R. W. Chantrell

1996-03-01T23:59:59.000Z

125

Effect of the Interaction between Magnetic Particles on the Critical Single-Domain Size  

Science Journals Connector (OSTI)

On theoretical grounds, the critical single-domain size of a ferromagnetic particle is expected to be influenced by the interaction of other neighboring particles. Measurements of the coercive force of some ?-Fe2O3 powders containing particles of different sizes and shapes at various concentrations provide experimental evidence for the existence of such an effect.

A. H. Morrish and L. A. K. Watt

1957-03-01T23:59:59.000Z

126

Arabidopsis VASCULAR-RELATED NAC-DOMAIN6 Directly Regulates the Genes That Govern Programmed Cell Death and Secondary Wall Formation during Xylem Differentiation  

Science Journals Connector (OSTI)

...wall, namely, cellulose, xylan, and lignin. In addition to...cell wall over the entire cell surface, without forming a pattern...FLA12. IRX9 is required for xylan synthesis in the secondary cell...components: cellulose, lignin, and xylan (Zhong et al., 2007; McCarthy...

Kyoko Ohashi-Ito; Yoshihisa Oda; Hiroo Fukuda

2010-10-15T23:59:59.000Z

127

Dynamics of strings between walls  

SciTech Connect (OSTI)

Configurations of vortex-strings stretched between or ending on domain walls were previously found to be 1/4 BPS states. Among zero modes of string positions, the center of mass of strings in each region between two adjacent domain walls is shown to be non-normalizable whereas the rests are normalizable. We study dynamics of vortex-strings stretched between separated domain walls by using two methods, the moduli space (geodesic) approximation of full 1/4 BPS states and the charged particle approximation for string endpoints in the wall effective action. In the first method we obtain the effective Lagrangian explicitly and find the 90 degree scattering for head-on collision. In the second method the domain wall effective action is assumed to be U(1){sup N} gauge theory, and we find a good agreement between two methods for well separated strings. This talk is based on the work [1].

Eto, Minoru [INFN, Sezione di Pisa, Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Fujimori, Toshiaki; Nagashima, Takayuki [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Nitta, Muneto [Department of Physics, Keio University, Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan); Ohashi, Keisuke [Department of Applied Mathematics and Theoretical Physics, University of Cambridge, CB3 0WA (United Kingdom); Sakai, Norisuke [Department of Mathematics, Tokyo Woman's Christian University, Tokyo 167-8585 (Japan)

2008-11-23T23:59:59.000Z

128

Hydration kinetics of cements by Time-Domain Nuclear Magnetic Resonance: Application to Portland-cement-derived endodontic pastes  

SciTech Connect (OSTI)

Time-Domain Nuclear Magnetic Resonance (TD-NMR) of {sup 1}H nuclei is used to monitor the maturation up to 30 days of three different endodontic cement pastes. The 'Solid-liquid' separation of the NMR signals and quasi-continuous distributions of relaxation times allow one to follow the formation of chemical compounds and the build-up of the nano- and subnano-structured C-S-H gel. {sup 1}H populations, distinguished by their different mobilities, can be identified and assigned to water confined within the pores of the C-S-H gel, to crystallization water and Portlandite, and to hydroxyl groups. Changes of the TD-NMR parameters during hydration are in agreement with the expected effects of the different additives, which, as it is known, can substantially modify the rate of reactions and the properties of cementitious pastes. Endodontic cements are suitable systems to check the ability of this non-destructive technique to give insight into the complex hydration process of real cement pastes.

Bortolotti, Villiam, E-mail: villiam.bortolotti@unibo.it [Department DICAM, University of Bologna, Via Terracini 28, 40131, Bologna (Italy); Fantazzini, Paola [Department of Physics, University of Bologna, Viale Berti Pichat 6/2, 40127, Bologna (Italy); Mongiorgi, Romano [Centre of Biomineralogy, Crystallography and Biomaterials, Department of Earth and Geoenvironmental Sciences, University of Bologna, Piazza di Porta S. Donato, 40127, Bologna (Italy); Sauro, Salvatore [Department of Dental Biomaterials Science Kings College, London Dental Institute at Guy's, King's College and St Thomas' Hospitals, Floor 17 Guy's Tower, Guys Hospital, London Bridge, London SE1 9RT (United Kingdom); Dental Materials, School of Dentistry, University of Granada, Colegio Maximo, Campus de Cartuja, Granada (Spain); Zanna, Silvano [Centre of Biomineralogy, Crystallography and Biomaterials, Department of Earth and Geoenvironmental Sciences, University of Bologna, Piazza di Porta S. Donato, 40127, Bologna (Italy)

2012-03-15T23:59:59.000Z

129

Short note on the stability of a dilatonic wall  

E-Print Network [OSTI]

A nontopological soliton solution of dilaton-Maxwell theory describes a domain wall-like solution which confines magnetic flux in its core [G.W. Gibbons and C.G. Wells, Class. Quant. Grav. 11, 2499 (1994)]. Since the solution is not stabilized by a nontrivial topology of the vacuum manifold, it is interesting to see if the static solution is stable against small fluctuations. We consider the stability of the solution in response to small fluctuations in the scalar and magnetic fields. It is determined that the ansatz solution does indeed exhibit stability.

J. R. Morris

2014-09-29T23:59:59.000Z

130

Avalanches through windows: Multiscale visualization in magnetic thin films  

E-Print Network [OSTI]

Avalanches through windows: Multiscale visualization in magnetic thin films Alessandro Magni, Cornell University, Ithaca, NY 14853-2501 Abstract--The dynamics of domain walls motion in thin films dynamics, but are strongly dependent on the size of the windows chosen. Here we investigate how to properly

Sethna, James P.

131

Effect of substrate temperature on the magnetic properties of epitaxial sputter-grown Co/Pt  

SciTech Connect (OSTI)

Epitaxial Co/Pt films have been deposited by dc-magnetron sputtering onto heated C-plane sapphire substrates. X-ray diffraction, the residual resistivity, and transmission electron microscopy indicate that the Co/Pt films are highly ordered on the atomic scale. The coercive field and the perpendicular magnetic anisotropy increase as the substrate temperature is increased from 100–250?°C during deposition of the Co/Pt. Measurement of the domain wall creep velocity as a function of applied magnetic field yields the domain wall pinning energy, which scales with the coercive field. Evidence for an enhanced creep velocity in highly ordered epitaxial Co/Pt is found.

Mihai, A. P.; Whiteside, A. L.; Canwell, E. J.; Marrows, C. H.; Moore, T. A., E-mail: t.a.moore@leeds.ac.uk [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom); Benitez, M. J.; McGrouther, D.; McVitie, S.; McFadzean, S. [School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom)] [School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom)

2013-12-23T23:59:59.000Z

132

Effects of eddy currents due to a vacuum chamber wall in the airgap of a moving-magnet linear actuator  

SciTech Connect (OSTI)

This paper discusses the effects of eddy currents induced in an electrically conducting plate which is placed in the airgap of a linear synchronous actuator with moving permanent magnets. The eddy currents induced in this plate, which is part of a controlled atmosphere chamber, cause not only damping but also deteriorate the actuator performance by disturbing the position measurement with Hall sensors. Furthermore, feed-forward controllers are less effective due to the suppression of high frequent armature fields. These effects are analyzed with an analytical model and verified with finite element simulations and measurements.

Jansen, J. W.; Lomonova, E. A.; Rovers, J. M. M. [Department of Electrical Engineering, Eindhoven University of Technology, Den Dolech 2, 5612 AZ Eindhoven (Netherlands)

2009-04-01T23:59:59.000Z

133

Magnetism  

Science Journals Connector (OSTI)

Historically, magnetism is related to rock magnetism, due to a few minerals exhibiting spontaneous magnetization. Attractive properties of magnetite were already known in Antiquity and were used for navigation...

Guillaume Morin

1998-01-01T23:59:59.000Z

134

The B->pi l nu and Bs->K l nu form factors and |Vub| from 2+1-flavor lattice QCD with domain-wall light quarks and relativistic heavy quarks  

E-Print Network [OSTI]

We calculate the form factors for B->pi l nu & Bs->K l nu decay in lattice QCD. We use the (2+1)-flavor RBC-UKQCD gauge field-ensembles generated with the domain-wall fermion and Iwasaki gauge actions. For the b quarks we use the anisotropic clover action with the relativistic heavy-quark interpretation. We analyze data at 2 lattice spacings a~0.11, 0.086 fm with pion masses as light as M_pi~290 MeV. We extrapolate our numerical results to the physical light-quark masses and to the continuum and interpolate in the pion/kaon energy using SU(2) "hard-pion" chiral perturbation theory. We provide complete systematic error budgets for the vector & scalar form factors f+(q^2) & f0(q2) for B->pi l nu & Bs ->K l nu at 3 momenta that span the q^2 range accessible in our numerical simulations. Next we extrapolate these results to q^2 = 0 using a model-independent z-parameterization based on analyticity & unitarity. We present our final results for f+(q^2) & f0(q^2) as the z coefficients and matr...

Flynn, J M; Kawanai, T; Lehner, C; Soni, A; Van de Water, R S; Witzel, O

2015-01-01T23:59:59.000Z

135

magnetism  

Science Journals Connector (OSTI)

magnetism [A class of physical phenomena associated with moving electricity, including the mutual mechanical forces among magnets and electric currents] ? Magnetismus m

2014-08-01T23:59:59.000Z

136

Dynamics of strings between walls  

SciTech Connect (OSTI)

Configurations of vortex strings stretched between or ending on domain walls were previously found to be 1/4 Bogomol'nyi-Prasad-Sommerfield (BPS) states in N=2 supersymmetric gauge theories in 3+1 dimensions. Among zero modes of string positions, the center of mass of strings in each region between two adjacent domain walls is shown to be non-normalizable whereas the rests are normalizable. We study dynamics of vortex strings stretched between separated domain walls by using two methods, the moduli space (geodesic) approximation of full 1/4 BPS states and the charged particle approximation for string end points in the wall effective action. In the first method we explicitly obtain the effective Lagrangian in the strong coupling limit, which is written in terms of hypergeometric functions, and find the 90 deg. scattering for head-on collision. In the second method the domain wall effective action is assumed to be U(1){sup N} gauge theory, and we find a good agreement between two methods for well-separated strings.

Eto, Minoru [INFN, Sezione di Pisa, Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Department of Physics, University of Pisa Largo Pontecorvo, 3, Ed. C, 56127 Pisa (Italy); Fujimori, Toshiaki; Nagashima, Takayuki [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Nitta, Muneto [Department of Physics, Keio University, Hiyoshi, Yokohama, Kanagawa 223-8521 (Japan); Ohashi, Keisuke [Department of Applied Mathematics and Theoretical Physics, University of Cambridge, CB3 0WA (United Kingdom); Sakai, Norisuke [Department of Mathematics, Tokyo Woman's Christian University, Tokyo 167-8585 (Japan)

2009-02-15T23:59:59.000Z

137

Magnetism  

Science Journals Connector (OSTI)

... dipoles in applied fields". It deals with the classical (Langevin) theory of para-magnetism, anisotropy fields and magnetic measurements. In the next chapter "Atomic structure" the author ... special relevance to ferrites and the inclusion of a quite lengthy discussion of Pauli para-magnetism and of Stoner's treatment of itinerant electron ferromagnetism, though it does much to ...

E. W. LEE

1972-03-31T23:59:59.000Z

138

Magnetism  

Science Journals Connector (OSTI)

... THIS is a good book, and we are glad to see the subject of magnetism fully treated in a popularly written text-book. It is a second edition of ... of importance, accuracy, and exhaustiveness, places the present treatise, as far as terrestrial magnetism is concerned, much before any similar book with which we are acquainted. The correction ...

JAMES STUART

1872-03-07T23:59:59.000Z

139

Colossal anisotropic resistivity and oriented magnetic domains in strained La{sub 0.325}Pr{sub 0.3}Ca{sub 0.375}MnO{sub 3} films  

SciTech Connect (OSTI)

Magnetic and resistive anisotropies have been studied for the La{sub 0.325}Pr{sub 0.3}Ca{sub 0.375}MnO{sub 3} films with different thicknesses grown on low symmetric (011)-oriented (LaAlO{sub 3}){sub 0.3}(SrAl{sub 0.5}Ta{sub 0.5}O{sub 3}){sub 0.7} substrates. In the magnetic and electronic phase separation region, a colossal anisotropic resistivity (AR) of ?10{sup 5}% and an anomalous large anisotropic magnetoresistance can be observed for 30 nm film. However, for 120 nm film, the maximum AR decreases significantly (?2?×?10{sup 3}%) due to strain relaxation. The colossal AR is strongly associated with the oriented formation of magnetic domains, and the features of the strain effects are believed to be useful for the design of artificial materials and devices.

Jiang, Tao; Yang, Shengwei; Liu, Yukuai; Zhao, Wenbo; Feng, Lei; Li, Xiaoguang, E-mail: lixg@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale, Department of Physics, University of Science and Technology of China, Hefei 230026 (China); Zhou, Haibiao; Lu, Qingyou [Hefei National Laboratory for Physical Sciences at Microscale, Department of Physics, University of Science and Technology of China, Hefei 230026 (China); High Magnetic Field Laboratory, Chinese Academy of Sciences and University of Science and Technology of China, Hefei 230031 (China); Hou, Yubin [High Magnetic Field Laboratory, Chinese Academy of Sciences and University of Science and Technology of China, Hefei 230031 (China)

2014-05-19T23:59:59.000Z

140

magnets  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

I I Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Asymmetric Magnetization Reversal in Exchange-Biased Hysteresis Loops  

SciTech Connect (OSTI)

Polarized neutron reflectometry is used to probe the in-plane projection of the net-magnetization vector M(vector sign) of polycrystalline Fe films exchange coupled to twinned (110) MnF{sub 2} or FeF{sub 2} antiferromagnetic (AF) layers. The magnetization reversal mechanism depends upon the orientation of the cooling field with respect to the twinned microstructure of the AF, and whether the applied field is increased to (or decreased from) a positive saturating field; i.e., the magnetization reversal is asymmetric. The reversal of the sample magnetization from one saturated state to the other occurs via either domain wall motion or magnetization rotation on opposite sides of the same hysteresis loop. (c) 2000 The American Physical Society.

Fitzsimmons, M. R.; Yashar, P.; Leighton, C.; Schuller, Ivan K.; Nogues, J.; Majkrzak, C. F.; Dura, J. A.

2000-04-24T23:59:59.000Z

142

Two-Stage Magnetization Reversal in Exchange Biased Bilayers  

SciTech Connect (OSTI)

MnF{sub 2}/Fe bilayers exhibit asymmetric magnetization reversal that occurs by coherent rotation on one side of the loop and by nucleation and propagation of domain walls on the other side of the loop. Here, we show by polarized neutron reflectometry, magnetization, and magnetotransport measurements that for samples with good crystalline ''quality'' the rotation is a two-stage process, due to coherent rotation to a stable state perpendicular to the cooling field direction. The result is remarkably asymmetrically shaped hysteresis loops.

Leighton, C.; Fitzsimmons, M. R.; Yashar, P.; Hoffmann, A.; Nogues, J.; Dura, J.; Majkrzak, C. F.; Schuller, Ivan K.

2001-05-07T23:59:59.000Z

143

Radiation Damage and Tritium Breeding Study in a Fusion Reactor Using a Liquid Wall of Various Thorium Molten Salts  

Science Journals Connector (OSTI)

A new magnetic fusion reactor design, called APEX uses a liquid wall between fusion plasma and solid first wall to reach ... replacement of the first wall structure during the reactor’s operation due to the radia...

Mustafa Übeyli

2007-12-01T23:59:59.000Z

144

Wall to Wall Optimal Transport  

E-Print Network [OSTI]

The calculus of variations is employed to find steady divergence-free velocity fields that maximize transport of a tracer between two parallel walls held at fixed concentration for one of two constraints on flow strength: a fixed value of the kinetic energy or a fixed value of the enstrophy. The optimizing flows consist of an array of (convection) cells of a particular aspect ratio Gamma. We solve the nonlinear Euler-Lagrange equations analytically for weak flows and numerically (and via matched asymptotic analysis in the fixed energy case) for strong flows. We report the results in terms of the Nusselt number Nu, a dimensionless measure of the tracer transport, as a function of the Peclet number Pe, a dimensionless measure of the energy or enstrophy of the flow. For both constraints the maximum transport Nu_{MAX}(Pe) is realized in cells of decreasing aspect ratio Gamma_{opt}(Pe) as Pe increases. For the fixed energy problem, Nu_{MAX} \\sim Pe and Gamma_{opt} \\sim Pe^{-1/2}, while for the fixed enstrophy scenario, Nu_{MAX} \\sim Pe^{10/17} and Gamma_{opt} \\sim Pe^{-0.36}. We also interpret our results in the context of certain buoyancy-driven Rayleigh-Benard convection problems that satisfy one of the two intensity constraints, enabling us to investigate how the transport scalings compare with upper bounds on Nu expressed as a function of the Rayleigh number \\Ra. For steady convection in porous media, corresponding to the fixed energy problem, we find Nu_{MAX} \\sim \\Ra and Gamma_{opt} \\sim Ra^{-1/2}$, while for steady convection in a pure fluid layer between free-slip isothermal walls, corresponding to fixed enstrophy transport, Nu_{MAX} \\sim Ra^{5/12} and Gamma_{opt} \\sim Ra^{-1/4}.

Pedram Hassanzadeh; Gregory P. Chini; Charles R. Doering

2014-04-14T23:59:59.000Z

145

Wall thickness measuring method and apparatus  

DOE Patents [OSTI]

An apparatus for measuring the wall thickness of a nonmagnetic article having a housing supporting a magnet and a contiguous supporting surface. The tubular article and the housing are releasably secured to the supporting surface and a support member of an optical comparator, respectively. To determine the wall thickness of the article at a selected point, a magnetically responsive ball is positioned within the tubular article over said point and retained therein by means of a magnetic field produced by the magnet. Thereafter, an optical comparator is employed to project a magnified image of the ball on a screen and the wall thickness at the selected point is calculated by using a ball surface measurement taken with the comparator in conjunction with a previously determined base line measurement.

Salzer, L.J.; Bergren, D.A.

1987-10-06T23:59:59.000Z

146

High performance magnetic bearing systems using high temperature superconductors  

DOE Patents [OSTI]

Disclosed are a magnetic bearing apparatus and a method for providing at least one stabilizing force in a magnetic bearing structure with a superconducting magnetic assembly and a magnetic assembly, by providing a superconducting magnetic member in the superconducting magnetic assembly with a plurality of domains and arranging said superconducting magnetic member such that at least one domain has a domain C-axis vector alignment angularly disposed relative to a reference axis of the magnetic member in the magnetic assembly. 7 figs.

Abboud, R.G.

1998-05-05T23:59:59.000Z

147

High performance magnetic bearing systems using high temperature superconductors  

DOE Patents [OSTI]

A magnetic bearing apparatus and a method for providing at least one stabilizing force in a magnetic bearing structure with a superconducting magnetic assembly and a magnetic assembly, by providing a superconducting magnetic member in the superconducting magnetic assembly with a plurality of domains and arranging said superconducting magnetic member such that at least one domain has a domain C-axis vector alignment angularly disposed relative to a reference axis of the magnetic member in the magnetic assembly.

Abboud, Robert G. (Barrington Hills, IL)

1998-01-01T23:59:59.000Z

148

Magnetic Imaging Wolfgang Kuch  

E-Print Network [OSTI]

Magnetic Imaging Wolfgang Kuch Freie Universit¨at Berlin, Institut f¨ur Experimentalphysik, Arnimallee 14, 14195 Berlin, Germany kuch@physik.fu-berlin.de Abstract. Imaging of magnetic domains has- ern techniques is used nowadays routinely for magnetic imaging of magnetic ma- terials

Kuch, Wolfgang

149

INTOR impurity control and first wall system  

SciTech Connect (OSTI)

The highlights of the recent INTOR effort on examining the key issues of the impurity control/first wall system are summarized. The emphasis of the work was an integrated study of the edge-region physics, plasma-wall interaction, materials, engineering and magnetic considerations associated with the poloidal divertor and pump limiter. The development of limiter and divertor collector plate designs with an acceptable lifetime was a major part of the work.

Abdou, M.A.

1983-04-01T23:59:59.000Z

150

Wall surveyor project report  

SciTech Connect (OSTI)

A report is made on the demonstration of a first-generation Wall Surveyor that is capable of surveying the interior and thickness of a stone, brick, or cement wall. LLNL`s Micropower Impulse Radar is used, based on emitting and detecting very low amplitude and short microwave impulses (MIR rangefinder). Six test walls were used. While the demonstrator MIR Wall Surveyor is not fieldable yet, it has successfully scanned the test walls and produced real-time images identifying the walls. It is planned to optimize and package the evaluation wall surveyor into a hand held unit.

Mullenhoff, D.J.; Johnston, B.C.; Azevedo, S.G.

1996-02-22T23:59:59.000Z

151

Stability analysis of polarized domains Jos'e A. Miranda and Michael Widom  

E-Print Network [OSTI]

is the magnetization and fl the line tension (essentially h times the surface tension). Jackson, Goldstein Stability analysis of polarized domains Jos'e A. Miranda and Michael Polarized ferrofluids, lipid monolayers and magnetic bubbles form domains with deformable boundaries

Widom, Michael

152

Magnetic shielding  

DOE Patents [OSTI]

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines. 3 figs.

Kerns, J.A.; Stone, R.R.; Fabyan, J.

1987-10-06T23:59:59.000Z

153

Magnetic shielding  

DOE Patents [OSTI]

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, John A. (Livermore, CA); Stone, Roger R. (Walnut Creek, CA); Fabyan, Joseph (Livermore, CA)

1987-01-01T23:59:59.000Z

154

Axions from cosmic string and wall decay  

SciTech Connect (OSTI)

If inflation occurred with a reheat temperature > T{sub PQ}, axions from the decay of global axion strings and domain walls would make an important contribution to the cosmological energy density, comparable to that from vacuum misalignment. Several groups have numerically studied the evolution of axion strings and walls in the past, however substantial uncertainties remain in their contribution to the present density {Omega}{sub a,string+wall} {approx} 1-100 (f{sub a}/10{sup 12} GeV){sup 7/6}, where f{sub a} is the axion decay constant. I will describe the numerical methods used in our simulations and show results for several string and wall configurations.

Hagmann, C A

2010-03-10T23:59:59.000Z

155

Low-frequency magnetic and resistance noise in magnetic tunnel junctions  

Science Journals Connector (OSTI)

We have studied the voltage fluctuations of current-biased, micron-scale magnetic tunnel junctions. We find that the spectral power density is 1/f-like at low frequencies and becomes frequency independent at high frequencies. The frequency-independent background noise is due to Johnson-Nyquist noise and shot noise mechanisms. The nature of the 1/f noise has its origin in two different mechanisms. In the magnetic hysteresis loops this noise power is strongly field-dependent and is due to thermal magnetization fluctuations in both the “free” and “fixed” magnetic layers. We attribute these magnetic fluctuations to thermally excited hopping of magnetic domain walls between pinning sites. At high temperatures, this magnetic noise is found to track the dc resistance susceptibility but it is not in quantitative agreement with the fluctuation dissipation relation, indicating that the magnetic structure is not in equilibrium. A second mechanism for the 1/f noise, connected with defects in the tunnel barrier but not related to the overall magnetization fluctuations, was found at fields for which the magnetic structure in the free and fixed layers is well aligned. We attribute this noise to electron trapping processes having thermally activated kinetics and a broad distribution of activation energies. Below ?25 K the noise power is temperature independent suggesting that the kinetics are dominated by tunneling. Our results show that the thermal stability of both the magnetic layers and the quality of the tunnel barrier are important factors in reducing the low-frequency noise in magnetic tunnel junctions.

L. Jiang; E. R. Nowak; P. E. Scott; J. Johnson; J. M. Slaughter; J. J. Sun; R. W. Dave

2004-02-13T23:59:59.000Z

156

Magnetic shielding  

DOE Patents [OSTI]

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, J.A.; Stone, R.R.; Fabyan, J.

1985-02-12T23:59:59.000Z

157

Eminent Domain Law (Iowa)  

Broader source: Energy.gov [DOE]

These regulations confer the power of eminent domain and describe procedures for exercising eminent domain in Iowa.

158

DMBC: Domain Names & Web Hosting Domain Names  

E-Print Network [OSTI]

DMBC: Domain Names & Web Hosting Domain Names Top Level Domains · .com · .net · .org · .edu · .gov.9% of the web-viewing audience is used to typing in. Chances are, a visitor will type in ".com" even if you tell and simple · Try to avoid dashes or underscores in the domain name unless there is no other option Web

Stowell, Michael

159

Fluidized wall for protecting fusion chamber walls  

DOE Patents [OSTI]

Apparatus for protecting the inner wall of a fusion chamber from microexplosion debris, x-rays, neutrons, etc. produced by deuterium-tritium (DT) targets imploded within the fusion chamber. The apparatus utilizes a fluidized wall similar to a waterfall comprising liquid lithium or solid pellets of lithium-ceramic, the waterfall forming a blanket to prevent damage of the structural materials of the chamber.

Maniscalco, James A. (Danville, CA); Meier, Wayne R. (Livermore, CA)

1982-01-01T23:59:59.000Z

160

Stripe Domain-Structures in a Thin Ferromagnetic Film  

E-Print Network [OSTI]

We present a theory of the stripe domain structure in a thin ferromagnetic film with single-ion easy-axis magnetic anisotropy and long-range dipole interactions, for a wide range of temperatures and applied magnetic field. The domains exist...

KASHUBA, AB; Pokrovsky, Valery L.

1993-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Liquid Wall Chambers  

SciTech Connect (OSTI)

The key feature of liquid wall chambers is the use of a renewable liquid layer to protect chamber structures from target emissions. Two primary options have been proposed and studied: wetted wall chambers and thick liquid wall (TLW) chambers. With wetted wall designs, a thin layer of liquid shields the structural first wall from short ranged target emissions (x-rays, ions and debris) but not neutrons. Various schemes have been proposed to establish and renew the liquid layer between shots including flow-guiding porous fabrics (e.g., Osiris, HIBALL), porous rigid structures (Prometheus) and thin film flows (KOYO). The thin liquid layer can be the tritium breeding material (e.g., flibe, PbLi, or Li) or another liquid metal such as Pb. TLWs use liquid jets injected by stationary or oscillating nozzles to form a neutronically thick layer (typically with an effective thickness of {approx}50 cm) of liquid between the target and first structural wall. In addition to absorbing short ranged emissions, the thick liquid layer degrades the neutron flux and energy reaching the first wall, typically by {approx}10 x x, so that steel walls can survive for the life of the plant ({approx}30-60 yrs). The thick liquid serves as the primary coolant and tritium breeding material (most recent designs use flibe, but the earliest concepts used Li). In essence, the TLW places the fusion blanket inside the first wall instead of behind the first wall.

Meier, W R

2011-02-24T23:59:59.000Z

162

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

163

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

164

Tokamak reactor first wall  

DOE Patents [OSTI]

This invention relates to an improved first wall construction for a tokamak fusion reactor vessel, or other vessels subjected to similar pressure and thermal stresses.

Creedon, R.L.; Levine, H.E.; Wong, C.; Battaglia, J.

1984-11-20T23:59:59.000Z

165

Formalizing Synthetic Domain Theory  

Science Journals Connector (OSTI)

Synthetic Domain Theory (SDT) is a constructive variant of Domain Theory where all functions are continuous following Dana Scott‘s idea of “domains as sets”. Recently there have been suggested more abstract axiomatizations encompassing ... Keywords: LCF, domain theory, formal verification, programming logics, synthetic domain theory, type theory

Bernhard Reus

1999-11-01T23:59:59.000Z

166

Modelling of Ion Cyclotron Wall Conditioning plasmas  

SciTech Connect (OSTI)

Ion Cyclotron Wall Conditioning (ICWC) is envisioned in ITER to clean the wall from impurities, to control the wall isotopic ratio and the hydrogen recycling in the presence of the toroidal magnetic field. Various experiments and modelling are advancing to consolidate this technique. In this contribution the modeling of ICWC is presented, which can be divided in two parts: plasma description and plasma wall interaction. Firstly a 0D plasma model, based on a set of energy and particle balance equations for Maxwellian Hydrogen and Helium species, is presented. The model takes into account elementary collision processes, coupled RF power, particle confinement, wall recycling, and active gas injection and pumping. The RF plasma production process is based mainly on electron collisional ionization. The dependency of the plasma parameters, the Hydrogen and Helium partial pressures and neutral or ionic fluxes on pressure and RF power are quantitatively in good agreement with those obtained experimentally on TORE SUPRA. Secondly an extension of the 0D model including the description of the wall interaction is presented and compared to TORE SUPRA multi-pulse ICWC discharges.

Douai, D.; Wauters, T.; Wuenderlich, D.; Bremond, S.; Lombard, G.; Mollard, P.; Pegourie, B. [CEA, IRFM, 13108 St Paul lez Durance (France); Lyssoivan, A. [LPP-ERM/KMS, 1000 Brussels (Belgium); Marchuk, O. [IEK-4, FZ Juelich, 52425 Juelich (Germany); Van Oost, G. [Ghent University, 9000 Ghent (Belgium)

2011-12-23T23:59:59.000Z

167

Multi-Domain Modeling  

Science Journals Connector (OSTI)

This chapter presents several multi-domain system models. Multi-domain models are characterized by the fact that they have components belonging to different engineering domains. In this chapter, we will see mo...

Michael Tiller Ph.D.

2001-01-01T23:59:59.000Z

168

Great Wall Starbucks  

E-Print Network [OSTI]

along the Great Wall. When you think about it, it's not a bad marketing strategy: the Wall is high, the stairs relentless; what better than an espresso to energize you for the steep climb up? On second thought, make that a double. #ceas #china #tsutsui...

Hacker, Randi; Gatewood, Tyler; Tsutsui, William

2006-03-29T23:59:59.000Z

169

Surface effect on domain wall width in ferroelectrics  

E-Print Network [OSTI]

Oct 26, 2009 ... Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831, USA. 3Department of Materials ..... =1,2,5,10,20, curves 1, 2, 3, 4, 5, 6 and dead layer thickness H/R. =1,3 panels a and b, .... No. 3306. The research is supported in part S.V.K. by the. Division of Scientific User Facilities, DOE BES. V.G. wishes.

2009-10-26T23:59:59.000Z

170

Resistive ferromagnetic wall modes in theory and experiment  

SciTech Connect (OSTI)

Effects of the ferromagnetic resistive wall on the plasma stability are analyzed. The analysis is based on the equations describing the perturbation dynamics outside the plasma, assuming a linear plasma response. A single-mode cylindrical model is used with two features that differ from the standard case: the wall magnetic permeability is incorporated and the thin-wall approximation is waived. The derivations are performed so that the results can be applied to both tokamaks and line-tied pinches. This is done to allow conclusions for tokamaks from comparison of the developed theory with the experimental data on the resistive and ferromagnetic wall modes in the Wisconsin rotating wall machine with and without a ferritic wall [W. F. Bergerson, D. A. Hannum, C. C. Hegna, R. D. Kendrick, J. S. Sarff, and C. B. Forest, Phys. Rev. Lett. 101, 235005 (2008)]. The model shows that the ferromagnetic wall effect is always destabilizing. However, it must be small under standard conditions in tokamaks. The effect can be much stronger in the pinch with lower magnetic field and larger wall permeability. The dispersion relation obtained here makes possible an explanation of the experimental results available so far, including those from the Wisconsin machine reported recently as strongly contradictory to expectations based on earlier models. Also, an easy practical solution for compensating the destabilizing ferromagnetic effect in tokamaks is proposed.

Pustovitov, V. D. [Nuclear Fusion Institute, Russian Research Centre Kurchatov Institute, Kurchatov Square 1, Moscow 123182 (Russian Federation)

2009-05-15T23:59:59.000Z

171

Definition: Time-Domain Electromagnetics | Open Energy Information  

Open Energy Info (EERE)

Definition Definition Edit with form History Facebook icon Twitter icon » Definition: Time-Domain Electromagnetics Jump to: navigation, search Dictionary.png Time-Domain Electromagnetics Time-domain electromagnetic (TDEM) surveys are active-source soundings which provide information about the electrical structure of the shallow subsurface.[1] View on Wikipedia Wikipedia Definition Transient electromagnetics, (also time-domain electromagnetics / TDEM), is a geophysical exploration technique in which electric and magnetic fields are induced by transient pulses of electric current and the subsequent decay response measured. TEM / TDEM methods are generally able to determine subsurface electrical properties, but are also sensitive to subsurface magnetic properties in applications like UXO detection and

172

Unitised Curtain Walls  

Science Journals Connector (OSTI)

Unitised curtain walling was developed to overcome the problems associated with the installation of stick systems (see Chapter 7) and to reduce the on-site installation time. It consists of large panels, usual...

2009-01-01T23:59:59.000Z

173

Structural, Optical, and Magnetic Properties of Highly Ordered Mesoporous MCr2O4 and MCr2–xFexO4 (M = Co, Zn) Spinel Thin Films with Uniform 15 nm Diameter Pores and Tunable Nanocrystalline Domain Sizes  

Science Journals Connector (OSTI)

§ Department of Advanced Interdisciplinary Science, Graduate School of Engineering, Utsunomiya University, Yoto 7-1-2, 321-8585 Utsunomiya, Japan ... Such magnetic ferroelectricity, showing an unprecedented sensitivity to ap plied magnetic fields, occurs in frustrated magnets with competing interactions between spins and complex magnetic orders. ...

Christian Suchomski; Christian Reitz; Kirstin Brezesinski; Célia Tavares de Sousa; Marcus Rohnke; Ken-ichi Iimura; Joao Pedro Esteves de Araujo; Torsten Brezesinski

2011-11-23T23:59:59.000Z

174

Chiral magnetic effect in 2+1 flavor QCD+QED  

E-Print Network [OSTI]

The exciting possibility of direct observation of QCD instantons in heavy-ion collisions has recently been proposed by Kharzeev. The underlying phenomenon, known as the chiral magnetic effect, may have been observed recently at RHIC, and a first principles calculation is needed to confirm and understand the results. The chiral magnetic effect is thought to be visible in the symmetric phase, at temperatures above the QCD critical temperature, and in the presence of an external magnetic field. We report on first 2+1 flavor, domain wall fermion, QCD+QED dynamical simulations above the critical temperature, in a fixed topological sector(s), which are used to study the electric charge separation produced by the effect.

M. Abramczyk; T. Blum; G. Petropoulos; R. Zhou

2009-11-06T23:59:59.000Z

175

BNL | Joseph S. Wall  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Joseph S. Wall Joseph S. Wall Emeritus Research Interests Mass mapping of unstained biological molecules with the scanning transmission electron microscope (STEM), particularly assemblies of complexes from subunits of known size and shape. Examples include: Alzheimer's filaments, viral capsids, annelid hemoglobins, hemocyanins, proteases, chaperonins, microtubule proteins, prions and various nucleic acid-protein complexes. Another research area is instrument development involving design and construction of an instrument for low-temperture, energy loss spectroscopy, and elemental mapping at low dose. This is being used to map phosphorus in nucleic acid-protein complexes, phosphorylated proteins and phospholipid structures. He also is director of the Scanning Transmission Electron Microscope STEM

176

Big Magnet Design II: a) solenoid and cable concept  

E-Print Network [OSTI]

.V. Zlobin #12;Magnetic cavern design II Fields 1 m iron wall thickness. ~2.4 T peak field in the iron. Good

McDonald, Kirk

177

Single-Walle 4. Single-Walled Carbon Nanotubes  

E-Print Network [OSTI]

applications, carbon nanotube research is ac- tively being pursued in diverse areas including energy storage105 Single-Walle 4. Single-Walled Carbon Nanotubes Sebastien Nanot, Nicholas A. Thompson, Ji Single-walled carbon nanotubes (SWCNTs) are hol- low, long cylinders with extremely large aspect ratios

Kono, Junichiro

178

Stick-System Curtain Walls  

Science Journals Connector (OSTI)

Curtain walls can be divided in two main types according to the system of fabrication and installation: stick systems and unitised panels. The traditional curtain-wall construction is the stick system, where m...

2009-01-01T23:59:59.000Z

179

Complex magnetic behavior of the sawtooth Fe chains in Rb2Fe2O(AsO4)2  

SciTech Connect (OSTI)

Results of magnetic eld and temperature dependent neutron diraction and magnetization mea- surements on oxy-arsenate Rb2Fe2O(AsO4)2 are reported. The crystal structure of this compound contains pseudo-one-dimensional [Fe2O6] sawtooth-like chains, formed by corner sharing isosce- les triangles of Fe3+ ions occupying two nonequivalent crystallographic sites. The chains extend innitely along the crystallographic b-axis and are structurally conned from one another via dia- magnetic (AsO4)3- units along the a-axis, and Rb+ cations along the c-axis direction. Neutron diraction measurements indicate the onset of a long range antiferromagnetic order below approxi- mately 25 K. The magnetic structure consists of ferrimagnetic chains which are antiferromagnetically coupled with each other. Within each chain, one of the two Fe sites carries a moment which lies along the b-axis, while the second site bears a canted moment in the opposite direction. Exter- nally applied magnetic eld induces a transition to a ferrimagnetic state, in which the coupling between the sawtooth chains becomes ferromagnetic. Magnetization measurements performed on optically-aligned single crystals reveal evidence for an uncompensated magnetization at low mag- netic elds that could emerge from to a phase-segregated state with ferrimagnetic inclusions or from antiferromagnetic domain walls. The observed magnetic states and the competition between them is expected to arise from strongly frustrated interactions within the sawtooth chains and relatively weak coupling between them.

Garlea, Vasile O [ORNL] [ORNL; Sanjeewa, Liurukara D. [Clemson University] [Clemson University; McGuire, Michael A [ORNL] [ORNL; Kumar, Pramod [Indian Institute of Information Technology] [Indian Institute of Information Technology; Sulejmanovic, Dino [Clemson University] [Clemson University; Hwu, Shiou-Jyh [Clemson University] [Clemson University

2014-01-01T23:59:59.000Z

180

Fault patterns on the outer wall of the Peru—Chile trench  

Science Journals Connector (OSTI)

Faults on the outer wall of the northern Peru—Chile trench, seaward of the Lima Basin, Arica Bight, and Iquique Basin, parallel the trend of Nazca plate magnetic ... on the ridge. Seaward of the Yaquina Basin, fa...

R. A. Hagen

1993-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Magnetic Confinement Fusion Science Status and Challenges  

E-Print Network [OSTI]

Magnetic Confinement Fusion Science Status and Challenges S. Prager University of Wisconsin February, 2005 #12;Two approaches to fusion Inertial confinement extremely dense, short-lived Magnetic ·Control plasma disruptions ·Develop new magnetic configurations ·Control the plasma-wall interaction

182

Eminent Domain Rights (Florida)  

Broader source: Energy.gov [DOE]

Developers of certain facilities, including dams to be used for hydropower, natural gas companies, wastewater systems, and coal pipelines, may be eligible to exercise eminent domain powers in...

183

Stability analysis of polarized domains Jose A. Miranda and Michael Widom  

E-Print Network [OSTI]

, lipid monolayers, and magnetic bubbles form domains with deformable boundaries. Stability analysis results on the asymptotic behavior of the integral In(x) in his study of magnetic bubble stabilityStability analysis of polarized domains Jose´ A. Miranda and Michael Widom Department of Physics

Widom, Michael

184

Covering Walls With Fabrics.  

E-Print Network [OSTI]

the glue a dull surface to adhere to. Fill any gouges or nail holes with patching plaster and sand smooth after they have dried thoroughly. Minor ripples can be covered with spackling compound, a plaster-like substance that is spread thinly... during dry weather and in a well-ventilated room. Cut each panel 3 inches longer than the ceiling height. Match and cut sufficient fabric widths to cover completely one wall at a time. Start with Corner I nstall the first fabric panel so...

Anonymous,

1979-01-01T23:59:59.000Z

185

X-ray Holograms Expose Secret Magnetism | Advanced Photon Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How Dissolved Metal Ions Interact in Solution How Dissolved Metal Ions Interact in Solution One Giant Leap for Radiation Biology? What's in the Cage Matters in Iron Antimonide Thermoelectric Materials Novel Experiments on Cement Yield Concrete Results Watching a Glycine Riboswitch "Switch" Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed X-ray Holograms Expose Secret Magnetism MAY 11, 2007 Bookmark and Share By observing changes in coherent x-ray speckle pattern, such as the one shown above, researchers are able for the first time to investigate nanoscale dynamics of antiferromagnetic domain walls, and observe a cross over from classical to quantum behavior. (Credit: O. Shpyrko)

186

Escape patterns, magnetic footprints, and homoclinic tangles due to ergodic magnetic limiters  

E-Print Network [OSTI]

to uniformize these fluxes through the cre- ation of chaotic magnetic field lines near the tokamak wall, which to the particle anomalous diffusion in presence of chaotic magnetic field lines. Approaches based in classical,11 The investigation of anomalous transport in the presence of chaotic magnetic field lines often needs the analysis

Rey Juan Carlos, Universidad

187

Theory of magnetic dissipation imaging Y. Liu, B. Ellman, and P. Gruttera)  

E-Print Network [OSTI]

. Dissipation measured by this technique is equivalent to a measurement of the spatially resolved energy loss of the domain wall width. When neglecting the demagnetization energy, the domain wall energy per unit area width result in magnetoelastic emission of phonons. These phonons carry energy from the tip, leading

Grütter, Peter

188

Oven wall panel construction  

DOE Patents [OSTI]

An oven roof or wall is formed from modular panels, each of which comprises an inner fabric and an outer fabric. Each such fabric is formed with an angle iron framework and somewhat resilient tie-bars or welded at their ends to flanges of the angle irons to maintain the inner and outer frameworks in spaced disposition while minimizing heat transfer by conduction and permitting some degree of relative movement on expansion and contraction of the module components. Suitable thermal insulation is provided within the module. Panels or skins are secured to the fabric frameworks and each such skin is secured to a framework and projects laterally so as slidingly to overlie the adjacent frame member of an adjacent panel in turn to permit relative movement during expansion and contraction.

Ellison, Kenneth (20 Avondale Cres., Markham, CA); Whike, Alan S. (R.R. #1, Caledon East, both of Ontario, CA)

1980-04-22T23:59:59.000Z

189

Investigation of coercivity mechanism in hot deformed Nd-Fe-B permanent magnets by small-angle neutron scattering  

SciTech Connect (OSTI)

The magnetic reversal behaviors of single domain sized Nd-Fe-B permanent magnets, with and without isolation between the Nd{sub 2}Fe{sub 14}B grains, was clarified using small-angle neutron scattering (SANS). The SANS patterns obtained arose from changes in the magnetic domains and were analyzed using the Teubner–Stray model, a phenomenological correlation length model, to quantify the periodicity and morphology of the magnetic domains. The results indicated that the magnetic reversal evolved with the magnetic domains that had similar sized grains. The grain isolation enabled us to realize the reversals of single domains.

Yano, M., E-mail: masao-yano-aa@mail.toyota.co.jp; Manabe, A.; Shoji, T.; Kato, A. [Advanced Material Engineering Division, Toyota Motor Corporation, Susono 410-1193 (Japan); Ono, K. [High Energy Accelerator Research Organization (KEK), Tsukuba 305-0801 (Japan); Harada, M. [Toyota Central R and D Labs, Inc., Aichi 480-1192 (Japan); Kohlbrecher, J. [Laboratory for Neutron Scattering, Paul Scherrer Institut, 5232 Villigen PSI (Switzerland)

2014-05-07T23:59:59.000Z

190

Magnetic signature of indoor air pollution: Household dust study  

Science Journals Connector (OSTI)

The combination of magnetic and geochemical methods was used to determine the mineralogy, grain size and domain structure of magnetic particles in indoor dust collected in 195 sites in Warsaw, Poland. Data sho...

Beata Górka-Kostrubiec; Maria Jele?ska; El?bieta Król

2014-12-01T23:59:59.000Z

191

Domain boundary prediction based on profile domain linker propensity index  

Science Journals Connector (OSTI)

Successful prediction of protein domain boundaries provides valuable information not only for the computational structure prediction of multi-domain proteins but also for the experimental structure determination. In this work, a novel index at the profile ... Keywords: Domain, Domain linker, Profile

Qiwen Dong; Xiaolong Wang; Lei Lin; Zhiming Xu

2006-04-01T23:59:59.000Z

192

residual magnetism  

Science Journals Connector (OSTI)

The magnetization, i.e., the magnetic polarization, that remains in a magnetized material after all attempts to remove the magnetization have been made. Note: An example of residual magnetization is the magnetiza...

2001-01-01T23:59:59.000Z

193

Magnetically Confined Plasmas  

Science Journals Connector (OSTI)

The propagation of high-velocity shock waves in an axial magnetic field generated by single-turn coils connected in parallel to a condenser bank is investigated. Time-resolved photographs show that the plasma behind the shock front is driven away from the tube walls by the magnetic pressure. This compression heats the ionized gas and maintains a high shock velocity during the transit of the front through the coil. The compressed plasma appears to be stable and undergoes radial oscillations that follow the current oscillations. The interpretation and significance of these observations in controlled thermonuclear fusion research are discussed.

A. C. Kolb

1958-10-15T23:59:59.000Z

194

Resuspension of wall deposits in spray dryers  

Science Journals Connector (OSTI)

Wall deposition occurs in spray dryers when dried or partially dried particles contact and adhere to the walls during operation, thus reducing the yield of product collected. Wall deposits also present a product ...

M. J. Hanus; T. A. G. Langrish

2007-10-01T23:59:59.000Z

195

Nano and picosecond magnetization dynamics of weakly coupled CoFe/Cr/NiFe trilayers studied by a multitechnique approach  

Science Journals Connector (OSTI)

We present results on the magnetization dynamics in heterostructures of the CoFe/Cr/NiFe type. We have employed a combination of different layer-selective methods covering a broad range from quasistatic hysteresis measurements by x-ray magnetic circular dichroism (XMCD), over time-resolved photoemission electron microscopy (PEEM) at subnanosecond timescales to high-frequency ferromagnetic resonance (FMR) experiments. With increasing driving frequency, we found a different influence of the coupling between the two ferromagnetic layers on the dynamic behavior. Employing the spatial resolution of the PEEM method, we have been able to discern various dynamic responses in different regions of the sample that could be attributed to magnetodynamic processes with a different degree of coupling. In conjunction with the complementary FMR and XMCD measurements, we attribute the inhomogeneous influence of interlayer coupling to a shift from domain-wall-motion-dominated dynamics at low frequencies to precession-dominated dynamics at higher frequencies.

A. M. Kaiser; C. Schöppner; F. M. Römer; C. Hassel; C. Wiemann; S. Cramm; F. Nickel; P. Grychtol; C. Tieg; J. Lindner; C. M. Schneider

2011-10-10T23:59:59.000Z

196

Structure of the controlled halo-current magnetic field in the T-10 tokamak  

Science Journals Connector (OSTI)

In the T-10 tokamak, the magnetic field spatially resonant with a ... the cross sections of the torus near the tokamak vacuum vessel wall. The spatial distribution of...

N. V. Ivanov; A. M. Kakurin

2011-01-01T23:59:59.000Z

197

General formulation of the resistive wall mode coupling equations  

SciTech Connect (OSTI)

A theoretical framework to describe the magnetic coupling of the toroidal plasma with the resistive wall and other sources of the field asymmetry is formulated. This is done for general toroidal geometry without restrictions on the plasma, while the wall is considered as a thin shell. Mathematically, the approach here exploits the Chance concept [M. S. Chance, Phys. Plasmas 4, 2161 (1997)], but with an essential difference: each source of the magnetic perturbation b (plasma, wall, external currents) is treated separately with account of their differences in space and nature. This allows much simpler formulation of the problem than was known before. The final equation couples the normal component of {partial_derivative}b/{partial_derivative}t at the wall to the perturbation at the plasma surface. Step by step reduction of this first-principle equation is performed with demonstration of its main features, starting from the known problem of singularities. This also includes the reduction to axially symmetric geometry, large-aspect-ratio, and the cylindrical limits. In the latter case, the known 'cylindrical' equation is reproduced, but now from the full 'toroidal' equations.

Pustovitov, V. D. [Nuclear Fusion Institute, Russian Research Centre 'Kurchatov Institute', Kurchatov Sq., 1, Moscow, 123182 (Russian Federation)

2008-07-15T23:59:59.000Z

198

Disorder-Induced Microscopic Magnetic Memory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Disorder-Induced Microscopic Magnetic Memory Print Disorder-Induced Microscopic Magnetic Memory Print The magnetic-recording industry deliberately introduces carefully controlled disorder into its materials to obtain the desired magnetic properties. But as the density of magnetic disks climbs, the size of the magnetic domains responsible for storage must decrease, posing new challenges. Beautiful theories based on random microscopic disorder have been developed over the past ten years. To directly compare these theories with precise experiments, an American-European team, led by researchers from the University of Washington, Seattle, first developed and then applied coherent x-ray speckle metrology to microscopic magnetic domains in a series of thin multilayer perpendicular magnetic materials of varying disorder. Their results, at odds with all previous theories, have set a new reference point for future theories.

199

Disorder-Induced Microscopic Magnetic Memory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Disorder-Induced Microscopic Disorder-Induced Microscopic Magnetic Memory Disorder-Induced Microscopic Magnetic Memory Print Wednesday, 26 October 2005 00:00 The magnetic-recording industry deliberately introduces carefully controlled disorder into its materials to obtain the desired magnetic properties. But as the density of magnetic disks climbs, the size of the magnetic domains responsible for storage must decrease, posing new challenges. Beautiful theories based on random microscopic disorder have been developed over the past ten years. To directly compare these theories with precise experiments, an American-European team, led by researchers from the University of Washington, Seattle, first developed and then applied coherent x-ray speckle metrology to microscopic magnetic domains in a series of thin multilayer perpendicular magnetic materials of varying disorder. Their results, at odds with all previous theories, have set a new reference point for future theories.

200

Disorder-Induced Microscopic Magnetic Memory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Disorder-Induced Microscopic Magnetic Memory Print Disorder-Induced Microscopic Magnetic Memory Print The magnetic-recording industry deliberately introduces carefully controlled disorder into its materials to obtain the desired magnetic properties. But as the density of magnetic disks climbs, the size of the magnetic domains responsible for storage must decrease, posing new challenges. Beautiful theories based on random microscopic disorder have been developed over the past ten years. To directly compare these theories with precise experiments, an American-European team, led by researchers from the University of Washington, Seattle, first developed and then applied coherent x-ray speckle metrology to microscopic magnetic domains in a series of thin multilayer perpendicular magnetic materials of varying disorder. Their results, at odds with all previous theories, have set a new reference point for future theories.

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Direct observation of temperature dependent magnetic domain structure of the multiferroic La{sub 0.66}Sr{sub 0.34}MnO{sub 3}/BiFeO{sub 3} bilayer system by x-ray linear dichroism- and x-ray magnetic circular dichroism-photoemission electron microscopy  

SciTech Connect (OSTI)

Low-thickness La{sub 0.66}Sr{sub 0.34}MnO{sub 3} (LSMO)/BiFeO{sub 3} (BFO) thin film samples deposited on SrTiO{sub 3} were imaged by high resolution x-ray microscopy at different temperatures. The ultra-thin thickness of the top layer allows to image both the ferromagnetic domain structure of LSMO and the multiferroic domain structure of the buried BFO layer, opening a path to a direct observation of coupling at the interface on a microscopic level. By comparing the domain size and structure of the BFO and LSMO, we observed that, in contrast to LSMO single layers, LSMO/BFO multilayers show a strong temperature dependence of the ferromagnetic domain structure of the LSMO. Particularly, at 40?K, a similar domain size for BFO and LSMO is observed. This indicates a persistence of exchange coupling on the microscopic scale at a temperature, where the exchange bias as determined by magnetometer measurements is vanishing.

Mix, C.; Finizio, S.; Jakob, G.; Kläui, M. [Institut für Physik, Johannes Gutenberg Universität Mainz, Staudingerweg 7, D-55128 Mainz (Germany); Buzzi, M.; Nolting, F. [Swiss Light Source, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland); Kronast, F. [Helmholtz-Zentrum-Berlin für Materialien und Energie GmbH, Albert-Einstein Straße 15, D-12489 Berlin (Germany)

2014-05-21T23:59:59.000Z

202

Data Domain to Model Domain Conversion Package | Argonne National  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Data Domain to Model Domain Conversion Package Data Domain to Model Domain Conversion Package Data Domain to Model Domain Conversion Package The Data Domain to Model Domain Conversion Package project will develop methods and implement a novel approach for generating data ensembles by using the latest available statistical modeling tools and knowledge of relevant physical and chemical process to develop climatologically aware methods for processing ACRF and other spatially sparse data sets. Data collected at the Atmospheric Radiation Measurement Program Climate Research Facility (ACRF) sites are employed mainly in column radiation models, to validate the models and develop new parameterizations. Currently, no single methodology can be used with data collected at the spatial scale of the ACRF sites or from specific AmeriFlux locations, to

203

Charge-Transfer Induced Magnetic Field Effects of Nano-Carbon Heterojunctions  

E-Print Network [OSTI]

Room temperature magnetic field effects have not been definitively observed in either single-walled carbon nanotubes (SWCNTs) or C60 under a small magnetic field due to their weak hyperfine interaction and slight difference of g-factor between...

Qin, Wei; Gong, Maogang; Shastry, Tejas; Hersam, Mark C.; Ren, Sheqiang

2014-08-22T23:59:59.000Z

204

Non-Abelian vortices on a cylinder: Duality between vortices and walls  

SciTech Connect (OSTI)

We investigate vortices on a cylinder in supersymmetric non-Abelian gauge theory with hypermultiplets in the fundamental representation. We identify moduli space of periodic vortices and find that a pair of wall-like objects appears as the vortex moduli is varied. Usual domain walls also can be obtained from the single vortex on the cylinder by introducing a twisted boundary condition. We can understand these phenomena as a T duality among D-brane configurations in type II superstring theories. Using this T-duality picture, we find a one-to-one correspondence between the moduli space of non-Abelian vortices and that of kinky D-brane configurations for domain walls.

Eto, Minoru; Fujimori, Toshiaki; Isozumi, Youichi; Nitta, Muneto; Ohashi, Keisuke; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Ohta, Kazutoshi [Theoretical Physics Laboratory, The Institute of Physical and Chemical Research (RIKEN), Wako 351-0198 (Japan)

2006-04-15T23:59:59.000Z

205

Stress-MI and domain studies in Co-based nanocrystalline ribbons Sandhya Dwevedi a  

E-Print Network [OSTI]

Stress-MI and domain studies in Co-based nanocrystalline ribbons Sandhya Dwevedi a , G on the magnetoimpedance (MI) effect in melt-spun (Co1�xFex)89Zr7B4 [x¼0, 0.025, 0.05] and (Co0.88Fe0.12)78.4Nb2.6Si9B9Al in large MI. Magnetic domains were investigated in the ribbons through magnetic force microscopy. & 2011

McHenry, Michael E.

206

Soft magnetic composites manufactured by warm co-extrusion of bulk metallic glass and steel powders  

SciTech Connect (OSTI)

Soft magnetic composites of Fe-based bulk metallic glass and low-alloy steel have been manufactured by warm co-extrusion of precursor powders at temperatures within the supercooled liquid region of the glass. Composites were manufactured with amorphous volume fractions of 75%, 67%, and 100%. Full consolidation of the constituent powders was observed with the bulk metallic glass remaining substantially amorphous. The composite electrical resistivity was observed to be anisotropic with a resistivity of 79 {mu}{Omega} cm measured transverse to the extrusion axis in a sample with 75% amorphous volume fraction. A 0-3 connectivity pattern with the low-resistivity steel phase embedded in a 3-dimensionally connected high-resistivity bulk metallic glass phase was observed with scanning electron microscopy. This confirms that the flow characteristics of the bulk metallic glass and the steel powders were comparable during extrusion at these temperatures. The saturation magnetization of 1.3 T was consistent with the volume weighted average of the saturation magnetization of the two phases. A relatively high quasistatic coercivity of 8 Oe was measured and is likely due to slight crystallization of the bulk metallic glass as well as domain wall pinning at prior particle boundaries. Careful control of the thermal environment during the extrusion process is required to minimize glass crystallization and achieve the desired balance of magnetic and electrical properties.

Johnson, Francis; Raber, Thomas R.; Zabala, Robert J.; Buresh, Steve J.; Tanico, Brian [GE Global Research, Ceramic and Metallurgy Technologies, One Research Circle, Niskayuna, New York 12309 (United States)

2013-05-07T23:59:59.000Z

207

Flux expulsion and reversible magnetization in the stripe phase superconductor La{sub 1.45}Nd{sub 0.40}Sr{sub 0.15}CuO{sub 4}  

SciTech Connect (OSTI)

Magnetization and free energy surfaces have been studied for superconducting La{sub 1.45}Nd{sub 0.40}Sr{sub 0.15}CuO{sub 4} in order to determine whether this stripe-phase material has a thermodynamic critical field curve, H{sub c}, similar to the classical superconductors. A large region of thermodynamic reversibility is found so that magnetization and free energy surfaces can be determined reliably over much of the H-T plane. In these stripe-phase materials there is evidence from neutron scattering that the holes collect in the domain walls of the antiphase domain structure, so the superconducting order parameter might be space dependent and the vortex lattice might be different from ordinary type-II superconductors. Although some uncertainty is introduced because a substantial background magnetization from the magnetic Nd ions must be subtracted, it can be stated that the H{sub c} vs T curve is found to be comparable to Nb. The material is a good bulk superconductor, but the shape of the magnetization curves (M{sub s} vs H) is quite different from the predictions of conventional type-II superconductor theories. {copyright} {ital 1997} {ital The American Physical Society}

Ostenson, J.E.; Budko, S.; Breitwisch, M.; Finnemore, D.K. [Ames Laboratory, US DOE and Department of Physics, Iowa State University, Ames, Iowa 50011 (United States)] [Ames Laboratory, US DOE and Department of Physics, Iowa State University, Ames, Iowa 50011 (United States); Ichikawa, N.; Uchida, S. [University of Tokyo, Yayoi 2-11-16, Tokyo 113 (Japan)] [University of Tokyo, Yayoi 2-11-16, Tokyo 113 (Japan)

1997-08-01T23:59:59.000Z

208

Stability analysis of polarized domains Jos'e A. Miranda and Michael Widom  

E-Print Network [OSTI]

and magnetic bubbles form domains with deformable boundaries. Stability analysis of these do­ mains depends of the integral I n (x) in his study of mag­ netic bubble stability. Nevertheless, only a systematic expansionStability analysis of polarized domains Jos'e A. Miranda and Michael Widom Department of Physics

Widom, Michael

209

Definition: Frequency-Domain Electromagnetics Survey | Open Energy  

Open Energy Info (EERE)

Frequency-Domain Electromagnetics Survey Frequency-Domain Electromagnetics Survey Jump to: navigation, search Dictionary.png Frequency-Domain Electromagnetics Survey Frequency-domain electromagnetic techniques are continuous wave field methods which enable the mapping of the electrical conductivity of the subsurface through electromagnetic induction.[1] View on Wikipedia Wikipedia Definition Electromagnetic induction is the production of a potential difference (voltage) across a conductor when it is exposed to a varying magnetic field. Michael Faraday is generally credited with the discovery of induction in 1831 though it may have been anticipated by the work of Francesco Zantedeschi in 1829. Around 1830 to 1832, Joseph Henry made a similar discovery, but did not publish his findings until later. Faraday's

210

Liquid Walls Innovative Concepts for First Walls and Blankets  

E-Print Network [OSTI]

rrr �= V r J r PV r B r 1P 2P g r + - V r #12;Liquid Wall Options Thickness · Thin (~ 2cm with existing technology · Size of plasma devices and power plants can be substantially reduced High Poloidal

Abdou, Mohamed

211

Magnetic-Field-Induced Assemblies of Cobalt Nanoparticles  

Science Journals Connector (OSTI)

8 Magnetic fields have also been used to create 2D assemblies of magnetic nanoparticles at the liquid?air interface9 and 1D assembled chains or 2D rings on solid substrates or TEM grids. ... A magnet (Fisher Scientific, Pittsburgh, PA) with a 0.05-Telsa magnetic field strength was placed near the side wall of the glass vial. ... The interparticle magnetic dipole?dipole couplings and the external coupling of the magnetic dipoles to the field favor linear chain growth along the magnetic-field flux lines. ...

Guangjun Cheng; Danilo Romero; Gerald T. Fraser; A. R. Hight Walker

2005-10-12T23:59:59.000Z

212

Micromagnetic modeling and analysis for memory and processing applications  

E-Print Network [OSTI]

P. (2005). Magnetic domain-wall logic. Science, 309(5741):magnetic nanostructures. Computational Materials Science,density magnetic recording media. Materials Science Forum,

Lubarda, Marko V.

2012-01-01T23:59:59.000Z

213

Magnetic Spinner  

Science Journals Connector (OSTI)

A science toy sometimes called the “magnetic spinner” is an interesting class demonstration to illustrate the principles of magnetic levitation. It can also be used to demonstrate Faraday's law and a horizontally suspended physical pendulum. The levitated part contains two circular magnets encased in a plastic housing. Each magnet stays above two triangular magnets fixed to the base. The magnetic repulsive force experienced by the circular magnets is independent of their orientation; therefore the holder of these magnets can be rotated without affecting its stability. The holder with the circular magnets can be oscillated up and down as a horizontally suspended physical pendulum.

P. J. Ouseph

2006-01-01T23:59:59.000Z

214

Magnetism Digest  

Science Journals Connector (OSTI)

... and Institute of Electrical and Electronic Engineers, on the occasion of their annual conferences on magnetism and magnetic materials in the United States, have sponsored the production of a Magnetic ... references, drawn from a large number of sources, to work in the field of magnetism and magnetic materials published in the preceding year. They therefore provide a very convenient ...

J. H. PHILLIPS

1966-06-25T23:59:59.000Z

215

Materials Science and Engineering B 120 (2005) 9194 Optical index profile at an antiparallel ferroelectric domain  

E-Print Network [OSTI]

-antisites, NbLi (which are excess Nb atoms at Li locations), and lithium vacancies denoted by VLi. The de- fect ferroelectric domain wall in lithium niobate Sungwon Kim, Venkatraman Gopalan Materials Research Institute-stoichiometric lithium niobate. This is imaged using near-field scanning optical microscopy. A detailed modeling

Gopalan, Venkatraman

216

Soft Magnetic Materials in Telecommunications  

Science Journals Connector (OSTI)

... , the subject being "Soft Magnetic Materials whose Properties are of Use or Significance in Telecommunications". The meetings were attended by about seventy people from Great Britain and the Continent ... for a few papers which dealt with aspects of the matter not generally considered by telecommunications engineers, the authors concentrated on the following main lines : theoretical consequences of domain ...

1952-05-31T23:59:59.000Z

217

Remarks on Liquid Wall Research Mohamed Abdou  

E-Print Network [OSTI]

Wall Research Advances the Science and Energy Goals of Fusion in a Perfect Fit · If we can make liquidRemarks on Liquid Wall Research Mohamed Abdou Professor Mechanical and Aerospace Engineering UCLA Note For recent presentations and papers on liquid wall research by the APEX team see website: http

Abdou, Mohamed

218

Modeling of Spherical Torus Plasmas for Liquid Lithium Wall Experiments  

SciTech Connect (OSTI)

Liquid metal walls have the potential to solve first-wall problems for fusion reactors, such as heat load and erosion of dry walls, neutron damage and activation, and tritium inventory and breeding. In the near term, such walls can serve as the basis for schemes to stabilize magnetohydrodynamic (MHD) modes. Furthermore, the low recycling characteristics of lithium walls can be used for particle control. Liquid lithium experiments have already begun in the Current Drive eXperiment-Upgrade (CDX-U). Plasmas limited with a toroidally localized limiter have been investigated, and experiments with a fully toroidal lithium limiter are in progress. A liquid surface module (LSM) has been proposed for the National Spherical Torus Experiment (NSTX). In this larger ST, plasma currents are in excess of 1 MA and a typical discharge radius is about 68 cm. The primary motivation for the LSM is particle control, and options for mounting it on the horizontal midplane or in the divertor region are under consideration. A key consideration is the magnitude of the eddy currents at the location of a liquid lithium surface. During plasma start up and disruptions, the force due to such currents and the magnetic field can force a conducting liquid off of the surface behind it. The Tokamak Simulation Code (TSC) has been used to estimate the magnitude of this effect. This program is a two dimensional, time dependent, free boundary simulation code that solves the MHD equations for an axisymmetric toroidal plasma. From calculations that match actual ST equilibria, the eddy current densities can be determined at the locations of the liquid lithium. Initial results have shown that the effects could be significant, and ways of explicitly treating toroidally local structures are under investigation.

R. Kaita; S. Jardin; B. Jones; C. Kessel; R. Majeski; J. Spaleta; R. Woolley; L. Zakharo; B. Nelson; M. Ulrickson

2002-01-29T23:59:59.000Z

219

On the structure and properties of a material deposited from arc discharge plasma near the cathode and onto vacuum-chamber walls  

Science Journals Connector (OSTI)

The structure and composition of a material (composite) deposited onto vacuum-chamber walls from arc discharge plasma during the crystallization of cathode spot products in electric and magnetic fields is studied...

N. A. Smolanov; N. A. Pankin

2014-09-01T23:59:59.000Z

220

Photon Magnetic Moment and Vacuum Magnetization in an Asymptotically Large Magnetic Field  

E-Print Network [OSTI]

We consider the effect of the photon radiative correction on the vacuum energy in a superstrong magnetic field. The notion of a photon anomalous magnetic moment is analyzed and its connection with the quasiparticle character of the electromagnetic radiation is established. In the infrared domain the magnetic moment turns out to be a vector with two orthogonal components in correspondence with the cylindrical symmetry imposed by the external field. The possibility of defining such quantity in the high energy limit is studied as well. Its existence suggests that the electromagnetic radiation is a source of magnetization to the whole vacuum and thus its electron-positron zero-point energy is slightly modified. The corresponding contribution to the vacuum magnetization density is determined by considering the individual contribution of each vacuum polarization eigenmode in the Euler-Heisenberg Lagrangian. A paramagnetic response is found in one of them, whereas the remaining ones are diamagnetic. Additional issues concerning the transverse pressures are analyzed.

Selym Villalba Chavez

2009-10-27T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Magnetism.1  

Science Journals Connector (OSTI)

... each complete magnets with a pair of poles. The general character of the earth's magnetism has long been known—that the earth behaves with regard to magnets as though it ... and that these poles have a slow secular motion. For many years the earth's magnetism has been the subject of careful study by the most powerful minds. Gauss organized ...

1890-01-16T23:59:59.000Z

222

Earth’s magnetism  

Science Journals Connector (OSTI)

Earth’s magnetism, geomagnetism, terrestrial magnetism [The magnetism of the Earth] ? Erdmagnetismus m, Geomagnetismus

2014-08-01T23:59:59.000Z

223

Simulating Acoustic Emission: the Noise of Collapsing Domains  

E-Print Network [OSTI]

,26 , magnetization measurements 27 , calorimetry 15,28 , resistivity 29,30 and capacitance measurements 31 , and optical observations 24,32 . In comparison with these techniques, AE appears to be the most popular method for the observation of intense jerks... to the same energy change. We will now analyze the elementary movements of the twinning and de-twinning processes and compare the energies with those of the yield event. A. Collapse of spanning needle domains in the horizontal direction The formation...

Salje, E.K.H.; Wang, X; Ding, X; Sun, J

2014-08-07T23:59:59.000Z

224

Magnetic study of M-type doped barium hexaferrite nanocrystalline particles  

SciTech Connect (OSTI)

Co-Ti and Ru-Ti substituted barium ferrite nanocrystalline particles BaFe{sub 12?2x}Co{sub x}Ti{sub x}O{sub 19} with (0?x?1) and BaFe{sub 12?2x}Ru{sub x}Ti{sub x}O{sub 19} with (0?x?0.6) were prepared by ball milling method, and their magnetic properties and their temperature dependencies were studied. The zero-field-cooled (ZFC) and field-cooled (FC) processes were recorded at low magnetic fields and the ZFC curves displayed a broad peak at a temperature T{sub M}. In all samples under investigation, a clear irreversibility between the ZFC and FC curves was observed below room temperature, and this irreversibility disappeared above room temperature. These results were discussed within the framework of random particle assembly model and associated with the magnetic domain wall motion. The resistivity data showed some kind of a transition from insulator to perfect insulator around T{sub M}. At 2?K, the saturation magnetization slightly decreased and the coercivity dropped dramatically with increasing the Co-Ti concentration x. With Ru-Ti substitution, the saturation magnetization showed small variations, while the coercivity decreased monotonically, recording a reduction of about 73% at x?=?0.6. These results were discussed in light of the single ion anisotropy model and the cationic distributions based on previously reported neutron diffraction data for the CoTi substituted system, and the results of our Mössbauer spectroscopy data for the RuTi substituted system.

Alsmadi, A. M., E-mail: abdel.alsmadi@ku.edu.kw [Physics Department, Kuwait University, 13060 Safat (Kuwait); Physics Department, The Hashemite University, 13115 Zarqa (Jordan); Bsoul, I. [Physics Department, Al al-Bayt University, Mafraq (Jordan); Mahmood, S. H. [Physics Department, The University of Jordan, Amman (Jordan); Alnawashi, G. [Physics Department, The Hashemite University, 13115 Zarqa (Jordan); Prokeš, K.; Siemensmeyer, K.; Klemke, B. [Helmholtz Zentrum für Matearialien und Energie, 14109 Berlin (Germany); Nakotte, H. [Physics Department, New Mexico State University, Las Cruces, New Mexico 88003 (United States)

2013-12-28T23:59:59.000Z

225

Domain assignments for FSSP representative set using DomainParser  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Domain assignments for the FSSP representative set Domain assignments for the FSSP representative set The following are the domain assignments for the FSSP representative set (released on January 31, 2000, 1987 chains in total) using DomainParser. Each line shows a PDB entry (with a chain identifier if any), total number of residues, number of domains, and domain assignments. The result is obtained fully automatically without manual editing. 12asa 327 2 (33-86; 271-288) (4-32; 87-270; 289-330) 153l 185 1 16pk 415 2 (5-205; 409-419) (206-408) 16vpa 311 2 (47-130; 164-233; 324-349) (131-163; 234-323; 395-402) 1914 171 1 19hca 292 2 (45-107) (1-44; 108-292) 1a02f 53 1 1a02j 52 1 1a02n 280 2 (399-569) (570-678) 1a04a 205 2 (5-126) (127-216) 1a0aa 63 1 1a0ca 437 1 1a0fa 201 2 (1-81) (82-201) 1a0ha 159 1 1a0i 332 2 (2-239) (240-349)

226

Inverse natural convection problem of estimating wall heat flux using a moving sensor  

SciTech Connect (OSTI)

Inverse heat transfer problems have many applications in various branch of science and engineering. Here, the inverse problem of determining heat flux at the bottom wall of a two-dimensional cavity from temperature measurement in the domain is considered. The Boussinesq equation is used to model the natural convection induced by the wall heat flux. The inverse natural convection problem is posed as a minimization problem of the performance function, which is the sum of square residuals between calculated and observed temperature, by means of a conjugate gradient method. Instead of employing several fixed sensors, a single sensor is used which is moving at a given frequency over the bottom wall. The present method solves the inverse natural convection problem accurately without a priori information about the unknown function to be estimated.

Park, H.M.; Chung, O.Y.

1999-11-01T23:59:59.000Z

227

Reentrant magnetism: New aspects  

Science Journals Connector (OSTI)

Measurements are presented of the thermoremanent and the low-field magnetizations of an amorphous (Fe78Mn22)75P16 B6Al3 and a crystalline Ni78.4Mn21.6 reentrant alloy as a function of temperatures. The data show evidence for two different blocking mechanisms responsible for the sharp drop in the familiar zero-field-cooled susceptibility below Tf. Both mechanisms are basically connected with domain-rotation effects. Our results are reasonably explained on the basis of a phenomenological free-energy model.

S. Senoussi

1985-05-01T23:59:59.000Z

228

Collaborative Networks for Biodiversity Domain Organizations  

E-Print Network [OSTI]

, conservation groups, etc., referred to in this paper as BOs (Biodiversity-domain OrganizationsCollaborative Networks for Biodiversity Domain Organizations Ekaterina Ermilova, Hamideh, operating in the domains of biology, ecology, and biodiversity, strongly need to cooperate

Boyer, Edmond

229

Identification of new functions for BRCT domains  

E-Print Network [OSTI]

Our lab identified the tandem BRCT domains of PTIP function as a DNA damage responsive phospho binding domain that recognizes proteins phosphorylated by ATM and ATR after DNA damage. The PTIP tandem BRCT domains are ...

Mohammad, Duaa H

2008-01-01T23:59:59.000Z

230

Fabrication of nanoscale magnetic domains using block-copolymer lithography  

E-Print Network [OSTI]

The tendency of PS-b-PDMS to phase separate, the tunability of the resulting morphology and the sufficient etch contrast between PS and PDMS makes the block copolymer ideal for creating patterns that can be transferred ...

Akinronbi, Babajide

2014-01-01T23:59:59.000Z

231

Panelized wall system with foam core insulation  

DOE Patents [OSTI]

A wall system includes a plurality of wall members, the wall members having a first metal panel, a second metal panel, and an insulating core between the first panel and the second panel. At least one of the first panel and the second panel include ridge portions. The insulating core can be a foam, such as a polyurethane foam. The foam can include at least one opacifier to improve the k-factor of the foam.

Kosny, Jan (Oak Ridge, TN); Gaskin, Sally (Houston, TX)

2009-10-20T23:59:59.000Z

232

First wall for polarized fusion reactors  

DOE Patents [OSTI]

Depolarization mechanisms arising from the recycling of the polarized fuel at the limiter and the first-wall of a fusion reactor are greater than those mechanisms in the plasma. Rapid depolarization of the plasma is prevented by providing a first-wall or first-wall coating formed of a low-Z, non-metallic material having a depolarization rate greater than 1 sec.sup.-1.

Greenside, Henry S. (Cranbury, NJ); Budny, Robert V. (Princeton, NJ); Post, Jr., Douglass E. (Buttonwood, CT)

1988-01-01T23:59:59.000Z

233

MMMMaaaaggggnnnneeeettttiiiicccc FFFFuuuussssiiiioooonnnn EEEEnnnneeeerrrrggggyyyy MAGNETIC FUSION ENERGY  

E-Print Network [OSTI]

· ENVIRONMENTAL ADVANTAGES - NO CARBON EMISSIONS - LOW RADIOACTIVITY · CAN'T BLOW UP, CAN'T MELT DOWN - , WIND, ETC. - MINIMAL LAND USE · Not subject to daily, seasonal or regional weather variation. - NO NEED FFFFuuuussssiiiioooonnnn EEEEnnnneeeerrrrggggyyyy Schematic of MFE Power Plant Raw Fuel WasteFuel p First Wall Magnet

234

Modeling Drilled Shafts in MSE Block Walls  

E-Print Network [OSTI]

ACKNOWLEDGEMENTS xii ABSTRACT xiii 1 INTRODUCTION 1 2 LITERATURE REVIEW 3 2.1 Physical Testing 3 2.1.1 MSE Wall Design (FHWA) 3 2.1.2 Design of Laterally Loaded Shafts 6 2.1.3 Design of Drilled Shafts Supporting Sound Walls 7 2.1.4 Topics Related to MSE... Wall Interaction with Bridges 8 2.1.5 Lateral Loading of Facing and Retained Soil 9 2.1.6 Physical Test Results 11 2.1.6.1 Construction and Instrumentation of Test Wall 12 2.1.6.2 Physical Testing and Results 17 2.2 Numerical Approaches 22 2...

Pierson, Matthew Charles

2010-09-01T23:59:59.000Z

235

Multiple moving wall dry coal extrusion pump  

DOE Patents [OSTI]

A pump for transporting particulate material includes a passageway defined on each side between an inlet and an outlet by a moving wall.

Fitzsimmons, Mark Andrew

2013-05-14T23:59:59.000Z

236

First wall for polarized fusion reactors  

DOE Patents [OSTI]

A first-wall or first-wall coating for use in a fusion reactor having polarized fuel may be formed of a low-Z non-metallic material having slow spin relaxation, i.e., a depolarization rate greater than 1 sec/sup -1/. Materials having these properties include hydrogenated and deuterated amorphous semiconductors. A method for preventing the rapid depolarization of a polarized plasma in a fusion device may comprise the step of providing a first-wall or first-wall coating formed of a low-Z, non-metallic material having a depolarization rate greater than 1 sec/sup -1/.

Greenside, H.S.; Budny, R.V.; Post, D.E. Jr.

1985-01-29T23:59:59.000Z

237

Modern Magnetism  

Science Journals Connector (OSTI)

... BATES‘S "Modern Magnetism", first published in 1939, is widely appreciated as a general survey in which ... grateful to the author for collecting together so much interesting information about recent work in magnetism. ...

E. C. S.

1948-06-05T23:59:59.000Z

238

Direct observation of field and temperature induced domain replication in dipolar coupled perpendicular anisotropy films  

Science Journals Connector (OSTI)

Dipolar interactions in a soft/Pd/hard [CoNi/Pd]30/Pd/[Co/Pd]20 multilayer system, where a thick Pd layer between two ferromagnetic units prevents direct exchange coupling, are directly revealed by combining magnetometry and state-of-the-art layer resolving soft x-ray imaging techniques with sub-100-nm spatial resolution. The domains forming in the soft layer during external magnetic field reversal are found to match the domains previously trapped in the hard layer. The low Curie temperature of the soft layer allows varying its intrinsic parameters via temperature and thus studying the competition with dipolar fields due to the domains in the hard layer. Micromagnetic simulations elucidate the role of [CoNi/Pd] magnetization, exchange, and anisotropy in the duplication process. Finally, thermally driven domain replication in remanence during temperature cycling is demonstrated.

T. Hauet; C. M. Günther; B. Pfau; M. E. Schabes; J.-U. Thiele; R. L. Rick; P. Fischer; S. Eisebitt; O. Hellwig

2008-05-19T23:59:59.000Z

239

Beetle Kill Wall at NREL  

ScienceCinema (OSTI)

When it comes to designing an interior decorative feature for one of the most energy efficient office buildings in the world, very few would consider bringing in a beetle to do the job. But thats what happened at the U.S. Department of Energy's (DOE) Research Support Facility (RSF) located on the National Renewable Energy Laboratory (NREL) campus.In June, the RSF will become home to more than 800 workers from DOE and NREL and building visitors will be greeted with a soaring, two-story high wall entirely covered with wood harvested from the bark beetle infestation that has killed millions of pine trees in the Western U.S. But, the use of beetle kill wood is just one example of the resources being leveraged to make the RSF a model for sustainability and one more step toward NRELs goal to be a net zero energy campus.

None

2013-05-29T23:59:59.000Z

240

Virtual gap dielectric wall accelerator  

DOE Patents [OSTI]

A virtual, moving accelerating gap is formed along an insulating tube in a dielectric wall accelerator (DWA) by locally controlling the conductivity of the tube. Localized voltage concentration is thus achieved by sequential activation of a variable resistive tube or stalk down the axis of an inductive voltage adder, producing a "virtual" traveling wave along the tube. The tube conductivity can be controlled at a desired location, which can be moved at a desired rate, by light illumination, or by photoconductive switches, or by other means. As a result, an impressed voltage along the tube appears predominantly over a local region, the virtual gap. By making the length of the tube large in comparison to the virtual gap length, the effective gain of the accelerator can be made very large.

Caporaso, George James; Chen, Yu-Jiuan; Nelson, Scott; Sullivan, Jim; Hawkins, Steven A

2013-11-05T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Migratory magnetism  

Science Journals Connector (OSTI)

... in tune with the Earth's magnetic field. But how, exactly, do creatures sense magnetism? This is one of the most intriguing questions in modern biology - and also ... move preferentially in a north-south direction. This finding hints at the possible influence of magnetism on their movements. ...

Henry Gee

1999-10-06T23:59:59.000Z

242

Magnetic-compression/magnetized-target fusion (MAGO/MTF): A marriage of inertial and magnetic confinement  

SciTech Connect (OSTI)

Intermediate between magnetic confinement (MFE) and inertial confinement (ICF) in time and density scales is an area of research now known in the US as magnetized target fusion (MTF) and in Russian as MAGO (MAGnitnoye Obzhatiye--magnetic compression). MAGO/MTF uses a magnetic field and preheated, wall-confined plasma fusion fuel within an implodable fusion target. The magnetic field suppresses thermal conduction losses in the fuel during the target implosion and hydrodynamic compression heating process. In contrast to direct, hydrodynamic compression of initially ambient-temperature fuel (i.e., ICF), MAGO/MTF involves two steps: (a) formation of a warm (e.g., 100 eV or higher), magnetized (e.g., 100 kG) plasma within a fusion target prior to implosion; (b) subsequent quasi-adiabatic compression by an imploding pusher, of which a magnetically driven imploding liner is one example. In this paper, the authors present ongoing activities and potential future activities in this relatively unexplored area of controlled thermonuclear fusion.

Lindemuth, I.R.; Ekdahl, C.A.; Kirkpatrick, R.C. [and others

1996-12-31T23:59:59.000Z

243

Cellulose Binding Domains of a Phytophthora Cell Wall Protein Are Novel Pathogen-Associated Molecular Patterns  

Science Journals Connector (OSTI)

...except after heat treatment of the medium (Meindl...and neutralized by dialysis against 100 volumes of water at 4C for 16 h...strain GV3101 by electroporation, and transformed...et al. (1980). Electron Microscopy and Immunogold...

Elodie Gaulin; Nani Dramé; Claude Lafitte; Trudy Torto-Alalibo; Yves Martinez; Carine Ameline-Torregrosa; Moustafa Khatib; Honoré Mazarguil; François Villalba-Mateos; Sophien Kamoun; Christian Mazars; Bernard Dumas; Arnaud Bottin; Marie-Thérèse Esquerré-Tugayé; Martina Rickauer

2006-06-09T23:59:59.000Z

244

Microscopic and Macroscopic Signatures of Antiferromagnetic Domain Walls R. Jaramillo,1  

E-Print Network [OSTI]

. Rosenbaum,1,* E. D. Isaacs,2 O. G. Shpyrko,2 P. G. Evans,3 G. Aeppli,4 and Z. Cai5 1 The James Franck

Evans, Paul G.

245

Thermoelectric Effect across the Metal-Insulator Domain Walls in VO2  

E-Print Network [OSTI]

-performance thermoelectric materials are currently one of the focuses in materials research for energy conversion technologies.1-4 A good thermoelectric material should have a relatively high thermopower (Seebeck coefficient perpendicular to the current and heat flow direction. This offers a material platform where the thermoelectric

Wu, Junqiao

246

Fabrication of curved-line nanostructures on membranes for transmission electron microscopy investigations of domain walls  

E-Print Network [OSTI]

Fabrication of curved-line nanostructures on membranes for transmission electron microscopy, Cambridge CB2 3QZ, United Kingdom Available online 28 February 2006 Abstract We have fabricated curved-line ferromagnetic nanostructures on membranes for transmission electron microscopy investigations of the equilibrium

Dunin-Borkowski, Rafal E.

247

DWM-TAPESTRI - an energy efficient all-spin cache using domain wall shift based writes  

Science Journals Connector (OSTI)

Spin-based memories are promising candidates for future on-chip memories due to their high density, non-volatility, and very low leakage. However, the high energy and latency of write operations in these memories is a major challenge. In this work, we ...

Rangharajan Venkatesan; Mrigank Sharad; Kaushik Roy; Anand Raghunathan

2013-03-01T23:59:59.000Z

248

Magnetic Testing of Bonded Magnets  

Science Journals Connector (OSTI)

Many techniques exist to characterize the magnetic properties of bonded magnets. We will review the common and not so common techniques in use, with emphasis on the advantages and disadvantages of each one, an...

S. R. Trout

2003-01-01T23:59:59.000Z

249

Remarks on Liquid Wall Research Mohamed Abdou  

E-Print Network [OSTI]

Remarks on Liquid Wall Research Mohamed Abdou Professor Mechanical and Aerospace Engineering UCLA physicists and engineering scientists · Enhances synergism between IFE and MFE · Provides excellent disciplines. #12;Several "Ideas" Have Been Proposed for Liquid Walls Fluids 1) High-conductivity, low Pr

California at Los Angeles, University of

250

Flow and Heat Transfer of a MHD Viscoelastic Fluid in a Channel with Stretching Walls: Some Applications to Haemodynamics  

E-Print Network [OSTI]

Of concern in the paper is a study of steady incompressible viscoelastic and electrically conducting fluid flow and heat transfer in a parallel plate channel with stretching walls in the presence of a magnetic field applied externally. The flow is considered to be governed by Walter's liquid B fluid. The problem is solved by developing a suitable numerical method. The results are found to be in good agrement with those of earlier investigations reported in existing scientific literatures. The study reveals that a back flow occurs near the central line of the channel due to the stretching walls and further that this flow reversal can be stopped by applying a strong external magnetic field. The study also shows that with the increase in the strength of the magnetic field, the fluid velocity decreases but the temperature increases. Thus the study bears potential applications in the study of the haemodynamic flow of blood in the cardiovascular system when subjected to an external magnetic field.

Misra, J C; Rath, H J

2010-01-01T23:59:59.000Z

251

Wall System Innovations: Familiar Materials, Better Performance  

Broader source: Energy.gov (indexed) [DOE]

1 1 Wall System Innovation Vladimir Kochkin Joseph Wiehagen April 2013 Wall Innovation Metrics  High R (thermal and air barrier)  High Performance  Durable, structural  Build-able  Low transition risk to builders  50% Building America Goal  ≈ R25+ (CZ 4 and higher) 2 Background  Technologies for high-R walls have been proposed and used for over 25 years  But real market penetration is very low  Often the last EE measure implemented by builders (e.g. E*) 3 Background  High-R wall solutions have not achieved a broad level of standardization and commonality  A large set of methods and materials entered the market  Multiple and conflicting details  Wall characteristics are more critical = RISK 4 New Home Starts -

252

FREE CONVECTIVE LAMINAR FLOW WITHIN THE TROMBE WALL CHANNEL  

E-Print Network [OSTI]

LAMINAR FLOW WITHIN THE TROMBE WALL CHANNEL H. Akbarf andLAMINAR FLOW WITHIN THE TROMBE WALL CHANNEL H. Akbari andchannel surfaces of the Trombe wall has been investigated.

Akbari, H.

2011-01-01T23:59:59.000Z

253

Spontaneous phase transitions in magnetic films with a modulated structure  

SciTech Connect (OSTI)

The influence of monoperiodic and biperiodic bias fields on the nucleation of domain structures in quasi-uniaxial magnetic films near the Curie point has been studied experimentally. The main types of observed nonuniform magnetic moment distributions have been established and chains of a devil's staircase phase transitions are shown to be realized when the films are slowly cooled.

Arzamastseva, G. V.; Evtikhov, M. G.; Lisovskii, F. V., E-mail: lisf@rambler.ru; Mansvetova, E. G. [Russian Academy of Sciences, Kotelnikov Institute of Radio Engineering and Electronics, Fryazino Branch (Russian Federation)

2011-09-15T23:59:59.000Z

254

Non-algebraic quadrature domains  

E-Print Network [OSTI]

May 28, 2012 ... “Quadrature domain in the classical sense” is used to specify the restricted case we ...... monotonically” on ?. 4. The procedure used in the proof of Theorem 3.1 can also be used to ... Royal Inst. of Technology, Stockholm.

2012-05-28T23:59:59.000Z

255

Making recommendations from multiple domains  

Science Journals Connector (OSTI)

Given the vast amount of information on the World Wide Web, recommender systems are increasingly being used to help filter irrelevant data and suggest information that would interest users. Traditional systems make recommendations based on a single domain ... Keywords: collaborative filtering, personalization, recommendation, social trust

Wei Chen; Wynne Hsu; Mong Li Lee

2013-08-01T23:59:59.000Z

256

Strange Magnetism  

E-Print Network [OSTI]

We present an analytic and parameter-free expression for the momentum dependence of the strange magnetic form factor of the nucleon and its corresponding radius which has been derived in Heavy Baryon Chiral Perturbation Theory. We also discuss a model-independent relation between the isoscalar magnetic and the strange magnetic form factors of the nucleon based on chiral symmetry and SU(3) only. These limites are used to derive bounds on the strange magnetic moment of the proton from the recent measurement by the SAMPLE collaboration.

Thomas R. Hemmert; Ulf-G. Meissner; Sven Steininger

1998-11-09T23:59:59.000Z

257

Optical Magnetism  

Science Journals Connector (OSTI)

Magnetic dipole radiation one fourth as intense as electric dipole radiation, as well as a novel nonlinear magneto-optical effect are reported in dielectric media.

Oliveira, Samuel L; Rand, Stephen C

258

Magnetic Field Safety Magnetic Field Safety  

E-Print Network [OSTI]

Magnetic Field Safety Training #12;Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain medical conditions such as pacemakers, magnetic implants, or embedded shrapnel. In addition, high magnetic

McQuade, D. Tyler

259

Hydrogenation of single-walled carbon nanotubes  

E-Print Network [OSTI]

Towards the development of a useful mechanism for hydrogen storage, we have studied the hydrogenation of single-walled carbon nanotubes with atomic hydrogen using core-level photoelectron spectroscopy and x-ray absorption spectroscopy. We find that atomic hydrogen creates C-H bonds with the carbon atoms in the nanotube walls and such C-H bonds can be com-pletely broken by heating to 600 oC. We demonstrate approximately 65+/-15 at % hydrogenation of carbon atoms in the single-walled carbon nanotubes which is equivalent to 5.1+/-1.2 weight % hydrogen capacity. We also show that the hydrogenation is a reversible process.

Anton Nikitin; Hirohito Ogasawara; David Mann; Reinhard Denecke; Zhiyong Zhang; Hongjie Dai; KJ Cho; Anders Nilsson

2005-10-14T23:59:59.000Z

260

Magnetic Field Safety Training  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Safety Training Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain...

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

The logic behind thick, liquid-walled, fusion concepts  

SciTech Connect (OSTI)

It may be possible to surround the region where fusion reactions are taking place with a neutronically thick liquid blanket which has penetrations that allow only a few tenths of a percent of the neutrons to leak out. Even these neutrons can be attenuated by adding an accurately placed liquid or solid near the target to shadow-shield the beam ports from line-of-sight neutrons. The logic of such designs are discussed and their evolution is described with examples applied to both magnetic and inertial fusion (HYLIFE-II). These designs with liquid protection are self healing when exposed to pulsed loading and have a number of advantages-over the usual designs with solid first walls. For example, the liquid-protected solid components will last the life of the plant, and therefore the capacity factor is estimated to be approximately 10% higher than for the non-liquid-walled blankets, because no blanket replacement shutdowns are required. The component replacement, operations, and maintenance costs might be half the usual value because no blanket change-out costs or accompanying facilities are required. These combined savings might lower the cost of electricity by 20%. Nuclear-grade construction should not be needed, largely because the liquid attenuates neutrons and results in less activation of materials. Upon decommissioning, the reactor materials should qualify for disposal by shallow burial even when constructed of ordinary 304 stainless steel. The need for a high-intensity 14-MeV neutron test facility to develop first-wall materials is avoided or greatly reduced, saving billions of development dollars. Flowing molten Li, the molten salt Flibe (Li{sub 2}BeF{sub 4}), and molten Li{sub l7}Pb{sub 83} have been considered. An advantage of molten salt is that it will not burn and has a low tritium solubility and therefore low tritium inventory.

Moir, R.W.

1994-04-15T23:59:59.000Z

262

Symmetry of single-wall nanotubes  

Science Journals Connector (OSTI)

A review of the symmetry groups of the various single-wall nano- and microtubes considered in the literature (BN, GaN, MS2, C, BC3, BC2N) is presented.

Damnjanovic, M.

2001-04-27T23:59:59.000Z

263

Nonextensive statistical dynamics applied to wall turbulence  

E-Print Network [OSTI]

We apply a formalism of nonextensive statistical mechanics to experimental wall turbulence data, for the first time to our knowledge. Wind tunnel data for velocity differences a streamwise distance $r$ apart are compared to the prediction from theory as developed by Beck. The simplest theory, in which all free parameters are removed, is found to reproduce statistics for the wall-normal velocity component remarkably well, even for $r$ well beyond the corresponding integral scale, while the corresponding description of the streamwise velocity fluctuations is reasonable at separations below the integral scale. A least-squares 2-parameter fit is performed, and the dependence of the optimum parameter values on wall separation and $r$ is analysed. Both parameters are found to be approximately independent of wall-separation in the logarithmic sub-layer.

Simen Å Ellingsen; Per-Åge Krogstad

2014-02-10T23:59:59.000Z

264

Beautify Your Windows and Glass Walls.  

E-Print Network [OSTI]

-utside? How do your dqkrie outside of your house? 2 IlnKY color affect , Coloor, De~kn and Tex When choosing draperies to har- monize with a room, consider the room, proportions, exposure, view, walls, floors, furnishings, accessories...

Tompkins, Charlotte

1961-01-01T23:59:59.000Z

265

In situ Groundwater Remediation Using Treatment Walls  

Science Journals Connector (OSTI)

Development of treatment wall technology for the clean up of contaminated ground-water resources has expanded in the past few...ex situ and other in situ ground-water remediation approaches is reduced operation a...

Radisav D. Vidic; Frederick G. Pohland

2002-01-01T23:59:59.000Z

266

CLIMBING WALL POLICIES Open Bouldering Policies  

E-Print Network [OSTI]

. Climb at your own risk. Supervised Climbing Rules: 1. All climbers must check in at the climbing wall a munter knot and/or a figure eight belay device are not acceptable ways to belay. 11. Shirts and close

267

Magnetic insulation  

Science Journals Connector (OSTI)

... by Winterberg1, led me to look into the background of the idea of 'magnetic insulation'. The purpose of this letter is to point out that the scheme described in ... were presented earlier in a longer article2. In that article he suggested that 'magnetic insulation' might make possible a transformer for 109 V. A year later the same objections ...

JOHN P. BLEWETT

1974-06-28T23:59:59.000Z

268

Magnetism1  

Science Journals Connector (OSTI)

... is reached, the rate of diminution becomes very rapid indeed, until, finally, the magnetism of the iron disappears at the same time as for small forces. Instead of ... a lower maximum, and its rise is less rapid. The critical temperature at which magnetism disappears changes rapidly with the composition of the steel. For very soft charcoal iron ...

1890-01-23T23:59:59.000Z

269

Magnetism Group  

Science Journals Connector (OSTI)

... of the Institute of Physics and the Physical Society has announced the establishment of a Magnetism Group. The aim of the new Group is to further interest in ... Group. The aim of the new Group is to further interest in magnetism by holding regular discussion meetings and in other ways. It is intended that these ...

1965-09-04T23:59:59.000Z

270

Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... A similar investigation of the effect of the moon's action on terrestrial magnetism requires a series of observations made at much less distant intervals than the monthly ones ... heat, from the central body of our system, or merely having its own inherent magnetism modified by solar action, then we must choose as our unit the lunation, or ...

1873-01-09T23:59:59.000Z

271

Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... IN bringing before you this evening, gentlemen, the subject of terrestrial magnetism, it is not my intention to attempt to present you with an exhaustive paper ... clearly as I am able, what is the actual condition of our knowledge respecting the magnetism of the globe, and what the nature of its complex variations, without, however, ...

1873-01-02T23:59:59.000Z

272

Terrestrial Magnetism  

Science Journals Connector (OSTI)

... THE present activity of the department of terrestrial magnetism of the Carnegie Institution of Washington and the largeness of its future aims are alike ... a “progress report” which he contributes to the latest (March) number of Terrestrial Magnetism. The department, which has lately entered on its eleventh year, has under construetion ...

C. CHREE

1914-07-23T23:59:59.000Z

273

Remanent Magnetism  

Science Journals Connector (OSTI)

... STUDY of the natural remanent magnetism of rocks is becoming a familiar method for determining the direction of the Earth's ... the geomagnetic poles or of the continents themselves. An alternative use for measurements of remanent magnetism, namely, the determination of the temperature of formation of pyroclastic deposits, is described ...

1958-03-22T23:59:59.000Z

274

Superconducting Magnets  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mit Hilfe der Technologie supraleitender Magnete lassen sich in Mit Hilfe der Technologie supraleitender Magnete lassen sich in Ringbeschleunigern höhere Energien erreichen. Weil supraleitende Spulen keinen elektrischen Widerstand aufweisen, können damit stärkere Magnetfelder erzeugt werden. In normal leitenden Elektromagneten wird - wegen des elektrischen Widerstands der Drähte - die Spule aufgeheizt. Auf diese Weise geht sehr viel Energie in Form von Wärme verloren, was die Energiekosten dieser Magnete in die Höhe treibt. Supraleitende Spulen erlauben es, Magnete grosser Feldstärke unter günstigen Bedingungen zu betreiben und damit die Energiekosten zu senken. Durch den Einbau supraleitender Spulen in den Ringbeschleuniger von Fermilab konnte dessen Energie verdoppelt werden.Auch der im Bau befindliche "Large Hadron Collider" am CERN wird supraleitende Magnete

275

Magnetic nanotubes  

DOE Patents [OSTI]

A magnetic nanotube includes bacterial magnetic nanocrystals contacted onto a nanotube which absorbs the nanocrystals. The nanocrystals are contacted on at least one surface of the nanotube. A method of fabricating a magnetic nanotube includes synthesizing the bacterial magnetic nanocrystals, which have an outer layer of proteins. A nanotube provided is capable of absorbing the nanocrystals and contacting the nanotube with the nanocrystals. The nanotube is preferably a peptide bolaamphiphile. A nanotube solution and a nanocrystal solution including a buffer and a concentration of nanocrystals are mixed. The concentration of nanocrystals is optimized, resulting in a nanocrystal to nanotube ratio for which bacterial magnetic nanocrystals are immobilized on at least one surface of the nanotubes. The ratio controls whether the nanocrystals bind only to the interior or to the exterior surfaces of the nanotubes. Uses include cell manipulation and separation, biological assay, enzyme recovery, and biosensors.

Matsui, Hiroshi (Glen Rock, NJ); Matsunaga, Tadashi (Tokyo, JP)

2010-11-16T23:59:59.000Z

276

Rock magnetism of remagnetized carbonate rocks: another look MIKE JACKSON* & NICHOLAS L. SWANSON-HYSELL  

E-Print Network [OSTI]

Rock magnetism of remagnetized carbonate rocks: another look MIKE JACKSON* & NICHOLAS L. SWANSON-HYSELL Institute for Rock Magnetism, Winchell School of Earth Sciences, University of Minnesota, Minnesota, US, dominantly in the super- paramagnetic and stable single-domain size range, also give rise to distinctive rock-magnetic

Swanson-Hysell, Nicholas

277

How to Run DomainParser  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Run DomainParser Run DomainParser The structure for partition needs to be prepared in the PDB format. In most cases, running DomainParser using defaults should give satisfactory partitions. However, several options offered in DomainParser can provide a partition that a user desires or correct some overcut/undercut partitions. Here, we use a PDB file 1atna.pdb as an example to show how to use the DomainParser program. Run DomainParser using defaults: domainparser 1atna.pdb The output shows the partition for each domain in terms of ranges of residue numbers: 4 domains have been found for 1atna: Domain 1 : 34-96. Domain 2 : 181-272. Domain 3 : 148-180; 273-336. Domain 4 : 0-33; 97-147; 337-372. The program also generates a new file 1atna_dom.pdb, with the "temperature factor" column (column 61-66 of an "ATOM" entry) showing domain numbers. A

278

Magnetoresistance of single-domain ferromagnetic particles J. Aumentado and V. Chandrasekhara)  

E-Print Network [OSTI]

on single-domain, submicron elliptical Ni particles using nonmagnetic probes in a four-probe geometry as experimental techniques improve to the point where it is possible to observe the magnetization dynamics and lift-off techniques in two steps. In the first step, the elliptical particles were patterned

Chandrasekhar, Venkat

279

Performance Assessment Report Domain CHP System  

E-Print Network [OSTI]

Performance Assessment Report for the Domain CHP System November 2005 By Burns & McDonnell Engineering #12;Domain CHP System Performance Assessment Report for the Packaged Cooling, Heating and Power

Oak Ridge National Laboratory

280

15 FUNCTIONAL SERVICE DOMAIN ARCHITECTURE MANAGEMENT  

E-Print Network [OSTI]

. Based on a better understanding of functional domain architecture management approaches, situational, enterprise architecture management, situational method engineering #12;258 Part 5: Design Science 115 FUNCTIONAL SERVICE DOMAIN ARCHITECTURE MANAGEMENT: Building the Foundation for Situational

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Language Modeling for limited-data domains  

E-Print Network [OSTI]

With the increasing focus of speech recognition and natural language processing applications on domains with limited amount of in-domain training data, enhanced system performance often relies on approaches involving model ...

Hsu, Bo-June (Bo-June Paul)

2009-01-01T23:59:59.000Z

282

Frequency domain design of interval controller  

E-Print Network [OSTI]

significant role in the analysis and design of interval systems. Its external properties are also discussed. The image set approach & frequency domain criteria can be used to calculate the IP stability margin. The frequency domain criteria are used...

Park, Wunyong

1993-01-01T23:59:59.000Z

283

Linear chain magnetism  

Science Journals Connector (OSTI)

Linear chain magnetism ... A brief introduction to this concept, which is also called lower dimensional magnetism. ...

Richard L. Carlin

1991-01-01T23:59:59.000Z

284

Labelling Heuristics for CSP Application Domains  

E-Print Network [OSTI]

Labelling Heuristics for CSP Application Domains Zeynep K#16;z#16;ltan Computer Science Division an application domain as a family of CSP models, so as to exhibit the generic constraint store for all models store and the domain propagation during search is analysed, so as to infer | before modelling any CSP

Rossi, Francesca

285

Low dimensional magnetism  

E-Print Network [OSTI]

Magnetism in Ultracold Gases 4 Magnetic phase diagram of aMagnetism . . . . . . . . . . . .1.3 Magnetism in condensedIntroduction 1 Brief introduction to magnetism 1.1 Classic

Kjall, Jonas Alexander

2012-01-01T23:59:59.000Z

286

Magnetic Viscosity  

Science Journals Connector (OSTI)

1 January 1893 research-article Magnetic Viscosity J. Hopkinson E. Wilson F. Lydall The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Proceedings of the Royal Society of London. www.jstor.org

1893-01-01T23:59:59.000Z

287

Rock magnetism  

Science Journals Connector (OSTI)

The past three decades have witnessed a new paradigm, the plate tectonics paradigm, in Earth sciences. The record of the Earth's magnetic field stored in rocks played a major role in the establishment of this par...

Ronald T. Merrill

1989-01-01T23:59:59.000Z

288

Learning About Magnets!  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a force that can "attract" or "repel" other magnets and magnetic materials, like iron or nickel. What is a Magnet? This bar magnet is a permanent magnet. Permanent magnets can be found in the Earth as rocks and metals. Magnets have

289

Identification of Novel Cell Wall Components  

SciTech Connect (OSTI)

Our DOE Biosciences-funded work focused on the fungal cell wall and morphogenesis. We are especially interested in how new cell wall material is targeted to appropriate areas for polar (asymmetric) growth. Polar growth is the only way that filamentous fungi explore the environment to find suitable substrates to degrade. Work funded by this grant has resulted in a total of twenty peer-reviewed publications. In work funded by this grant, we identified nine Aspergillus nidulans temperature-sensitive (ts) mutants that fail to send out a germ tube and show a swollen cell phenotype at restrictive temperature, the swo mutants. In other organisms, a swollen cell phenotype is often associated with misdirected growth or weakened cell walls. Our work shows that several of the A. nidulans swo mutants have defects in the establishment and maintenance of polarity. Cloning of several swo genes by complementation also showed that secondary modification of proteins seems is important in polarity. We also investigated cell wall biosynthesis and branching based on leads in literature from other organisms and found that branching and nuclear division are tied and that the cell wall reorganizes during development. In our most recent work we have focused on gene expression during the shift from isotropic to polar growth. Surprisingly we found that genes previously thought to be involved only in spore formation are important in early vegetative growth as well.

Michelle Momany

2009-10-26T23:59:59.000Z

290

Control of linear modes in cylindrical resistive magnetohydrodynamics with a resistive wall, plasma rotation, and complex gain  

SciTech Connect (OSTI)

Feedback stabilization of magnetohydrodynamic (MHD) modes in a tokamak is studied in a cylindrical model with a resistive wall, plasma resistivity, viscosity, and toroidal rotation. The control is based on a linear combination of the normal and tangential components of the magnetic field just inside the resistive wall. The feedback includes complex gain, for both the normal and for the tangential components, and it is known that the imaginary part of the feedback for the former is equivalent to plasma rotation [J. M. Finn and L. Chacon, Phys. Plasmas 11, 1866 (2004)]. The work includes (1) analysis with a reduced resistive MHD model for a tokamak with finite ? and with stepfunction current density and pressure profiles, and (2) computations with a full compressible visco-resistive MHD model with smooth decreasing profiles of current density and pressure. The equilibria are stable for ??=?0 and the marginal stability values ?{sub rp,rw}?wall; resistive plasma, ideal wall; ideal plasma, resistive wall; and ideal plasma, ideal wall) are computed for both models. The main results are: (a) imaginary gain with normal sensors or plasma rotation stabilizes below ?{sub rp,iw} because rotation suppresses the diffusion of flux from the plasma out through the wall and, more surprisingly, (b) rotation or imaginary gain with normal sensors destabilizes above ?{sub rp,iw} because it prevents the feedback flux from entering the plasma through the resistive wall to form a virtual wall. A method of using complex gain G{sub i} to optimize in the presence of rotation in this regime with ??>??{sub rp,iw} is presented. The effect of imaginary gain with tangential sensors is more complicated but essentially destabilizes above and below ?{sub rp,iw}.

Brennan, D. P. [Department of Astrophysical Sciences, Princeton University, Princeton, New Jersey 08544 (United States); Finn, J. M. [Applied Mathematics and Plasma Physics, Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

2014-10-15T23:59:59.000Z

291

Word Domain Disambiguation via Word Sense Disambiguation  

SciTech Connect (OSTI)

Word subject domains have been widely used to improve the perform-ance of word sense disambiguation al-gorithms. However, comparatively little effort has been devoted so far to the disambiguation of word subject do-mains. The few existing approaches have focused on the development of al-gorithms specific to word domain dis-ambiguation. In this paper we explore an alternative approach where word domain disambiguation is achieved via word sense disambiguation. Our study shows that this approach yields very strong results, suggesting that word domain disambiguation can be ad-dressed in terms of word sense disam-biguation with no need for special purpose algorithms.

Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.

2006-06-04T23:59:59.000Z

292

WallBots: Interactive Wall-Crawling Robots In the Hands of Public Artists and Political Activists  

E-Print Network [OSTI]

WallBots: Interactive Wall-Crawling Robots In the Hands of Public Artists and Political Activists present WallBots- autonomous, wall-crawling robots as a research probe for public expression across a wide, street art INTRODUCTION "People look at an oil painting and admire the use of brushstrokes to convey

Paulos, Eric

293

Controlling Magnetism at the Nanoscale  

E-Print Network [OSTI]

Manipulation of Magnetism - External148 Conclusion A The Magnetism Cheat Sheet A.1 Magnetic157 A.2 Magnetism Unit Conversion

Wong, Jared

2012-01-01T23:59:59.000Z

294

Time-dependent Maxwell field operators and field energy density for an atom near a conducting wall  

E-Print Network [OSTI]

We consider the time evolution of the electric and magnetic field operators for a two-level atom, interacting with the electromagnetic field, placed near an infinite perfectly conducting wall. We solve iteratively the Heisenberg equations for the field operators and obtain the electric and magnetic energy density operators around the atom (valid for any initial state). Then we explicitly evaluate them for an initial state with the atom in its bare ground state and the field in the vacuum state. We show that the results can be physically interpreted as the superposition of the fields propagating directly from the atom and the fields reflected on the wall. Relativistic causality in the field propagation is discussed. Finally we apply these results to the calculation of the dynamical Casimir-Polder interaction energy in the far zone between two atoms when a boundary condition such as a conducting wall is present. Magnetic contributions to the interatomic Casimir-Polder interaction in the presence of the wall are also considered. We show that, in the limit of large times, the known results of the stationary case are recovered.

R. Vasile; R. Messina; R. Passante

2009-03-18T23:59:59.000Z

295

living walls | OpenEI Community  

Open Energy Info (EERE)

14 14 Varnish cache server Home Groups Community Central Green Button Applications Developer Utility Rate FRED: FRee Energy Database More Public Groups Private Groups Features Groups Blog posts Content Stream Documents Discussions Polls Q & A Events Notices My stuff Energy blogs 429 Throttled (bot load) Error 429 Throttled (bot load) Throttled (bot load) Guru Meditation: XID: 2142229614 Varnish cache server living walls Home Dc's picture Submitted by Dc(15) Member 15 November, 2013 - 13:26 Living Walls ancient building system architect biomimicry building technology cooling cu daylight design problem energy use engineer fred andreas geothermal green building heat transfer heating living walls metabolic adjustment net zero pre-electricity Renewable Energy Solar university of colorado utility grid Wind

296

Living Walls | OpenEI Community  

Open Energy Info (EERE)

Living Walls Living Walls Home > Groups > Buildings Dc's picture Submitted by Dc(15) Member 15 November, 2013 - 13:26 ancient building system architect biomimicry building technology cooling cu daylight design problem energy use engineer fred andreas geothermal green building heat transfer heating living walls metabolic adjustment net zero pre-electricity Renewable Energy Solar university of colorado utility grid Wind Much of the discussion surrounding green buildings centers around reducing energy use. The term net zero is the platinum standard for green buildings, meaning the building in question does not take any more energy from the utility grid than it produces using renewable energy resources, such as solar, wind, or geothermal installations (and sometimes these renewable energy resources actually feed energy back to the utility grid). Architects

297

Atomistic modeling of diffusion coefficient in fusion reactor first wall material tungsten  

Science Journals Connector (OSTI)

Abstract Tungsten is remarkable for its robustness, especially it has the highest melting point of all the non–alloyed metals. Metallic material tungsten and tungsten alloys have been widely used in aerospace, weapon, nuclear industries and fusion reactor. Tungsten is expected to be the fusion reactor first wall material for this reason. In this paper, self-diffusion coefficients of metallic material tungsten have been investigated via molecular dynamics simulation method using the modified embedded atom potential model. Diffusion activation energy of tungsten can be gotten according to Arrhenius relation between the self-diffusion coefficients simulation results and temperatures. The dipole interaction model is introduced to analyze metallic material tungsten self-diffusion process in a uniform magnetic field. The strong magnetic field increases diffusion activation energy by 34.52% and limits self-diffusion coefficient by 1.15% in 2 T uniform magnetic field.

Zenghui Wang; Kaixuan Zhao; Weiming Chen; Xiaodi Chen; Longyan Zhang

2014-01-01T23:59:59.000Z

298

Neutrino magnetic moment in a magnetized plasma  

E-Print Network [OSTI]

The contribution of a magnetized plasma to the neutrino magnetic moment is calculated. It is shown that only part of the additional neutrino energy in magnetized plasma connecting with its spin and magnetic field strength defines the neutrino magnetic moment. It is found that the presence of magnetized plasma does not lead to the considerable increase of the neutrino magnetic moment in contrast to the results presented in literature previously.

N. V. Mikheev; E. N. Narynskaya

2010-11-08T23:59:59.000Z

299

Cell Wall Recipe: A Lesson on Biofuels  

K-12 Energy Lesson Plans and Activities Web site (EERE)

Students will investigate how changes in the DNA sequence that codes for cell wall formation can have a favorable outcome in producing plants that have higher levels of cellulose than the parent plant. The cellulose yield is most important in the production of ethanol: the greater the amount of cellulose within the cell wall, the greater the amount of ethanol that can be produced. To engage students, the first part of this lesson has students participating in a discovery activity where they will extract DNA from wheat germ.

300

Domain formation on oxidized graphene  

Science Journals Connector (OSTI)

Using first-principles calculations within density functional theory, we demonstrate that the adsorption of a single oxygen atom results in significant electron transfer from graphene to oxygen. This strongly disturbs the charge landscape of the C-C bonds at the proximity. Additional oxygen atoms adsorbing to graphene prefer always the C-C bonds having the highest charge density and, consequently, they have the tendency to form domain structure. While oxygen adsorption to one side of graphene ends with significant buckling, the adsorption to both sides with similar domain pattern is favored. The binding energy displays an oscillatory variation and the band gap widens with increasing oxygen coverage. While a single oxygen atom migrates over the C-C bonds on the graphene surface, a repulsive interaction prevents two oxygen adatoms from forming an oxygen molecule. Our first-principles study together with finite-temperature ab initio molecular dynamics calculations conclude that oxygen adatoms on graphene can not desorb easily without the influence of external agents.

M. Topsakal and S. Ciraci

2012-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Questions and Answers - Why is a non-permanent, but long lasting, magnet  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Which jobs use electromagnets? Which jobs use electromagnets? Previous Question (Which jobs use electromagnets?) Questions and Answers Main Index Next Question (Can you turn something into a magnet by banging on it in a specific way?) Can you turn something into a magnetby banging on it in a specific way? Why is a non-permanent, but long lasting, magnet called a permanent magnet? Permanent magnets are magnets that you don't have to use energy to make them magnetic. Some types of permanent magnets, relative to the length of lives of humans, are pretty close to permanent. They decay slowly, but they do decay. When most of the magnetic domains in a material align in one direction you can call that a magnet. It helps if you can imagine a magnet as being made up of a bunch of little magnets. Each one has tiny North and

302

REVIEW OF SCIENTIFIC INSTRUMENTS 84, 063502 (2013) In situ "artificial plasma" calibration of tokamak magnetic sensors  

E-Print Network [OSTI]

of tokamak magnetic sensors D. Shiraki,1 J. P. Levesque,1 J. Bialek,1 P. J. Byrne,1 B. A. DeBono,1 M. E the effects of eddy currents in the nearby conducting wall. The spatial positions of these sensors of the magnetic fields produced by the various coils to solve for each sensor's position. Since the calibration

Mauel, Michael E.

303

Damage production and accumulation in SiC structures in inertial and magnetic fusion systems  

E-Print Network [OSTI]

Damage production and accumulation in SiC structures in inertial and magnetic fusion systems M wall in an IFE system is $10% lower than in an MFE system, while gas production and burnup rates magnetic (MFE) and inertial (IFE) confinement fusion systems. Variations in the geometry, neutron energy

Ghoniem, Nasr M.

304

Study of permanent-magnet couplings with progressive magnetization using an analytical formulation  

SciTech Connect (OSTI)

Permanent-magnet (PM) magnetic couplings are used in many industrial applications. They allow the transmission of a torque from a rotating part to another rotating part without any mechanical contact. They are used in sealed equipment to transmit a movement through a separation wall. They are also very useful in high security applications to avoid failures due to torque overload. Nonclassical structures of permanent-magnet cylindrical air-gap couplings with progressive magnetization are studied. In these couplings, parallelepiped magnets with nonclassical magnetization direction are used and stuck in ironless cores. The magnetization direction of each magnet is chosen to provide an optimal repartition of the induction in the air gap. This progressive magnetization allows very high values of pullout torque. The use of this type of structure with ironless cores and very high pull-out torque seems to be an advantageous way to minimize the inertia and maximize the pullout torque of a magnetic coupling. An efficient method to calculate the torque of such a coupling is presented, based on analytical formulas for forces between magnets. It allows the exact evaluation of the performance of the studied couplings when the main dimensions of the coupling are varying with small calculation time. In this paper the influence of the number of pole pairs, the influence of the number of magnets per pole, the influence of the magnets' thickness, the influence of the air-gap radius, and the influence of the length of the structure are studied and discussed. Then some general rules are presented for efficient design of such a coupling.

Charpentier, J.F.; Lemarquand, G.

1999-09-01T23:59:59.000Z

305

Ionic field effect and memristive phenomena in single-point ferroelectric domain switching  

SciTech Connect (OSTI)

Electric field induced polarization switching underpins most functional applications of ferroelectric materials in information technology, materials science, and optoelectronics. In the last 20 years, much attention has been focused on the switching of individual domains using scanning probe microscopy, both as model of ferroelectric data storage and approach to explore fundamental physics of ferroelectric switching. The classical picture of tip induced switching includes formation of cylindrical domain oriented along the tip field, with the domain size is largely determined by the tip-induced field distribution and domain wall motion kinetics. The polarization screening is recognized as a necessary precondition to the stability of ferroelectric phase; however, screening processes are generally considered to be uniformly efficient and not leading to changes in switching behavior. Here, we demonstrate that single-point tip-induced polarization switching can give rise to a surprisingly broad range of domain morphologies, including radial and angular instabilities. These behaviors are traced to the surface screening charge dynamics, which in some cases can even give rise to anomalous switching against the electric field (ionic field effect). The implications of these behaviors for ferroelectric materials and devices are discussed.

Ievlev, Anton [ORNL] [ORNL; Morozovska, A. N. [National Academy of Science of Ukraine, Kiev, Ukraine] [National Academy of Science of Ukraine, Kiev, Ukraine; Eliseev, E. A. [National Academy of Science of Ukraine, Kiev, Ukraine] [National Academy of Science of Ukraine, Kiev, Ukraine; Shur, Vladimir Ya. [Ural Federal University, Russia] [Ural Federal University, Russia; Kalinin, Sergei V [ORNL] [ORNL

2014-01-01T23:59:59.000Z

306

Petroglyphs, Lighting, and Magnetism  

E-Print Network [OSTI]

1950 Electricity and Magnetism: Theory and Applications.I Petroglyphs, Lightning, and Magnetism | Walker Figure 8.I Petroglyphs, Lightning, and Magnetism | Walker Figure IL

Walker, Merle F

2007-01-01T23:59:59.000Z

307

Hot wire production of single-wall and multi-wall carbon nanotubes  

DOE Patents [OSTI]

Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

Dillon, Anne C. (Boulder, CO); Mahan, Archie H. (Golden, CO); Alleman, Jeffrey L. (Lakewood, CO)

2010-10-26T23:59:59.000Z

308

ACTIVE FEEDBACK STABILZATION OF THE RESISTIVE WALL MODE ON THE DIII-D DEVICE  

SciTech Connect (OSTI)

A proof of principle magnetic feedback stabilization experiment has been carried out to suppress the resistive wall mode (RWM), a branch of the ideal magnetohydrodynamic (MHD) kink mode under the influence of a stabilizing resistive wall, on the DIII-D tokamak device [Plasma Phys. and Contr. Fusion Research (International Atomic Energy Agency, Vienna, 1986), p. 159]. The RWM was successfully suppressed and the high beta duration above the no wall limit was extended to more than 50 times the resistive wall flux diffusion time. It was observed that the mode structure was well preserved during the time of the feedback application. Several lumped parameter formulations were used to study the feedback process. The observed feedback characteristics are in good qualitative agreement with the analysis. These results provide encouragement to future efforts towards optimizing the RWM feedback methodology in parallel to what has been successfully developed for the n = 0 vertical positional control. Newly developed MHD codes have been extremely useful in guiding the experiments and in providing possible paths for the next step.

M. OKABAYASHI; J. BIALEK; M.S. CHANCE; M.S. CHU; E.D. FREDRICKSON; A.M. GAROFALO; M. GRYAZNEVICH; R.E HATCHER; T.H. JENSEN; L.C. JOHNSON; R.J. LA HAYE; E,A. LAZARUS; M.A. MAKOWSKI; J. MANICKAM; G.A. NAVRATIL; J.T. SCOVILLE; E.J. STRAIT; A.D. TURNBULL; M.L. WALKER

2000-11-01T23:59:59.000Z

309

THE CHINESE WALL LATTICE Ravi Sandhu  

E-Print Network [OSTI]

security policy for confidentiality · Mixture of free choice (discretionary) and mandatory of interest class #12;4 CHINESE WALL EXAMPLE BANKS OIL COMPANIESBANKS OIL COMPANIES A B X Y #12;5 READ ACCESS BREWER-NASH SIMPLE SECURITY S can read O only if · O is in the same company dataset as· O is in the same

Sandhu, Ravi

310

Symmetry groups of single-wall nanotubes  

Science Journals Connector (OSTI)

An approach to the determination of the symmetry groups of structural analogs of single-wall carbon nanotubes using ideas in color symmetry theory is described. The line group structures of the symmetry groups of BN, BC3, BCN and BC2N nanotubes are identified. An extension of the method to address nanotubes with non-hexagonal symmetry is also presented.

De Las Pe?as, M.L.A.N.

2013-11-26T23:59:59.000Z

311

Annual Report Diana H. Wall, Director  

E-Print Network [OSTI]

Student Sustainability Center more than doubled its student engagement, and our pre-college Summer2013-2014 Annual Report #12;Diana H. Wall, Director CSU is at the forefront of sustainability if such systems are to endure, and developing the expertise that is needed to shape a sustainable future

312

Wall Precursor Effects in Gaseous Detonation  

Science Journals Connector (OSTI)

... and 5 mm long, were used in an investigation of electrical phenomena in stoichiometric oxyhydrogen detonations produced in a 4 m long stainless steel tube of hexagonal cross-section. The ... , which was insulated from the tube wall, recorded the time of arrival of the detonation plasma at the plane of observation. Only when both the probes and insulating surfaces ...

M. C. CAVENOR

1970-02-21T23:59:59.000Z

313

Subcooled Boiling Near a Heated Wall  

SciTech Connect (OSTI)

Experimental measurements of void fraction, bubble frequency, and velocity are obtained in subcooled R-134a flowing over a heated flat plate near an unheated wall and compared to analytical predictions. The measurements were obtained for a fixed system pressure and mass flow rate (P = 2.4 MPa and w = 106 kg/hr) at various inlet liquid temperatures. During the experiments, electrical power was applied at a constant rate to one side of the test section. The local void fraction data, acquired with a hot-film anemometer probe, showed the existence of a significant peak near the heated wall and a smaller secondary peak near the unheated wall for the larger inlet subcoolings. Local vapor velocity data, taken with the hot-film probe and a laser Doppler velocimeter, showed broad maxima near the centerline between the heated and unheated plates. Significant temperature gradients near the heated wall were observed for large inlet subcooling. Bubble size data, inferred from measurements of void fraction, bubble frequency and vapor velocity, when combined with the measured bubble chord length distributions illustrate the transition from pure three dimensional spherical to two-dimensional planar bubble flow, the latter being initiated when the bubbles fill the gap between the plates. These various two-phase flow measurements were used for development of a multidimensional, four-field calculational method; comparisons of the data to the calculations show reasonable agreement.

T.A. Trabold; C.C. Maneri; P.F. Vassallo; D.M. Considine

2000-10-27T23:59:59.000Z

314

Design of wetted wall bioaerosol concentration cyclones  

E-Print Network [OSTI]

...................................................................................... 24 Aerosol-to-aerosol collection efficiency.................................................... 24 Wetting pattern on the impacting wall ? effect of an atomizer.................. 24..................................................................................... 67 Figure 3.4. Cold temperature experiemental setup ........................................................... 68 Figure 3.5. Preliminary heating system for the 1250 L/min cyclone and thermo-couple locations...

Seo, Youngjin

2009-05-15T23:59:59.000Z

315

Whirlpools on the Nanoscale Could Multiply Magnetic Memory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Whirlpools on the Nanoscale Could Whirlpools on the Nanoscale Could Multiply Magnetic Memory Whirlpools on the Nanoscale Could Multiply Magnetic Memory Print Tuesday, 21 May 2013 00:00 Research at the Advanced Light Source may lead to four-bit magnetic cells housed on nanoscale metal disks, instead of the two-bit magnetic domains of standard magnetic memories. In magnetic vortices, parallel electron spins point either clockwise or counterclockwise, while in their crowded centers the spins point either down or up. "From the scientist's point of view, magnetism is about controlling electron spin," says Peter Fischer of the Materials Sciences Division, who leads the work at beamline 6.1.2. Four orientations could provide multibits in a new kind of memory. The next step is to control the states independently and simultaneously.

316

Magnetic dipole discharges. I. Basic properties  

SciTech Connect (OSTI)

A simple discharge is described which uses a permanent magnet as a cold cathode and the metallic chamber wall as an anode. The magnet's equator is biased strongly negative, which produces secondary electrons due to the impact of energetic ions. The emitted electrons are highly confined by the strong dipolar magnetic field and the negative potential in the equatorial plane of the magnet. The emitted electrons ionize near the sheath and produce further electrons, which drift across field lines to the anode while the nearly unmagnetized ions are accelerated back to the magnet. A steady state discharge is maintained at neutral pressures above 10{sup ?3} mbar. This is the principle of magnetron discharges, which commonly use cylindrical and planar cathodes rather than magnetic dipoles as cathodes. The discharge properties have been investigated in steady state and pulsed mode. Different magnets and geometries have been employed. The role of a background plasma has been investigated. Various types of instabilities have been observed such as sheath oscillations, current-driven turbulence, relaxation instabilities due to ionization, and high frequency oscillations created by sputtering impulses, which are described in more detail in companion papers. The discharge has also been operated in reactive gases and shown to be useful for sputtering applications.

Stenzel, R. L.; Urrutia, J. M. [Department of Physics and Astronomy, University of California, Los Angeles, California 90095-1547 (United States)] [Department of Physics and Astronomy, University of California, Los Angeles, California 90095-1547 (United States); Teodorescu-Soare, C. T.; Ionita, C.; Schrittwieser, R. [Institute for Ion Physics and Applied Physics, University of Innsbruck, A-6020 Innsbruck (Austria)] [Institute for Ion Physics and Applied Physics, University of Innsbruck, A-6020 Innsbruck (Austria)

2013-08-15T23:59:59.000Z

317

Magnetic Catalysis vs Magnetic Inhibition  

E-Print Network [OSTI]

We discuss the fate of chiral symmetry in an extremely strong magnetic field B. We investigate not only quark fluctuations but also neutral meson effects. The former would enhance the chiral-symmetry breaking at finite B according to the Magnetic Catalysis, while the latter would suppress the chiral condensate once B exceeds the scale of the hadron structure. Using a chiral model we demonstrate how neutral mesons are subject to the dimensional reduction and the low dimensionality favors the chiral-symmetric phase. We point out that this effect, the Magnetic Inhibition, can be a feasible explanation for recent lattice-QCD data indicating the decreasing behavior of the chiral-restoration temperature with increasing B.

Kenji Fukushima; Yoshimasa Hidaka

2012-09-06T23:59:59.000Z

318

Magnetic Stereoscopy  

E-Print Network [OSTI]

The space mission STEREO will provide images from two viewpoints. An important aim of the STEREO mission is to get a 3D view of the solar corona. We develop a program for the stereoscopic reconstruction of 3D coronal loops from images taken with the two STEREO spacecraft. A pure geometric triangulation of coronal features leads to ambiguities because the dilute plasma emissions complicates the association of features in image 1 with features in image 2. As a consequence of these problems the stereoscopic reconstruction is not unique and multiple solutions occur. We demonstrate how these ambiguities can be resolved with the help of different coronal magnetic field models (potential, linear and non-linear force-free fields). The idea is that, due to the high conductivity in the coronal plasma, the emitting plasma outlines the magnetic field lines. Consequently the 3D coronal magnetic field provides a proxy for the stereoscopy which allows to eliminate inconsistent configurations. The combination of stereoscopy and magnetic modelling is more powerful than one of these tools alone. We test our method with the help of a model active region and plan to apply it to the solar case as soon as STEREO data become available.

Thomas Wiegelmann; Bernd Inhester

2006-12-21T23:59:59.000Z

319

NATIONAL PLAN TO ACHIEVE MARITIME DOMAIN AWARENESS  

E-Print Network [OSTI]

infrastructure following attack or similar disruption. · Maritime Transportation System Security Plan responds regarding the maritime domain. · Maritime Commerce Security Plan establishes a comprehensive plan to secure

Acton, Scott

320

Development of Nonlinear SSI Time Domain Methodology  

Broader source: Energy.gov [DOE]

Development of Nonlinear SSI Time Domain Methodology Justin Coleman, P.E. Nuclear Science and Technology Idaho National Laboratory October 22, 2014

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Standard guide for mutual inductance bridge applications for wall thickness determinations in boiler tubing  

E-Print Network [OSTI]

1.1 This guide describes a procedure for obtaining relative wall thickness indications in ferromagnetic and non-ferromagnetic steels using the mutual inductance bridge method. The procedure is intended for use with instruments capable of inducing two substantially identical magnetic fields and noting the change in inductance resulting from differing amounts of steel. It is used to distinguish acceptable wall thickness conditions from those which could place tubular vessels or piping at risk of bursting under high temperature and pressure conditions. 1.2 This guide is intended to satisfy two general needs for users of industrial Mutual Inductance Bridge (MIB) equipment: (1) the need for a tutorial guide addressing the general principles of Mutual Inductance Bridges as they apply to industrial piping; and (2) the need for a consistent set of MIB performance parameter definitions, including how these performance parameters relate to MIB system specifications. Potential users and buyers, as well as experienced M...

American Society for Testing and Materials. Philadelphia

2010-01-01T23:59:59.000Z

322

Stabilization of the resistive wall mode instability by trapped energetic particles  

SciTech Connect (OSTI)

A theoretical model for investigating the effect of the trapped energetic particles (EPs) on the resistive wall mode (RWM) instability is proposed. The results demonstrate that the trapped EPs have a dramatic stabilizing effect on the RWM because of resonant interaction between the mode and the magnetic precession drift motion of the trapped EPs. The results also show that the effect of the trapped EPs depends on the wall position. In addition, the stabilizing effect becomes stronger when the plasma rotation is taken into account. For sufficiently fast plasma rotation, the trapped EPs can lead to the complete stabilization of the RWM. Furthermore, the trapped EPs can induce a finite real frequency of the RWM in the absence of plasma rotation.

Hao, G. Z.; Wang, A. K.; Jiang, H. B.; Lu, Gaimin; He, H. D.; Qiu, X. M. [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041 (China); Liu, Y. Q. [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom)

2011-03-15T23:59:59.000Z

323

Progress on a Cavity with Beryllium Walls for Muon Ionization Cooling Channel R&D.  

SciTech Connect (OSTI)

The Muon Accelerator Program (MAP) collaboration is working to develop an ionization cooling channel for muon beams. An ionization cooling channel requires the operation of high-gradient, normal-conducting RF cavities in multi-Tesla solenoidal magnetic fields. However, experiments conducted at Fermilab?s MuCool Test Area (MTA) show that increasing the solenoidal field strength reduces the maximum achievable cavity gradient. This gradient limit is characterized by an RF breakdown process that has caused significant damage to copper cavity interiors. The damage may be caused by field-emitted electrons, focused by the solenoidal magnetic field onto small areas of the inner cavity surface. Local heating may then induce material fatigue and surface damage. Fabricating a cavity with beryllium walls would mitigate this damage due to beryllium?s low density, low thermal expansion, and high electrical and thermal conductivity. We address the design and fabrication of a pillbox RF cavity with beryllium walls, in order to evaluate the performance of high-gradient cavities in strong magnetic fields.

Bowring, D.L.; DeMello, A.J.; Lambert, A.R.; Li, D.; Virostek,, S.; Zisman, M.; Kaplan, D.; Palmer, R.B.

2012-05-20T23:59:59.000Z

324

TBU-0061- In the Matter of Misti Wall  

Broader source: Energy.gov [DOE]

Misti Wall (the complainant or Wall), appeals the dismissal of her complaint of retaliation filed under 10 C.F.R. Part 708, the Department of Energy (DOE) Contractor Employee Protection Program. As...

325

Double Diffusion in Enclosure Bounded by Massive and Volatilizing Walls  

E-Print Network [OSTI]

-10), are considered. Other governing parameters are maintained constant (Rayleigh number, Prandtl number, Lewis number and width ratio of massive wall to enclosure). The conjugate heat transfer of the thick wall and indoor airflow and the enhanced heat transfer...

Liu, D.; Tang, G.; Zhao, F.

2006-01-01T23:59:59.000Z

326

Helium Pumping Wall for a Liquid Lithium Tokamak Richard Majeski...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Helium Pumping Wall for a Liquid Lithium Tokamak Richard Majeski This invention is designed to be a subsystem of a device, a tokamak with walls or plasma facing components of...

327

After Exodus : re-occupation of the metropolitan wall  

E-Print Network [OSTI]

The title "Exodus alludes to a restricted exclave encircled by a forbidding wall -- effect, a prison on the scale of a metropolis, and one in which people sought refuge voluntarily. Over the past forty years, similar walls ...

Allison, Jordan Lloyd Norman

2012-01-01T23:59:59.000Z

328

Toroidal magnetic detector for high resolution measurement of muon momenta  

DOE Patents [OSTI]

A muon detector system including central and end air-core superconducting toroids and muon detectors enclosing a central calorimeter/detector. Muon detectors are positioned outside of toroids and all muon trajectory measurements are made in a nonmagnetic environment. Internal support for each magnet structure is provided by sheets, located at frequent and regularly spaced azimuthal planes, which interconnect the structural walls of the toroidal magnets. In a preferred embodiment, the shape of the toroidal magnet volume is adjusted to provide constant resolution over a wide range of rapidity. 4 figs.

Bonanos, P.

1992-01-07T23:59:59.000Z

329

Toroidal magnetic detector for high resolution measurement of muon momenta  

DOE Patents [OSTI]

A muon detector system including central and end air-core superconducting toroids and muon detectors enclosing a central calorimeter/detector. Muon detectors are positioned outside of toroids and all muon trajectory measurements are made in a nonmagnetic environment. Internal support for each magnet structure is provided by sheets, located at frequent and regularly spaced azimuthal planes, which interconnect the structural walls of the toroidal magnets. In a preferred embodiment, the shape of the toroidal magnet volume is adjusted to provide constant resolution over a wide range of rapidity.

Bonanos, Peter (East Brunswick, NJ)

1992-01-01T23:59:59.000Z

330

Reading the Cosmic Writing on the Wall  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Reading the Cosmic Reading the Cosmic Writing on the Wall Reading the Cosmic Writing on the Wall NERSC Key to Planck's Revision of Universal Recipe March 21, 2013 Contact: Margie Wylie, mwylie@lbl.gov, + 1 510 486 7421 map800-600.jpg This map shows the oldest light in our universe, as detected with the greatest precision yet by the Planck mission. The ancient light, called the cosmic microwave background, was imprinted on the sky when the universe was 370,000 years old. (Image credit: ESA and the Planck Collaboration) Thanks to a supersensitive space telescope and some sophisticated supercomputing, scientists from the international Planck collaboration have made the closest reading yet of the most ancient story in our universe: the cosmic microwave background (CMB). Today, the team released preliminary results based on the Planck

331

Gravitational infall in the hard wall model  

E-Print Network [OSTI]

An infalling shell in the hard wall model provides a simple holographic model for energy injection in a confining gauge theory. Depending on its parameters, a scalar shell either collapses into a large black brane, or scatters between the hard wall and the anti-de Sitter boundary. In the scattering regime, we find numerical solutions that keep oscillating for as long as we have followed their evolution, and we provide an analytic argument that shows that a black brane can never be formed. This provides examples of states in infinite-volume field theory that never thermalize. We find that the field theory expectation value of a scalar operator keeps oscillating, with an amplitude that undergoes modulation.

B. Craps; E. J. Lindgren; A. Taliotis; J. Vanhoof; H. Zhang

2014-12-15T23:59:59.000Z

332

Enhanced dielectric-wall linear accelerator  

DOE Patents [OSTI]

A dielectric-wall linear accelerator is enhanced by a high-voltage, fast e-time switch that includes a pair of electrodes between which are laminated alternating layers of isolated conductors and insulators. A high voltage is placed between the electrodes sufficient to stress the voltage breakdown of the insulator on command. A light trigger, such as a laser, is focused along at least one line along the edge surface of the laminated alternating layers of isolated conductors and insulators extending between the electrodes. The laser is energized to initiate a surface breakdown by a fluence of photons, thus causing the electrical switch to close very promptly. Such insulators and lasers are incorporated in a dielectric wall linear accelerator with Blumlein modules, and phasing is controlled by adjusting the length of fiber optic cables that carry the laser light to the insulator surface. 6 figs.

Sampayan, S.E.; Caporaso, G.J.; Kirbie, H.C.

1998-09-22T23:59:59.000Z

333

Wall, Pennsylvania: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Wall, Pennsylvania: Energy Resources Wall, Pennsylvania: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 40.3936801°, -79.7861577° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.3936801,"lon":-79.7861577,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

334

Manipulation and Imaging of Individual Single-Walled Carbon Nanotubes  

E-Print Network [OSTI]

Manipulation and Imaging of Individual Single-Walled Carbon Nanotubes with an Atomic Force Microscope** By Henk W. C. Postma, Allard Sellmeijer, and Cees Dekker* Carbon nanotubes[1] have attracted-walled nanotubes,[3±5] the prototype single-walled tubes are much more difficult to study since their diameter

335

Proposal on Lithium Wall Experiment (LWX) on PBXM 1  

E-Print Network [OSTI]

Proposal on Lithium Wall Experiment (LWX) on PBX­M 1 Leonid E. Zakharov, Princeton University; OUTLINE 1. Mini­conference on Lithium walls and low recycling regime. 2. PBX­M Capabilities. 3. Motivation "Lithium covered walls and low recycling regimes in toka­ maks". APS meeting, October 23­27, 2000, Quebec

Zakharov, Leonid E.

336

Particle Sizing using Passive Ultrasonic Measurement of Vessel Wall Vibrations  

E-Print Network [OSTI]

Particle Sizing using Passive Ultrasonic Measurement of Vessel Wall Vibrations Gillian Carson for particle sizing using an ultrasonic transducer to measure vessel wall vibrations and 1 #12;considers in a stirred vessel, its subse- quent impact with the vessel wall, and the resulting flexural vibrations

Mottram, Nigel

337

The Abstract Domain of Segmented Ranking Functions  

E-Print Network [OSTI]

function by abstract in- terpretation. We build our work on their proposed general framework, and we designThe Abstract Domain of Segmented Ranking Functions Caterina Urban ´Ecole Normale Sup´erieure - CNRS - INRIA, Paris, France urban@di.ens.fr Abstract. We present a parameterized abstract domain for proving

Paris-Sud XI, Université de

338

Brick Walls and AdS/CFT  

E-Print Network [OSTI]

We discuss the relationship between the bulk-boundary correspondence in Rehren's algebraic holography (and in other 'fixed-background' approaches to holography) and in mainstream 'Maldacena AdS/CFT'. Especially, we contrast the understanding of black-hole entropy from the viewpoint of QFT in curved spacetime -- in the framework of 't Hooft's 'brick wall' model -- with the understanding based on Maldacena AdS/CFT. We show that the brick-wall modification of a Klein Gordon field in the Hartle-Hawking-Israel state on 1+2-Schwarzschild AdS (BTZ) has a well-defined boundary limit with the same temperature and entropy as the brick-wall-modified bulk theory. One of our main purposes is to point out a close connection, for general AdS/CFT situations, between the puzzle raised by Arnsdorf and Smolin regarding the relationship between Rehren's algebraic holography and mainstream AdS/CFT and the puzzle embodied in the 'correspondence principle' proposed by Mukohyama and Israel in their work on the brick-wall approach to black hole entropy. Working on the assumption that similar results will hold for bulk QFT other than the Klein Gordon field and for Schwarzschild AdS in other dimensions, and recalling the first author's proposed resolution to the Mukohyama-Israel puzzle based on his 'matter-gravity entanglement hypothesis', we argue that, in Maldacena AdS/CFT, the algebra of the boundary CFT is isomorphic only to a proper subalgebra of the bulk algebra, albeit (at non-zero temperature) the (GNS) Hilbert spaces of bulk and boundary theories are still the 'same' -- the total bulk state being pure, while the boundary state is mixed (thermal). We also argue from the finiteness of its boundary (and hence, on our assumptions, also bulk) entropy at finite temperature, that the Rehren dual of the Maldacena boundary CFT cannot itself be a QFT and must, instead, presumably be something like a string theory.

Bernard S. Kay; L. Ortiz

2014-05-22T23:59:59.000Z

339

1993 NEC 1) (Single-Walled Carbon  

E-Print Network [OSTI]

MWNT (Vapor-grown carbon fiber, VGCF)33) 10001300 34) SWNT CCVD Smalley 15) CO SWNT SWNT 1993 NEC 1) (Single-Walled Carbon Nanotubes, SWNTs) 1(a) 1nm µm µm SWNTs 2) (MWNTs) 1(c 29,30,35-41) SWNT , MgO Fe/Co, Ni/Co, Mo/Co nm SWNT VGCF Fe(CO)5 SWNT Ethanol tank Hot

Maruyama, Shigeo

340

magnets2  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

II II Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Phenomenology of Wall Bounded Newtonian Turbulence  

E-Print Network [OSTI]

We construct a simple analytic model for wall-bounded turbulence, containing only four adjustable parameters. Two of these parameters characterize the viscous dissipation of the components of the Reynolds stress-tensor and other two parameters characterize their nonlinear relaxation. The model offers an analytic description of the profiles of the mean velocity and the correlation functions of velocity fluctuations in the entire boundary region, from the viscous sub-layer, through the buffer layer and further into the log-layer. As a first approximation, we employ the traditional return-to-isotropy hypothesis, which yields a very simple distribution of the turbulent kinetic energy between the velocity components in the log-layer: the streamwise component contains a half of the total energy whereas the wall-normal and the cross-stream components contain a quarter each. In addition, the model predicts a very simple relation between the von-K\\'arm\\'an slope $\\kappa $ and the turbulent velocity in the log-law region $v^+$ (in wall units): $v^+=6 \\kappa$. These predictions are in excellent agreement with DNS data and with recent laboratory experiments.

Victor S. L'vov; Anna Pomyalov; Itamar Procaccia; Sergej S. Zilitinkevich

2005-06-28T23:59:59.000Z

342

Slow Dynamics of Orbital Domains in Manganite  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Slow Dynamics of Orbital Domains in Manganite Print Slow Dynamics of Orbital Domains in Manganite Print At the ALS, an international team of researchers has used low-energy coherent x rays to extract new knowledge about the correlated motion of groups of self-assembled, outer-lying electrons in the extremely complex electronic system found in manganites. The manganite family of materials has puzzled physicists for years by defying standard models for the motion of electrons in crystals. By controlling the properties of the incident x rays, the researchers were able to map the complexity of a "half-doped" manganite into a far-field speckle diffraction pattern to study the manganite's domain dynamics. Their results suggest the material undergoes a transition characterized by the competition between a pinned orbital domain topology that remains static and mobile domain boundaries that exhibit slow, temporal fluctuations.

343

Slow Dynamics of Orbital Domains in Manganite  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Slow Dynamics of Orbital Domains in Manganite Print Slow Dynamics of Orbital Domains in Manganite Print At the ALS, an international team of researchers has used low-energy coherent x rays to extract new knowledge about the correlated motion of groups of self-assembled, outer-lying electrons in the extremely complex electronic system found in manganites. The manganite family of materials has puzzled physicists for years by defying standard models for the motion of electrons in crystals. By controlling the properties of the incident x rays, the researchers were able to map the complexity of a "half-doped" manganite into a far-field speckle diffraction pattern to study the manganite's domain dynamics. Their results suggest the material undergoes a transition characterized by the competition between a pinned orbital domain topology that remains static and mobile domain boundaries that exhibit slow, temporal fluctuations.

344

Slow Dynamics of Orbital Domains in Manganite  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Slow Dynamics of Orbital Domains in Manganite Print Slow Dynamics of Orbital Domains in Manganite Print At the ALS, an international team of researchers has used low-energy coherent x rays to extract new knowledge about the correlated motion of groups of self-assembled, outer-lying electrons in the extremely complex electronic system found in manganites. The manganite family of materials has puzzled physicists for years by defying standard models for the motion of electrons in crystals. By controlling the properties of the incident x rays, the researchers were able to map the complexity of a "half-doped" manganite into a far-field speckle diffraction pattern to study the manganite's domain dynamics. Their results suggest the material undergoes a transition characterized by the competition between a pinned orbital domain topology that remains static and mobile domain boundaries that exhibit slow, temporal fluctuations.

345

Magnetic Reconnection  

SciTech Connect (OSTI)

We review the fundamental physics of magnetic reconnection in laboratory and space plasmas, by discussing results from theory, numerical simulations, observations from space satellites, and the recent results from laboratory plasma experiments. After a brief review of the well-known early work, we discuss representative recent experimental and theoretical work and attempt to interpret the essence of significant modern findings. In the area of local reconnection physics, many significant findings have been made with regard to two- uid physics and are related to the cause of fast reconnection. Profiles of the neutral sheet, Hall currents, and the effects of guide field, collisions, and micro-turbulence are discussed to understand the fundamental processes in a local reconnection layer both in space and laboratory plasmas. While the understanding of the global reconnection dynamics is less developed, notable findings have been made on this issue through detailed documentation of magnetic self-organization phenomena in fusion plasmas. Application of magnetic reconnection physics to astrophysical plasmas is also brie y discussed.

Masaaki Yamada, Russell Kulsrud and Hantao Ji

2009-09-17T23:59:59.000Z

346

Protective interior wall and attach8ing means for a fusion reactor vacuum vessel  

DOE Patents [OSTI]

An array of connected plates mounted on the inside wall of the vacuum vessel of a magnetic confinement reactor in order to provide a protective surface for energy deposition inside the vessel. All fasteners are concealed and protected beneath the plates, while the plates themselves share common mounting points. The entire array is installed with torqued nuts on threaded studs; provision also exists for thermal expansion by mounting each plate with two of its four mounts captured in an oversize grooved spool. A spool-washer mounting hardware allows one edge of a protective plate to be torqued while the other side remains loose, by simply inverting the spool-washer hardware.

Phelps, Richard D. (Greeley, CO); Upham, Gerald A. (Valley Center, CA); Anderson, Paul M. (San Diego, CA)

1988-01-01T23:59:59.000Z

347

Fluorescent Single-Walled Carbon Nanotube Aerogels in Surfactant-free Environments  

Science Journals Connector (OSTI)

†Physical Chemistry and Applied Spectroscopy Group, Chemistry Division, ‡Center for Integrated Nanotechnologies, Materials Physics and Applications Division, §Polymers and Coatings Group, Materials Science and Technology Division, and ?National High Magnetic Field Laboratory, Los Alamos National Laboratory, Los Alamos New Mexico 87545, United States ... single-walled carbon nanotube; fluorescence; surfactant-free; silica aerogel; nanocomposite; low-temperature ... Thus, during gelation the silica precursor molecules can penetrate the SDS assembly more readily than the DOC coating resulting in weaker PL intensities for the SDS-suspended tubes in contrast to DOC-wrapped tubes. ...

Juan G. Duque; Christopher E. Hamilton; Gautam Gupta; Scott A. Crooker; Jared. J. Crochet; Aditya Mohite; Han Htoon; Kimberly A. DeFriend Obrey; Andrew M. Dattelbaum; Stephen K. Doorn

2011-07-26T23:59:59.000Z

348

A Study of the Filling of Wall Cavities With Retrofit Wall Insulation.  

SciTech Connect (OSTI)

The Pacific Northwest Power Marketing Agency, the Bonneville Power Administration (BPA), conducted a retrofit wall insulation study to determine the effects of various obstructions within a wall cavity, where voids are likely to occur, and preferred filling methods and material types. The insulation test structure was composed of four 8-foot /times/ 12-foot walls, and was built using standard construction practices. The inside walls were clear plastic glazing, instead of gypsum board, to enable viewing of the filling process. A total of eight tests were performed: four cellulose, two rockwool, and two fiberglass. One- and two-hole filling methods were observed. All insulations were found to perform in the same basic manner with all experiencing the same problem areas. Common installer problems were empty spaces at the tops of cavities and missed cavities, especially above headers. Wiring and lath and plaster consistently caused reduced insulation densities in cavities. The problems with wiring, lath and plaster, and other features in the wall cavities were avoided with the use of a filler tube. The filler tube also provided a more consistent fill along the length of the entire cavity. 2 figs., 3 tabs.

Flores, Joseph A.; Grill, Alan R.

1988-08-01T23:59:59.000Z

349

Effect of elasticity of wall on diffusion in nano channel  

SciTech Connect (OSTI)

Confining walls of nano channel are taken to be elastic to study their effect on the diffusion coefficient of fluid flowing through the channel. The wall is elastic to the extent that it responses to molecular pressure exerted by fluid. The model to study diffusion is based on microscopic considerations. Results obtained for fluid confining to 20 atomic diameter width contrasted with results obtained by considering rigid and smooth wall. The effect of roughness of wall on diffusion can be compensated by the elastic property of wall.

Tankeshwar, K., E-mail: tankesh@pu.ac.in [Computer Centre, Panjab University Chandigarh,- 160014 (India); Srivastava, Sunita [Department of Physics, Panjab University, Chandigarh 160014 (India)

2014-04-24T23:59:59.000Z

350

Structures of Domains I and IV from YbbR are Representative of a Widely Distributed Protein Family  

SciTech Connect (OSTI)

YbbR domains are widespread throughout Eubacteria and are expressed as monomeric units, linked in tandem repeats or cotranslated with other domains. Although the precise role of these domains remains undefined, the location of the multiple YbbR domain-encoding ybbR gene in the Bacillus subtilis glmM operon and its previous identification as a substrate for a surfactin-type phosphopantetheinyl transferase suggests a role in cell growth, division, and virulence. To further characterize the YbbR domains, structures of two of the four domains (I and IV) from the YbbR-like protein of Desulfitobacterium hafniense Y51 were solved by solution nuclear magnetic resonance and X-ray crystallography. The structures show the domains to have nearly identical topologies despite a low amino acid identity (23%). The topology is dominated by {beta}-strands, roughly following a 'figure 8' pattern with some strands coiling around the domain perimeter and others crossing the center. A similar topology is found in the C-terminal domain of two stress-responsive bacterial ribosomal proteins, TL5 and L25. Based on these models, a structurally guided amino acid alignment identifies features of the YbbR domains that are not evident from naive amino acid sequence alignments. A structurally conserved cis-proline (cis-Pro) residue was identified in both domains, though the local structure in the immediate vicinities surrounding this residue differed between the two models. The conservation and location of this cis-Pro, plus anchoring Val residues, suggest this motif may be significant to protein function.

A Barb; J Cort; J Seetharaman; S Lew; H Lee; T Acton; L Tong; G Montelione; J Prestegard; et al.

2011-12-31T23:59:59.000Z

351

Method of non-destructively inspecting a curved wall portion  

DOE Patents [OSTI]

A method of non-destructively inspecting a curved wall portion of a large and thick walled vessel for a defect by computed tomography is provided. A collimated source of radiation is placed adjacent one side of the wall portion and an array of detectors for the radiation is placed on the other side adjacent the source. The radiation from the source passing through the wall portion is then detected with the detectors over a limited angle, dependent upon the curvature of the wall of the vessel, to obtain a dataset. The source and array are then coordinately moved relative to the wall portion in steps and a further dataset is obtained at each step. The plurality of datasets obtained over the limited angle is then processed to produce a tomogram of the wall portion to determine the presence of a defect therein. In a preferred embodiment, the curved wall portion has a center of curvature so that the source and the array are positioned at each step along a respective arc curved about the center. If desired, the detector array and source can be reoriented relative to a new wall portion and an inspection of the new wall portion can be easily obtained. Further, the source and detector array can be indexed in a direction perpendicular to a plane including the limited angle in a plurality of steps so that by repeating the detecting and moving steps at each index step, a three dimensional image can be created of the wall portion.

Fong, James T. (Bethel Park, PA)

1996-01-01T23:59:59.000Z

352

Evaluating the Reference and Representation of Domain Concepts in APIs  

E-Print Network [OSTI]

Evaluating the Reference and Representation of Domain Concepts in APIs Daniel Ratiu, Jan Jürjens ICPC 12 June 2008 #12;Domain specific APIs reflect the domain knowledge Programs World c b d API reflection of domain Developed program a Domain knowledge Real World #12;APIs' Quality through

Jurjens, Jan

353

Highly Energy Efficient Wall Systems Research Project | Department of  

Broader source: Energy.gov (indexed) [DOE]

Highly Energy Efficient Wall Systems Highly Energy Efficient Wall Systems Research Project Highly Energy Efficient Wall Systems Research Project The Department of Energy is currently conducting research into highly energy efficient wall systems. Walls with high R-values are better insulators, and their development can help buildings come closer to having zero net energy consumption. Project Description This project seeks to develop a commercially viable wall system up to R-40 through integration of vacuum technology with the exterior insulated façade system (EIFS). Dow Corning will develop a wall system configuration of expanded polystyrene vacuum isolation panels that can be specified for R-values of 20, 30, and 40. This project also aims to develop a unitized protection system of vacuum isolation panels and to validate current code

354

Moisture Management of High-R Walls (Fact Sheet), Building America...  

Energy Savers [EERE]

wall with ccSPF cavity insulation Double stud wall with cellulose insulation and polyethylene vapor retarder Double stud wall with cellulose and 2 in. of ccSPF Double stud wall...

355

Magnetic Reconnection in Astrophysical and  

E-Print Network [OSTI]

Magnetic Reconnection in Astrophysical and Laboratory Plasmas Ellen G. Zweibel1 and Masaaki Yamada2 astrophysics, magnetic fields, magnetic reconnection Abstract Magnetic reconnection is a topological rearrangement of magnetic field that converts magnetic energy to plasma energy. Astrophysical flares, from

356

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Wednesday, 29 November 2006 00:00...

357

National High Magnetic Field Laboratory Audio Dictionary: Magnetic...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Links Magnets from Mini to Mighty Meet the Magnets How to Make an Electromagnet (audio slideshow) Compasses in Magnetic Fields (interactive tutorial) Magnetic Field Around a...

358

Time-Domain Electromagnetics | Open Energy Information  

Open Energy Info (EERE)

Time-Domain Electromagnetics Time-Domain Electromagnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Time-Domain Electromagnetics Details Activities (10) Areas (10) Regions (0) NEPA(0) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Electrical Techniques Parent Exploration Technique: Electromagnetic Sounding Techniques Information Provided by Technique Lithology: Detection of rock units or geological features with contrasting apparent resistivity. Stratigraphic/Structural: Structural information may be inferred from TDEM data. Hydrological: Hydrological information such as depth to groundwater table may be determined. Thermal: Extent of hydrothermal alteration mineralogy may be inferred. Cost Information

359

Detecting Networks Employing Algorithmically Generated Domain Names  

E-Print Network [OSTI]

and hence has no com- mon IP address or a common domain name. Let ip = I be the total number of IP-addresses that are present after the F1 stage. and let d = D be total number of domain names that are present after the F1 stage. The vertices of graph G... for the second level domain name of xyz.com. At times a few of the IP addresses would end up in this component class because of a shortage in the 27 analysis period, given enough time ideally all the IP addresses (hosting server) of a single business unit...

Ashwath Kumar Krishna Reddy

2011-10-21T23:59:59.000Z

360

Biosynthesis of magnetic nanostructures in a foreign organism by transfer of bacterial  

E-Print Network [OSTI]

single magnetic domain nanoparticles at ambient temperature is challenging1,2 . In nature, magnetosomes. Here, we show that the ability to biomineralize highly ordered magnetic nanostructures can- settes comprising the MycoMar (tps) or Tn5 transposase gene, two corresponding inverted repeats

Cai, Long

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Detonation limits in rough walled tubes  

Science Journals Connector (OSTI)

Abstract The present paper reports the results of a study of detonation limits in rough tubes. Detonation velocity is measured by photodiodes and ionization probes spaced at 10 cm intervals along the length of the tube. Short lengths of smoked foils inserted into the core of the rough tube is used to register the structure of the detonation wave. Pressure transducers are also used to obtain the pressure profile. The results indicate that in rough tubes, the detonation velocity is generally much lower than the corresponding values for smooth tubes. The velocity decreases slowly at first and then more rapidly as the limit is approached. The velocity variation is generally continuous and at the limits, the failure velocity is of the order of about 0.4 V CJ for all cases. The detonation limits in rough tubes are found to be wider than for a smooth tube. This indicates that the turbulence generated by the wall roughness facilitates the propagation of the detonation and extends the limits. Smoked foil records show that in the core of the rough tube the detonation front has a cellular structure corresponding to the usual cellular structure due to instability of the detonation. Thus the intrinsic unstable cellular structure is quite robust and retains its global characteristics in spite of the large perturbations generated by the rough wall. The detonation in the core of the rough tube goes from multi-headed to single headed as the limit is approached. Past the single headed spin, the low velocity detonation has no cellular structure but consists of interacting weak transverse waves from the rough wall. The averaged pressure of the low velocity detonation front corresponds to about the constant volume explosion pressure, in accord with the velocity of the low velocity detonation.

Amanda Starr; John H.S. Lee; Hoi Dick Ng

2014-01-01T23:59:59.000Z

362

Gas turbine bucket wall thickness control  

DOE Patents [OSTI]

A core for use in casting a turbine bucket including serpentine cooling passages is divided into two pieces including a leading edge core section and a trailing edge core section. Wall thicknesses at the leading edge and the trailing edge of the turbine bucket can be controlled independent of each other by separately positioning the leading edge core section and the trailing edge core section in the casting die. The controlled leading and trailing edge thicknesses can thus be optimized for efficient cooling, resulting in more efficient turbine operation.

Stathopoulos, Dimitrios (Glenmont, NY); Xu, Liming (Greenville, SC); Lewis, Doyle C. (Greer, SC)

2002-01-01T23:59:59.000Z

363

Superconducting magnet  

DOE Patents [OSTI]

A superconducting magnet designed to produce magnetic flux densities of the order of 4 to 5 Webers per square meter is constructed by first forming a cable of a plurality of matrixed superconductor wires with each wire of the plurality insulated from each other one. The cable is shaped into a rectangular cross-section and is wound with tape in an open spiral to create cooling channels. Coils are wound in a calculated pattern in saddle shapes to produce desired fields, such as dipoles, quadrupoles, and the like. Wedges are inserted between adjacent cables as needed to maintain substantially radial placement of the long dimensions of cross sections of the cables. After winding, individual strands in each of the cables are brought out to terminals and are interconnected to place all of the strands in series and to maximize the propagation of a quench by alternating conduction from an inner layer to an outer layer and from top half to bottom half as often as possible. Individual layers are separated from others by spiraled aluminum spacers to facilitate cooling. The wound coil is wrapped with an epoxy tape that is cured by heat and then machined to an interference fit with an outer aluminum pipe which is then affixed securely to the assembled coil by heating it to make a shrink fit. In an alternate embodiment, one wire of the cable is made of copper or the like to be heated externally to propagate a quench.

Satti, John A. (Naperville, IL)

1980-01-01T23:59:59.000Z

364

Open-domain textual question answering techniques  

Science Journals Connector (OSTI)

Textual question answering is a technique of extracting a sentence or text snippet from a document or document collection that responds directly to a query. Open-domain textual question answering presupposes that questions are natural and unrestricted ...

Sanda M. Harabagiu; Steven J. Maiorano; Marius A. Pa?ca

2003-09-01T23:59:59.000Z

365

Antiferromagnetic domain size and exchange bias  

E-Print Network [OSTI]

Using neutron diffraction, we measured the sizes of antiferromagnetic domains in three ferromagnet/antiferromagnet bilayer samples as a function of the magnitude and sign of exchange bias, temperature, and antiferromagnet composition. Neutron...

Fitzsimmons, M. R.; Lederman, D.; Cheon, M.; Shi, H.; Olamit, J.; Roshchin, Igor V.; Schuller, Ivan K.

2008-01-01T23:59:59.000Z

366

A Small Molecule Transcriptional Activation Domain  

Science Journals Connector (OSTI)

1 These activation domains often contain surreptitious repeats of 6?14 amino acids,4,5 and the minimal repeat unit of a natural transcriptional activator can itself function as an activator when attached to a DBD. ...

Aaron R. Minter; Brian B. Brennan; Anna K. Mapp

2004-08-07T23:59:59.000Z

367

Multilevel domain decomposition for electronic structure calculations  

E-Print Network [OSTI]

Multilevel domain decomposition for electronic structure calculations M. Barrault a,b,*, E. Cance method (MDD) for electronic structure calculations within semi- empirical and density functional theory electronic structure calculations A molecular system is composed of N electrons, modelled quantum

Hager, William

368

Experiments with liquid metal walls: Status of the lithium tokamak experiment  

Science Journals Connector (OSTI)

Abstarct Liquid metal walls have been proposed to address the first wall challenge for fusion reactors. The lithium tokamak experiment (LTX) at the Princeton Plasma Physics Laboratory (PPPL) is the first magnetic confinement device to have liquid metal plasma-facing components (PFC's) that encloses virtually the entire plasma. In the current drive experiment-upgrade (CDX-U), a predecessor to LTX at PPPL, the highest improvement in energy confinement ever observed in ohmically heated tokamak plasmas was achieved with a toroidal liquid lithium limiter. The LTX extends this liquid lithium PFC by using a conducting conformal shell that almost completely surrounds the plasma. By heating the shell, a lithium coating on the plasma-facing side can be kept liquefied. A consequence of the low-recycling conditions from liquid lithium walls is the need for efficient plasma fueling. For this purpose, a molecular cluster injector is being developed. Future plans include the installation of a neutral beam for core plasma fueling, and also ion temperature measurements using charge-exchange recombination spectroscopy (CHERS). Low edge recycling is also predicted to reduce temperature gradients that drive drift wave turbulence. Gyrokinetic simulations are in progress to calculate fluctuation levels and transport for LTX plasmas, and new fluctuation diagnostics are under development to test these predictions.

Robert Kaita; Laura Berzak; Dennis Boyle; Timothy Gray; Erik Granstedt; Gregory Hammett; Craig M. Jacobson; Andrew Jones; Thomas Kozub; Henry Kugel; Benoit Leblanc; Nicholas Logan; Matthew Lucia; Daniel Lundberg; Richard Majeski; Dennis Mansfield; Jonathan Menard; Jeffrey Spaleta; Trevor Strickler; John Timberlake; Jongsoo Yoo; L. Zakharov; Rajesh Maingi; Vlad Soukhanovskii; Kevin Tritz; Sophia Gershman

2010-01-01T23:59:59.000Z

369

Limiter Lock Systems at TEXTOR: Flexible Tools for Plasma-Wall Investigation  

SciTech Connect (OSTI)

Limiter lock systems on the top and the bottom of the TEXTOR vessel are essential elements for experimental investigations of plasma-wall interaction in a tokamak. The lock systems are designed as user facilities that allow the insertion of wall elements (limiter) and tools for diagnostic (electrical probes, gas injection) without breaking the TEXTOR vacuum. The specially designed holder on top of the central carrier and a powerful vacuum pump system permit the exchange of components within {approx}1 h. Up to ten electrical signals, four thermocouples, and a gas supply can be connected at the holder interface. Between discharges, the inserted component can be positioned radially and turned with respect to the toroidal magnetic field. Additionally, the central carrier is electrically isolated to apply bias voltages and currents up to 1 kV and 1 kA, respectively.An important feature of the lock system is the good access for optical spectroscopic observation of the inserted components in the vicinity of the edge plasma. The whole spectrum from ultraviolet to infrared is covered by spectrometers and filters combined with cameras. Toroidally and poloidally resolved measurements are obtained from the view on top of the probes while the tangential poloidal view delivers radially and toroidally resolved information.A programmable logic controller (Simatic S5) that is operated inside the TEXTOR bunker and from remote locations outside the concrete wall drives all possible features of the lock system.

Schweer, B.; Brezinsek, S.; Esser, H.G.; Huber, A.; Mertens, Ph.; Musso, S.; Philipps, V.; Pospieszczyk, A.; Samm, U.; Sergienko, G.; Wienhold, P. [Institut fuer Plasmaphysik, Forschungszentrum Juelich GmbH (Germany)

2005-02-15T23:59:59.000Z

370

Flame-wall interaction simulation in a turbulent channel flow  

SciTech Connect (OSTI)

The interaction between turbulent premixed flames and channel walls is studied. Combustion is represented by a simple irreversible reaction with a large activation temperature. A low heat release assumption is used, but feedback to the flowfield can be allowed through viscosity changes. The effect of wall distance on local and global flame structure is investigated. Quenching distances and maximum wall heat fluxed computed in laminar cases are compared to DNS results. It is found that quenching distances decrease and maximum heat fluxes increase relative to laminar flame values, scaling with the turbulent strain rate. It is shown that these effects are due to large coherent structures which push flame elements towards the wall. The effect of wall strain in flame-wall interaction is studied in a stagnation line flow; this is used to explain the DNS results. The effects of the flame on the flow through viscosity changes is studied. It is also shown that remarkable flame events are produced by flame interaction with a horseshoe vortex: burned gases are pushed towards the wall at high speed and induce quenching and high wall heat flux while fresh gases are expelled from the wall region and form finger-like structures. Effects of the wall on flame surface density are investigated.

Bruneaux, G.; Akselvoll, K.; Poinsot, T.; Ferziger, J.H.

1996-10-01T23:59:59.000Z

371

Growth of unstable domains in the two-dimensional Ising model  

Science Journals Connector (OSTI)

We investigate the ferromagnetic Ising model with spin-flip dynamics by Monte Carlo computer simulation. The system is prepared at time t=0 by deeply quenching from a high-temperature disordered state, to a low-temperature nonequilibrium state. We analyze the growth of domains of the ordered phase through two measures of the average size of these domains: the fluctuation in magnetization and the perimeter density. Systems of size 602, 752, 1052, 1502, and 2402 are studied over large numbers of quenches (from 48 to 450 on a given lattice). We find that domains grow self-similarly following the Allen-Cahn law (domain area proportional to time). The effects of different updating procedures, finite size, and varying number of runs on the evolution and the statistics of the data are studied. We find that the time evolution given by random updating or a multispin coding algorithm are the same. We estimate the percentage error in the observed size of domains from a simple zero-time sum rule, which is independent of system size. This is found to be a reasonable estimate of error throughout the self-similar scaling regime.

E. T. Gawlinski; Martin Grant; J. D. Gunton; K. Kaski

1985-01-01T23:59:59.000Z

372

Chem. Phys. Lett. in press Cold wall CVD generation of single-walled carbon nanotubes  

E-Print Network [OSTI]

-furnace [3] and arc-discharge [4] methods, several techniques employing the CVD approach [5-13] have been Catalytic CVD generation of high-purity single-walled carbon nanotubes (SWNTs) without use of an electric without resort to an electric furnace or a hot filament is proposed. All one needs is a vacuum chamber

Maruyama, Shigeo

373

Mechanism of Synthesis of Ultra-Long Single Wall Carbon Nanotubes in Arc Discharge Plasma  

SciTech Connect (OSTI)

In this project fundamental issues related to synthesis of single wall carbon nanotubes (SWNTs), which is relationship between plasma parameters and SWNT characteristics were investigated. Given that among plasma-based techniques arc discharge stands out as very advantageous in several ways (fewer defects, high flexibility, longer lifetime) this techniques warrants attention from the plasma physics and plasma technology standpoint. Both experimental and theoretical investigations of the plasma and SWNTs synthesis were conducted. Experimental efforts focused on plasma diagnostics, measurements of nanostructures parameters, and nanoparticle characterization. Theoretical efforts focused to focus on multi-dimensional modeling of the arc discharge and single wall nanotube synthesis in arc plasmas. It was demonstrated in experiment and theoretically that controlling plasma parameters can affect nanostucture synthesis altering SWNT properties (length and diameter) and leading to synthesis of new structures such as a few-layer graphene. Among clearly identified parameters affecting synthesis are magnetic and electric fields. Knowledge of the plasma parameters and discharge characteristics is crucial for ability to control synthesis process by virtue of both magnetic and electric fields. New graduate course on plasma engineering was introduced into curriculum. 3 undergraduate students were attracted to the project and 3 graduate students (two are female) were involved in the project. Undergraduate student from Historically Black University was attracted and participated in the project during Summer 2010.

Keidar, Michael [George Washington University] [George Washington University

2013-06-23T23:59:59.000Z

374

Category:Time-Domain Electromagnetics | Open Energy Information  

Open Energy Info (EERE)

category "Time-Domain Electromagnetics" This category contains only the following page. T Time-Domain Electromagnetics Retrieved from "http:en.openei.orgw...

375

Time-Domain Electromagnetics At Glass Mountain Area (Cumming...  

Open Energy Info (EERE)

Time-Domain Electromagnetics At Glass Mountain Area (Cumming And Mackie, 2007) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain...

376

Learning About Magnets!  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

by the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a...

377

Hollow porous-wall glass microspheres for hydrogen storage  

DOE Patents [OSTI]

A porous wall hollow glass microsphere is provided having a diameter range of between 1 to 200 microns, a density of between 1.0 to 2.0 gm/cc, a porous-wall structure having wall openings defining an average pore size of between 10 to 1000 angstroms, and which contains therein a hydrogen storage material. The porous-wall structure facilitates the introduction of a hydrogen storage material into the interior of the porous wall hollow glass microsphere. In this manner, the resulting hollow glass microsphere can provide a membrane for the selective transport of hydrogen through the porous walls of the microsphere, the small pore size preventing gaseous or liquid contaminants from entering the interior of the hollow glass microsphere.

Heung, Leung K. (Aiken, SC); Schumacher, Ray F. (Aiken, SC); Wicks, George G. (Aiken, SC)

2010-02-23T23:59:59.000Z

378

En-Vac Robotic Wall Scabbler. Innovative Technology Summary Report  

SciTech Connect (OSTI)

The Idaho National Engineering and Environmental Laboratory (INEEL)demonstrated an En-Vac Robotic Wall Scabbler from Japan to remove contaminated paint and concrete up to five times faster than workers using a hand-held scabbling/grinding tool. The Robotic Wall Scabbler uses abrasive steel grit to blast metal and concrete surfaces and it moves along the wall and adheres to the surface using vacuum suction. The Robotic Wall Scabbling unit includes the robot, grit recycling unit, debris filtration system, vacuum system, and remote control station. It scabbles concrete at depths up to 1/8-inch per pass. The demonstration was conducted on the walls of the Decontamination Shop of Test Area North which is contaminated with polychlorobiphenyls, lead, and radionuclides. Besides production rate, other benefits of the robotic wall scabbler include reduced radiation dose to workers and no airborne contamination.

None

2001-04-01T23:59:59.000Z

379

Femtosecond Opto-Magnetism  

Science Journals Connector (OSTI)

We demonstrate that circularly polarized laser pulses may selectively excite different modes of magnetic resonance, realize quantum control of magnons, trigger magnetic phase...

Kimel, Alexey; Kirilyuk, A; Rasing, Th

380

Approaching the Theoretical Limit of Diamagnetic-Induced Momentum in a Rapidly Diverging Magnetic Nozzle  

Science Journals Connector (OSTI)

Cross-field diffusion and plasma expansion in a rapidly diverging magnetic nozzle are controlled while maintaining constant plasma production in a contiguously attached radio frequency plasma source. It is demonstrated that the measured electron-diamagnetic-induced axial momentum increases with increasing magnetic field strength to approach the theoretical limit derived using an ideal nozzle approximation. The measured axial momentum exerted onto the axial and radial plasma source boundaries validate the prediction from a maximum electron pressure model on the back wall and from a zero net axial momentum model on the radial wall.

Kazunori Takahashi; Christine Charles; Rod W. Boswell

2013-05-08T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Self-assembling functionalized single-walled carbon nanotubes  

E-Print Network [OSTI]

scale synthesis of carbon nanotubes." Nature, Vol.358, 220-Ropes of Metallic Carbon Nanotubes." Science, Vol.273(5274),of single- wall carbon nanotubes. Process, product, and

Gao, Yan

2011-01-01T23:59:59.000Z

382

Stud Walls With Continuous Exterior Insulation for Factory Built...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

density, fairly simple window and door framing details can be used. Easily installed plastic sill flashing is an added benefit. STUD WALLS WITH FOAM- CONTROL NAILBRACE AFM's...

383

Concept for Reducing Hall Thruster Chamber Wall Erosion with...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Concept for Reducing Hall Thruster Chamber Wall Erosion with Lithium Vapor Shielding. Hall thrusters have been established as a compact and reliable means for satellite...

384

Security Walls, LLC, January 14-18, 2013  

Broader source: Energy.gov (indexed) [DOE]

Assistance Washington, DC 20585 Security Walls, LLC DOE-VPP Onsite Review January 2013 Foreword The Department of Energy (DOE) recognizes that true excellence can be...

385

Imaging cell wall architecture in single Zinnia elegans tracheary elements  

E-Print Network [OSTI]

indicated a loss of lignin and a modest loss of otherTEs accumulate lignin in their secondary walls and undergohemicelluloses, and also lignin, a complex aromatic polymer

Lacayo, Catherine

2012-01-01T23:59:59.000Z

386

Electromagnetic Interference (EMI) Shielding of Single-Walled Carbon  

E-Print Network [OSTI]

Electromagnetic Interference (EMI) Shielding of Single-Walled Carbon Nanotube Epoxy Composites Ning (SWNT)-polymer composites have been fabricated to evaluate the electromagnetic interference (EMI

Gao, Hongjun

387

Fracture of welded aluminum thin-walled structures  

E-Print Network [OSTI]

A comprehensive methodology was developed in the thesis for damage prediction of welded aluminum thin-walled structures, which includes material modeling, calibration, numerical simulation and experimental verification. ...

Zheng, Li, Ph. D. Massachusetts Institute of Technology

2006-01-01T23:59:59.000Z

388

Seismic design, testing and analysis of reinforced concrete wall buildings  

E-Print Network [OSTI]

and Priestley M.J.N. (1992). “Seismic Design of Reinforced2007). “Displacement Based Seismic Design of Structures”.318-99 Provisions for Seismic Design of Structural Walls.

Panagiotou, Marios

2008-01-01T23:59:59.000Z

389

Wall and laser spot motion in cylindrical hohlraums  

SciTech Connect (OSTI)

Wall and laser spot motion measurements in empty, propane-filled and plastic (CH)-lined gold coated cylindrical hohlraums were performed on the Omega laser facility [T. R. Boehly et al., Opt. Commun. 133, 495 (1997)]. Wall motion was measured using axial two-dimensional (2D) x-ray imaging and laser spot motion was perpendicularly observed through a thinned wall using streaked hard x-ray imaging. Experimental results and 2D hydrodynamic simulations show that while empty targets exhibit on-axis plasma collision, CH-lined and propane-filled targets inhibit wall expansion, corroborated with perpendicular streaked imaging showing a slower motion of laser spots.

Huser, G.; Courtois, C.; Monteil, M.-C. [CEA, DAM, DIF, F-91297 Arpajon (France)

2009-03-15T23:59:59.000Z

390

Self-assembling functionalized single-walled carbon nanotubes  

E-Print Network [OSTI]

Single-walled carbon nanotubes Carbon nanotubes (CNTs) arescale synthesis of carbon nanotubes." Nature, Vol.358, 220-Ropes of Metallic Carbon Nanotubes." Science, Vol.273(5274),

Gao, Yan

2011-01-01T23:59:59.000Z

391

Behavior of nanoparticle clouds around a magnetized microsphere under magnetic and flow fields  

E-Print Network [OSTI]

When a micron-sized magnetizable particle is introduced into a suspension of nanosized magnetic particles, the nanoparticles accumulate around the microparticle and form thick anisotropic clouds extended in the direction of the applied magnetic field. This phenomenon promotes colloidal stabilization of bimodal magnetic suspensions and allows efficient magnetic separation of nanoparticles used in bioanalysis and water purification. In the present work, size and shape of nanoparticle clouds under the simultaneous action of an external uniform magnetic field and the flow have been studied in details. In experiments, dilute suspension of iron oxide nanoclusters (of a mean diameter of 60 nm) was pushed through a thin slit channel with the nickel microspheres (of a mean diameter of 50$\\mu$m) attached to the channel wall. The behavior of nanocluster clouds was observed in the steady state using an optical microscope. In the presence of strong enough flow, the size of the clouds monotonically decreases with increasing flow speed in both longitudinal and transverse magnetic fields. This is qualitatively explained by enhancement of hydrodynamic forces washing the nanoclusters away from the clouds. In the longitudinal field, the flow induces asymmetry of the front and the back clouds. To explain the flow and the field effects on the clouds, we have developed a simple model based on the balance of the stresses and particle fluxes on the cloud surface. This model, applied to the case of the magnetic field parallel to the flow, captures reasonably well the flow effect on the size and shape of the cloud and reveals that the only dimensionless parameter governing the cloud size is the ratio of hydrodynamic-to-magnetic forces - the Mason number. At strong magnetic interactions considered in the present work (dipolar coupling parameter $\\alpha \\geq 2$), the Brownian motion seems not to affect the cloud behavior.

Cécilia Magnet; Pavel Kuzhir; Georges Bossis; Alain Meunier; Sebastien Nave; Andrey Zubarev; Claire Lomenech; Victor Bashtovoi

2014-04-14T23:59:59.000Z

392

Effective spacetime and Hawking radiation from moving domain wall in thin film of 3He-A  

E-Print Network [OSTI]

An event horizon for "relativistic" fermionic quasiparticles can be constructed in a thin film of superfluid 3He-A. The quasiparticles see an effective "gravitational" field which is induced by a topological soliton of the order parameter. Within the soliton the "speed of light" crosses zero and changes sign. When the soliton moves, two planar event horizons (black hole and white hole) appear, with a curvature singularity between them. Aside from the singularity, the effective spacetime is incomplete at future and past boundaries, but the quasiparticles cannot escape there because the nonrelativistic corrections become important as the blueshift grows, yielding "superluminal" trajectories. The question of Hawking radiation from the moving soliton is discussed but not resolved.

T. A. Jacobson; G. E. Volovik

1998-11-04T23:59:59.000Z

393

Mr. Andy Wall0 The Aerospace Corporation  

Office of Legacy Management (LM)

'k.f' :, , j '"; ,,' 'k.f' :, , j '"; ,,' DEC 5 1984 Mr. Andy Wall0 The Aerospace Corporation suite 4000 955 L'Enfant Plaza, S.W. Washington, D.C. 20024 Dear Mr. Wallo: The Divisfon of Remedial Action Projects staff has reviewed the authority review documents for Gardinler, Inc., Tampa, Florida; Conserv (formerly Virginia-Carolina Chemical Co.), Nichols, Florida; and Blockson Chemical co., Joliet, Illinois. Based on the content therein and in consultation with Mr. Steve Miller, Office of General Counsel (C&11), Departamt of Energy, It has been determined that the Department has no authority, through the Atomic Energy Act of 1954, as amended, to conduct remedial action at the aforementioned sites, Therefore, please prepare the document packages necessary to notify the appropriate state authorities and the

394

Hadronization at the AdS wall  

E-Print Network [OSTI]

We describe hadronization events, using the AdS/CFT Correspondence, which display many of the qualitative features expected in QCD. In particular we study the motion of strings with separating end points in a back-reacted hard wall geometry. The solutions show the development of a linear QCD-like string. The end points oscillate in the absence of string breaking. We introduce string breaking by hand and evolve the new state forward in time to observe the separation of two string segments. A kink associated with this breaking evolves to the end points of the string inducing rho meson production. We explicitly compute the rho meson production at the end point.

Nick Evans; James French; Kristan Jensen; Ed Threlfall

2009-08-04T23:59:59.000Z

395

The plasmoid instability during asymmetric inflow magnetic reconnection  

SciTech Connect (OSTI)

Theoretical studies of the plasmoid instability generally assume that the reconnecting magnetic fields are symmetric. We relax this assumption by performing two-dimensional resistive magnetohydrodynamic simulations of the plasmoid instability during asymmetric inflow magnetic reconnection. Magnetic asymmetry modifies the onset, scaling, and dynamics of this instability. Magnetic islands develop preferentially into the weak magnetic field upstream region. Outflow jets from individual X-points impact plasmoids obliquely rather than directly as in the symmetric case. Consequently, deposition of momentum by the outflow jets into the plasmoids is less efficient, the plasmoids develop net vorticity, and shear flow slows down secondary merging between islands. Secondary merging events have asymmetry along both the inflow and outflow directions. Downstream plasma is more turbulent in cases with magnetic asymmetry because islands are able to roll around each other after exiting the current sheet. As in the symmetric case, plasmoid formation facilitates faster reconnection for at least small and moderate magnetic asymmetries. However, when the upstream magnetic field strengths differ by a factor of 4, the reconnection rate plateaus at a lower value than expected from scaling the symmetric results. We perform a parameter study to investigate the onset of the plasmoid instability as a function of magnetic asymmetry and domain size. There exist domain sizes for which symmetric simulations are stable but asymmetric simulations are unstable, suggesting that moderate magnetic asymmetry is somewhat destabilizing. We discuss the implications for plasmoid and flux rope formation in solar eruptions, laboratory reconnection experiments, and space plasmas. The differences between symmetric and asymmetric simulations provide some hints regarding the nature of the three-dimensional plasmoid instability.

Murphy, Nicholas A. [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States)] [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States); Young, Aleida K. [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States) [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States); Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, Michigan 48109 (United States); Shen, Chengcai [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States) [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States); Yunnan Astronomical Observatory, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Lin, Jun [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States) [Harvard-Smithsonian Center for Astrophysics, Cambridge, Massachusetts 02138 (United States); Yunnan Astronomical Observatory, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Ni, Lei [Yunnan Astronomical Observatory, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China)] [Yunnan Astronomical Observatory, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China)

2013-06-15T23:59:59.000Z

396

Scott Domain Representability of a Class of Generalized Ordered Spaces  

E-Print Network [OSTI]

-space constructed on a locally compact LOTS, is Scott-domain representable, i.e., is homeomorphic to the space-domain representable (i.e., being homeomorphic to the subspace of maximal elements of a Scott-domain with the ScottScott Domain Representability of a Class of Generalized Ordered Spaces Kevin W. Duke and David

Lutzer, David J.

397

Formal Domain Modeling: From Specification to Atif Mashkoor  

E-Print Network [OSTI]

Formal Domain Modeling: From Specification to Validation Atif Mashkoor LORIA ­ DEDALE Team ­ Nancy with re- finement based approach at domain level. We also introduce a stepwise validation process and their inter-relationships, along with their important static and dynamic properties of the domain. The domain

Paris-Sud XI, Université de

398

Domain-specific abstractions and compiler transformations  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Domain-specific abstractions and compiler Domain-specific abstractions and compiler transformations Domain-specific abstractions and compiler transformations March 4, 2013 sadayappan Saday Sadayappan Department of Computer Science and Engineering, Ohio State University Recent trends in architecture are making multicore parallelism as well as heterogeneity ubiquitous. This creates significant chalenges to application developers as well as compiler implementations. Currently it is virtually impossible to achieve performance portability of high-performance applications, i.e., develop a single version of source code for an application that achieves high performance on different parallel computer platforms. Different implementations of compute intensive core functions are generally needed for different target platforms, e.g., for multicore

399

Quadrupole magnets measurement  

SciTech Connect (OSTI)

A rotating coil setup is designed for quadrupole magnet measurement at the Accelerator Test Facility (ATF); Hall probe measurement was also performed for one of each type of quadrupole magnet. Both mechanical and magnetic properties of the quadrupole magnets were measured, the results are reported here. 5 refs., 12 figs., 12 tabs.

Wang, Xijie (California Univ., Los Angeles, CA (USA). Center for Advanced Accelerators Physics); Sylvester, C. (Brookhaven National Lab., Upton, NY (USA))

1991-01-01T23:59:59.000Z

400

Magnetism in Nanocrystalline Gold  

Science Journals Connector (OSTI)

Magnetism in Nanocrystalline Gold ... Bridging the current gap in experimental study of magnetism in bare gold nanomaterials, we report here on magnetism in gold nanocrystalline films produced by cluster deposition in the aggregate form that can be considered as a crossover state between a nanocluster and a continuous film. ... gold; nanocrystalline film; magnetism; cluster deposition; SQUID magnetometry ...

Vladimir Tuboltsev; Alexander Savin; Alexandre Pirojenko; Jyrki Räisänen

2013-07-07T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Magnetism of spiral galaxies  

Science Journals Connector (OSTI)

... magnetic fields of spiral galaxies has taken a special place in the study of cosmic magnetism, but magnetic fields are a universal property of all galactic-type objects, as is ... . The past ten years have been notable for rapid, qualitative progress in understanding the magnetism of spiral galaxies, a result of both theoretical and observational developments. A few decades ...

Alexander Ruzmaikin; Dmitry Sokoloff; Anvar Shukurov

1988-11-24T23:59:59.000Z

402

Magnetism in microquasars  

Science Journals Connector (OSTI)

...Lynden-Bell, E. R. Priest and N. O. Weiss Magnetism in microquasars I. F. Mirabel Centre...binaries|magnetic field|plasma physics| Magnetism in microquasars By I. F. Mirabel Centre...Trans. R. Soc. Lond. A (2000) Magnetism in microquasars 843 At rst glance it...

2000-01-01T23:59:59.000Z

403

Early History of Magnetism  

Science Journals Connector (OSTI)

... 2, Dr. J. B. Kramer read a paper on “The Early History of Magnetism”, in which he discussed the various accounts of the first discovery of a magnet ... accounts of the first discovery of a magnet, and the development of the science of magnetism down to A.D. 1600. His remarks were divided into five sections, the ...

1932-03-19T23:59:59.000Z

404

Eminent Domain (Indiana) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

(Indiana) (Indiana) Eminent Domain (Indiana) < Back Eligibility Agricultural Commercial Construction Fed. Government Fuel Distributor General Public/Consumer Industrial Installer/Contractor Institutional Investor-Owned Utility Local Government Low-Income Residential Multi-Family Residential Municipal/Public Utility Nonprofit Residential Retail Supplier Rural Electric Cooperative Schools State/Provincial Govt Systems Integrator Transportation Tribal Government Utility Savings Category Alternative Fuel Vehicles Hydrogen & Fuel Cells Buying & Making Electricity Water Home Weatherization Solar Wind Program Info State Indiana Program Type Siting and Permitting Provider Indiana Association of Cities and Towns Utilities, corporations, and gas storage facilities may invoke the law of eminent domain in certain circumstances, as provided for in this

405

The Value of the EU Public Domain  

E-Print Network [OSTI]

is as natural and necessary part of our research efforts as the study of copyright.1 1 Mead Fellow in Economics, Emmanuel College, University of Cambridge 2 Erasmus University Rotterdam and Austrian Society for Cultural Economics and Policy Studies 3 Adjunct... proximate but already public domain works. 30We can add and remove mass because the set of in-print public domain and in copyright books do not necessarily match. 31If one considers this over-generous it is worth considering that the various different Harry...

Pollock, Rufus; Stepan, Paul; Välimäki, Mikko

406

Wall Lake Municipal Utilities Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Wall Lake Municipal Utilities Wind Farm Wall Lake Municipal Utilities Wind Farm Jump to: navigation, search Name Wall Lake Municipal Utilities Wind Farm Facility Wall Lake Municipal Utilities Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Wall Lake Municipal Utilities Developer Wall Lake Municipal Utilities Energy Purchaser Wall Lake Municipal Utilities Location Wall Lake IA Coordinates 42.281965°, -95.094098° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.281965,"lon":-95.094098,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

407

Laser-produced plasma-wall interaction O. RENNER,1  

E-Print Network [OSTI]

Laser-produced plasma-wall interaction O. RENNER,1 R. LISKA,2 AND F.B. ROSMEJ3,4 1 Institute, France (RECEIVED 30 August 2009; ACCEPTED 21 September 2009) Abstract Jets of laser­generated plasma surfaces (walls). The pilot experiments carried out on the iodine laser system (5­200 J, 0.44 mm, 0

Liska, Richard

408

Electron-wall interaction in Hall thrustersa... Y. Raitsesb  

E-Print Network [OSTI]

Electron-wall interaction in Hall thrustersa... Y. Raitsesb and D. Staack Princeton Plasma Physics; accepted 22 February 2005; published online 2 May 2005 Electron-wall interaction effects in Hall thrusters this threshold, the electron energy gain is constant in the acceleration region and therefore, secondary electron

409

A review on Phase Change Materials Integrated in Building Walls  

E-Print Network [OSTI]

A review on Phase Change Materials Integrated in Building Walls Fr´ed´eric Kuznika, , Damien Davida review of the integration of phase change materials in building walls. Many considerations are discussed in this paper including physical considerations about building envelop and phase change material, phase change

410

CP-Violating Bubble Wall and Electroweak Baryogenesis  

Science Journals Connector (OSTI)

...August 1997 research-article Articles CP-Violating Bubble Wall and Electroweak...baryogenesis depends on the profile of the CP-violating bubble wall created at the first...point out that a sufficiently small explicit CP violation gives nonperturbative effects......

Koichi Funakubo; Akira Kakuto; Shoichiro Otsuki; Fumihiko Toyoda

1997-08-01T23:59:59.000Z

411

Global structure of moduli space for BPS walls  

SciTech Connect (OSTI)

We study the global structure of the moduli space of BPS walls in the Higgs branch of supersymmetric theories with eight supercharges. We examine the structure in the neighborhood of a special Lagrangian submanifold M, and find that the dimension of the moduli space can be larger than that naively suggested by the index theorem, contrary to previous examples of BPS solitons. We investigate BPS wall solutions in an explicit example of M using Abelian gauge theory. Its Higgs branch turns out to contain several special Lagrangian submanifolds including M. We show that the total moduli space of BPS walls is the union of these submanifolds. We also find interesting dynamics between BPS walls as a by-product of the analysis. Namely, mutual repulsion and attraction between BPS walls sometimes forbid a movement of a wall and lock it in a certain position; we also find that a pair of walls can transmute to another pair of walls with different tension after they pass through.

Eto, Minoru; Isozumi, Youichi; Nitta, Muneto; Ohashi, Keisuke; Sakai, Norisuke [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8551 (Japan); Ohta, Kazutoshi [Theoretical Physics Laboratory, The Institute of Physical and Chemical Research (RIKEN), Saitama 351-0198 (Japan); Tachikawa, Yuji [Department of Physics, University of Tokyo, Tokyo 112-0033 (Japan)

2005-05-15T23:59:59.000Z

412

Absorption spectroscopy of individual single-walled carbon nanotubes  

E-Print Network [OSTI]

Absorption spectroscopy of individual single-walled carbon nanotubes Stéphane Berciaud,a Laurent-walled carbon nanotubes (SWNTs) lead to heterogeneous samples containing mixtures of metallic and semiconducting species with a variety of lengths and defects. Optical detection at the single nanotube level should thus

Boyer, Edmond

413

Simulations of nanosensors based on single walled carbon nanotubes  

E-Print Network [OSTI]

Simulations of nanosensors based on single walled carbon nanotubes Polina Pine1, Yuval E. Yaish2. The potential of single-walled carbon nanotubes as mass sensors is examined. The change in mass leads to proportional changes in the nanotube vibrational frequencies, which are monitored during atomistic simulations

Adler, Joan

414

Scanning tunneling spectroscopy of suspended single-wall carbon nanotubes  

E-Print Network [OSTI]

Scanning tunneling spectroscopy of suspended single-wall carbon nanotubes B. J. LeRoy,a) S. G-wall carbon nanotubes that are freely suspended over a trench. The nanotubes were grown by chemical vapor on the freestanding portions of the nanotubes. Spatially resolved spectroscopy on the suspended portion of both

Dekker, Cees

415

Characterization of single wall carbon nanotubes by nonane preadsorption  

E-Print Network [OSTI]

energy for nitrogen adsorbed in nanotubes at zero coverage within the range of 12­18 kJ/mol. This bindingCharacterization of single wall carbon nanotubes by nonane preadsorption Oleg Byl a , Jie Liu b The preferential blocking of the interior adsorption sites of single walled carbon nanotubes (SWNTs) by n

Liu, Jie

416

Electrical Transport in Single-Wall Carbon Nanotubes  

E-Print Network [OSTI]

. (a) Schematic view a nanotube field-effect transistor (b) The Dirac energy dispersion coneElectrical Transport in Single-Wall Carbon Nanotubes Michael J. Biercuk1,3 , Shahal Ilani2 metal and semiconducting single-wall carbon nanotubes. The fundamental scattering mechanisms governing

McEuen, Paul L.

417

Raman Measurements on Electrochemically Doped Single-Walled Carbon Nanotubes  

E-Print Network [OSTI]

Raman Measurements on Electrochemically Doped Single-Walled Carbon Nanotubes P. M. Rafailov, M and studied the Raman response of electro- chemically doped single-walled carbon nanotubes (SWNT) using different salt solutions. The fre- quency shift of the radial breathing mode (RBM) and the high-energy mode

Nabben, Reinhard

418

Wall Sculpture by Ellsworth Kelly Installed on Dartmouth Campus  

E-Print Network [OSTI]

Wall Sculpture by Ellsworth Kelly Installed on Dartmouth Campus Dartmouth Panels will be dedicated District, a wall sculpture by renowned abstract artist Ellsworth Kelly has been installed on the eastern façade of the Hopkins Center for the Arts, facing the Visual Arts Center. Kelly was in attendance

Shepherd, Simon

419

Ultrastructure and Composition of the Nannochloropsis gaditana Cell Wall  

Science Journals Connector (OSTI)

...removing the walls from the green pellet at the bottom of the tube until no green pellet was observed...the National Renewable Energy Laboratory (46). Characterization...Environ. Prog. Sustain. Energy 32 :989-1001. doi...wall proteomics of the green alga Haematococcus pluvialis...

Matthew J. Scholz; Taylor L. Weiss; Robert E. Jinkerson; Jia Jing; Robyn Roth; Ursula Goodenough; Matthew C. Posewitz; Henri G. Gerken

2014-09-19T23:59:59.000Z

420

NON-RECTANGULAR RC WALLS: A REVIEW ON EXPERIMENTAL INVESTIGATIONS  

E-Print Network [OSTI]

section. It was rare that tests were done using load paths that did not follow the principal axes subjected to unidirectional or bidirectional loading along one or both of the principal axes of the wall-sections such as for example L-shaped or U-shaped walls which were tested under quasi-static or dynamic loads. The tests

Thévenaz, Jacques

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Optical absorption intensity of semiconductor single-wall carbon nanotubes  

E-Print Network [OSTI]

Optical absorption intensity of semiconductor single-wall carbon nanotubes Y. Oyama1 , R. Saito1. The optical absorption intensity is inversely proportional to the diameter in the unit of per carbon atom of single-wall carbon nanotubes (SWNT) synthesized by alcohol CCVD (ACCVD) method and HiPco method [1

Maruyama, Shigeo

422

ORIGINAL PAPER Hydrothermal process synthesized electrocatalytic multi-walled  

E-Print Network [OSTI]

ORIGINAL PAPER Hydrothermal process synthesized electrocatalytic multi-walled carbon nanotubes as MWCNTs-Au, have been successfully prepared by a facile hydrothermal pro- cess of gold(III) chloride (Au. Keywords Hydrothermal Á Composites Á Au microparticles Á Multi-walled carbon nanotubes Á Ethanol oxidation

Guo, John Zhanhu

423

Associative model for solving the wall-following problem  

Science Journals Connector (OSTI)

A navigation system for a robot is presented in this work. The Wall-Following problem has become a classic problem of Robotics due to robots have to be able to move through a particular stage. This problem is proposed as a classifying task and it is ... Keywords: associative models, classification, morphological models, wall-following

Rodolfo Navarro; Elena Acevedo; Antonio Acevedo; Fabiola Martínez

2012-06-01T23:59:59.000Z

424

Optical microcavity with semiconducting single-wall carbon nanotubes  

E-Print Network [OSTI]

Optical microcavity with semiconducting single- wall carbon nanotubes Etienne Gaufrès,1 Nicolas-Perot microcavities based on semiconducting single-wall carbon nanotubes with a quality factor of 160. We properties References and links 1. P. Avouris, M. Freitag and V. Perebeinos, "Carbon nanotube photonics

Paris-Sud XI, Université de

425

Transverse Effect due to Short-range Resistive Wall Wakefield  

SciTech Connect (OSTI)

For accelerator designs with ultra short electron beams, beam dynamics study has to invoke the short-range wakefields. In this paper, we first obtain the short-range dipole mode resistive wall wakefield. Analytical approach is then developed to study the single bunch transverse beam dynamics due to this short-range resistive wall wake. The results are applied to the LCLS undulator.

Juhao Wu; Alex Chao; Jean Delayen

2007-06-18T23:59:59.000Z

426

Borehole-Wall Imaging with Acoustic and Optical Televiewers for  

Open Energy Info (EERE)

Borehole-Wall Imaging with Acoustic and Optical Televiewers for Borehole-Wall Imaging with Acoustic and Optical Televiewers for Fractured-Bedrock Aquifer Investigations Jump to: navigation, search OpenEI Reference LibraryAdd to library Conference Paper: Borehole-Wall Imaging with Acoustic and Optical Televiewers for Fractured-Bedrock Aquifer Investigations Abstract Imaging with acoustic and optical televiewers results in continuous and oriented 360 degree views of the borehole wall from which the character and orientation of lithologic and structural features can be defined for fractured-bedrock aquifer investigations. Fractures are more clearly defined under a wider range of conditions on acoustic images than on optical images including dark-colored rocks, cloudy borehole water, and coated borehole walls. However, optical images allow for the direct viewing

427

Methods for degrading or converting plant cell wall polysaccharides  

DOE Patents [OSTI]

The present invention relates to methods for converting plant cell wall polysaccharides into one or more products, comprising: treating the plant cell wall polysaccharides with an effective amount of a spent whole fermentation broth of a recombinant microorganism, wherein the recombinant microorganism expresses one or more heterologous genes encoding enzymes which degrade or convert the plant cell wall polysaccharides into the one or more products. The present invention also relates to methods for producing an organic substance, comprising: (a) saccharifying plant cell wall polysaccharides with an effective amount of a spent whole fermentation broth of a recombinant microorganism, wherein the recombinant microorganism expresses one or more heterologous genes encoding enzymes which degrade or convert the plant cell wall polysaccharides into saccharified material; (b) fermenting the saccharified material of step (a) with one or more fermenting microoganisms; and (c) recovering the organic substance from the fermentation.

Berka, Randy (Davis, CA); Cherry, Joel (Davis, CA)

2008-08-19T23:59:59.000Z

428

Magnetic Fields Analogous to electric field, a magnet  

E-Print Network [OSTI]

characteristic of elementary particles such as an electron #12;Magnetic Fields Magnetic field lines Direction;Magnetic Fields Magnetic field lines enter one end (south) of magnet and exit the other end (north) Opposite magnetic poles attract like magnetic poles repel #12;Like the electric field lines

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University

429

Integrated null-flux suspension and multiphase propulsion system for magnetically-levitated vehicles  

DOE Patents [OSTI]

This report discusses a propulsion and stabilization system comprising a series of figure 8 coils mounted vertically on the walls of the guideway to provide suspension, lateral guidance and propulsion of a magnetically levitated vehicle. This system further allows for altering the magnetic field effects by changing the relative position of the loops comprising the figure 8 coils either longitudinally and/or vertically with resulting changes in the propulsion, the vertical stability, and the suspension.

Rote, D.M.; He, Jianliang; Johnson, L.R.

1992-01-01T23:59:59.000Z

430

Theoretical comparison between field emission from single-wall and multi-wall carbon nanotubes A. Mayer,1,  

E-Print Network [OSTI]

Theoretical comparison between field emission from single-wall and multi-wall carbon nanotubes A s : 73.63.Fg, 79.70. q, 85.35.Kt, 03.65.Nk I. INTRODUCTION Carbon nanotubes show interesting field-emission of field emission from carbon nanotubes,13­16 we now consider the depen- dence of the emission from single

Mayer, Alexandre

431

HTS Magnet Program | Superconducting Magnet Division  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HTS Magnet Program HTS Magnet Program High Temperature Superconductors (HTS) have the potential to revolutionize the field of superconducting magnets for particle accelerators, energy storage and medical applications. This is because of the fact that as compared to the conventional Low Temperature Superconductors (LTS), the critical current density (Jc ) of HTS falls slowly both: as a function of increasing field, and as a function of increasing temperature These unique properties can be utilized to design and build: HTS magnets that produce very high fields (20 - 50 T) HTS magnets that operate at elevated temperatures (20 - 77 K) This is a significant step forward over the convention LTS magnets which generally operate at a temperature of ~4 K and with field usually limited

432

Nanocomposite Magnets: Transformational Nanostructured Permanent Magnets  

SciTech Connect (OSTI)

Broad Funding Opportunity Announcement Project: GE is using nanomaterials technology to develop advanced magnets that contain fewer rare earth materials than their predecessors. Nanomaterials technology involves manipulating matter at the atomic or molecular scale, which can represent a stumbling block for magnets because it is difficult to create a finely grained magnet at that scale. GE is developing bulk magnets with finely tuned structures using iron-based mixtures that contain 80% less rare earth materials than traditional magnets, which will reduce their overall cost. These magnets will enable further commercialization of HEVs, EVs, and wind turbine generators while enhancing U.S. competitiveness in industries that heavily utilize these alternatives to rare earth minerals.

None

2010-10-01T23:59:59.000Z

433

Tree based domain-specific mapping languages  

Science Journals Connector (OSTI)

Model transformation languages have been mainly used by researchers --- the software engineering industry has not yet widely accepted the model driven software development (MDSD). One of the main reasons is the complexity of metamodelling principles ... Keywords: UML, domain-specific languages, mappings, model transformation languages

Elina Kalnina; Audris Kalnins; Agris Sostaks; Edgars Celms; Janis Iraids

2012-01-01T23:59:59.000Z

434

Synthesis for Regular Specifications over Unbounded Domains  

E-Print Network [OSTI]

Synthesis for Regular Specifications over Unbounded Domains Jad Hamza # , Barbara Jobstmann + , Viktor Kuncak # # ENS Cachan, France + CNRS/Verimag, France, # EPFL, Switzerland Abstract---Synthesis that are correct by construction. Previous work includes synthesis of reactive finite­state systems from linear

Kuncak, Viktor

435

Synthesis for Regular Specifications over Unbounded Domains  

E-Print Network [OSTI]

Synthesis for Regular Specifications over Unbounded Domains Jad Hamza, Barbara Jobstmann, Viktor Kuncak ENS Cachan, France CNRS/Verimag, France, EPFL, Switzerland Abstract--Synthesis from specifications is a promising method of obtaining systems that are correct by construction. Previous work includes synthesis

Jobstmann, Barbara

436

Synthesis for Regular Specifications over Unbounded Domains  

E-Print Network [OSTI]

Synthesis for Regular Specifications over Unbounded Domains Jad Hamza, Barbara Jobstmann, Viktor Kuncak ENS Cachan, France CNRS/Verimag, France, EPFL, Switzerland Abstract--Synthesis from declarative. Previous work includes synthesis of reactive finite-state systems from linear temporal logic and its

Kuncak, Viktor

437

Large power grid analysis using domain decomposition  

E-Print Network [OSTI]

Large power grid analysis using domain decomposition Quming Zhou, Kai Sun, Kartik Mohanram, Danny C referred to as the power grid. The power grid for a modern integrated circuit may consist of several grid is traditionally described as a large-scale linear system. Simulation of power grids usually

Mohanram, Kartik

438

Competency Patient Care Sub Domain Procedures  

E-Print Network [OSTI]

Competency Patient Care Sub Domain Procedures Learning Objective Understands informed consent and performs uncomplicated procedures on patients or in simulation Milestones Year I Year II Year III Year IV Mid End Mid End Mid End Mid End · Defines elements of informed consent for procedures · Explains

Leistikow, Bruce N.

439

Processing electromagnetic data in the time domain  

Science Journals Connector (OSTI)

......necessary to allot storage for the full...the two impulse response functions A and...functions of frequency) that can be...components over all frequencies but a unique...in either the frequency or the time domain...and there is no energy in the direction...unknown impulse response vector A......

George A. McMechan; Ian Barrodale

1985-04-01T23:59:59.000Z

440

Data challenges of time domain astronomy  

Science Journals Connector (OSTI)

Astronomy has been at the forefront of the development of the techniques and methodologies of data intensive science for over a decade with large sky surveys and distributed efforts such as the Virtual Observatory. However, it faces a new data deluge ... Keywords: Astronomy, Classification, Time domain, Virtual observatory

Matthew J. Graham; S. G. Djorgovski; Ashish Mahabal; Ciro Donalek; Andrew Drake; Giuseppe Longo

2012-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Pneumatic wall-locking geophone system  

DOE Patents [OSTI]

A seismic signal receiving system is provided for use in boreholes to receive seismic waves in carrying out geophysical investigations. The system includes three pairs of opposed plates, each of the pairs of plates including oppositely facing outer surfaces for engagement with opposite sides of a borehole. A seismic receiver is mounted on the inner surface of each of the plates for receiving seismic signals. A double-acting, fluid-operated actuator selectively causes relative movement of the plates of the pairs of plates away from each other to provide expansion thereof so as to enable the plates to engage the walls of a borehole and selectively causes relative movement of the plates of the pairs of plates toward each other to provide retraction thereof so as to enable the system to be removed from a borehole. The pairs of plates each comprise a relatively long plate and a relatively short plate. An expandable linkage interconnects the long plates at the distal ends thereof. The plates are mechanically biassed into the retracted state so that the plates return to this state in the event of a system failure.

Kuhlman, Harland L. (Minneapolis, MN); Cumerlato, Calvin L. (Minneapolis, MN); Tweeton, Daryl R. (Apple Valley, MN)

1991-01-01T23:59:59.000Z

442

Liquid metal MHD studies with non-magnetic and ferro-magnetic structural material  

Science Journals Connector (OSTI)

Abstract In most of the liquid metal MHD experiments reported in the literature to study liquid breeder blanket performance, SS316/SS304 grade steels are used as the structural material which is non-magnetic. On the other hand, the structural material for fusion blanket systems has been proposed to be ferritic martensitic grade steel (FMS) which is ferromagnetic in nature. In the recent experimental campaign, liquid metal MHD experiments have been carried out with two identical test sections: one made of SS316L (non-magnetic) and another with SS430 (ferromagnetic), to compare the effect of structural materials on MHD phenomena for various magnetic fields (up to 4 T). The maximum Hartmann number and interaction number are 1047 and 300, respectively. Each test section consists of square channel (25 mm × 25 mm) cross-section with two U bends, with inlet and outlet at the middle portion of two horizontal legs, respectively. Pb–Li enters into the test section through a square duct and distributed into two parallel paths through a partition plate. In each parallel path, it travels ?0.28 m length in plane perpendicular to the magnetic field and faces two 90° bends before coming out of the test section through a single square duct. The wall electrical potential and MHD pressure drop across the test sections are compared under identical experimental conditions. Similar MHD behavior is observed with both the test section at higher value of the magnetic field (>2 T).

A. Patel; R. Bhattacharyay; P.K. Swain; P. Satyamurthy; S. Sahu; E. Rajendrakumar; S. Ivanov; A. Shishko; E. Platacis; A. Ziks

2014-01-01T23:59:59.000Z

443

Innovative Sensors for Pipeline Crawlers: Rotating Permanent Magnet Inspection  

SciTech Connect (OSTI)

Internal inspection of pipelines is an important tool for ensuring safe and reliable delivery of fossil energy products. Current inspection systems that are propelled through the pipeline by the product flow cannot be used to inspect all pipelines because of the various physical barriers they may encounter. To facilitate inspection of these ''unpiggable'' pipelines, recent inspection development efforts have focused on a new generation of powered inspection platforms that are able to crawl slowly inside a pipeline and can maneuver past the physical barriers that limit internal inspection applicability, such as bore restrictions, low product flow rate, and low pressure. The first step in this research was to review existing inspection technologies for applicability and compatibility with crawler systems. Most existing inspection technologies, including magnetic flux leakage and ultrasonic methods, had significant implementation limitations including mass, physical size, inspection energy coupling requirements and technology maturity. The remote field technique was the most promising but power consumption was high and anomaly signals were low requiring sensitive detectors and electronics. After reviewing each inspection technology, it was decided to investigate the potential for a new inspection method. The new inspection method takes advantage of advances in permanent magnet strength, along with their wide availability and low cost. Called rotating permanent magnet inspection (RPMI), this patent pending technology employs pairs of permanent magnets rotating around the central axis of a cylinder to induce high current densities in the material under inspection. Anomalies and wall thickness variations are detected with an array of sensors that measure local changes in the magnetic field produced by the induced current flowing in the material. This inspection method is an alternative to the common concentric coil remote field technique that induces low-frequency eddy currents in ferromagnetic pipes and tubes. Since this is a new inspection method, both theory and experiment were used to determine fundamental capabilities and limitations. Fundamental finite element modeling analysis and experimental investigations performed during this development have led to the derivation of a first order analytical equation for designing rotating magnetizers to induce current and positioning sensors to record signals from anomalies. Experimental results confirm the analytical equation and the finite element calculations provide a firm basis for the design of RPMI systems. Experimental results have shown that metal loss anomalies and wall thickness variations can be detected with an array of sensors that measure local changes in the magnetic field produced by the induced current flowing in the material. The design exploits the phenomenon that circumferential currents are easily detectable at distances well away from the magnets. Current changes at anomalies were detectable with commercial low cost Hall Effect sensors. Commercial analog to digital converters can be used to measure the sensor output and data analysis can be performed in real time using PC computer systems. The technology was successfully demonstrated during two blind benchmark tests where numerous metal loss defects were detected. For this inspection technology, the detection threshold is a function of wall thickness and corrosion depth. For thinner materials, the detection threshold was experimentally shown to be comparable to magnetic flux leakage. For wall thicknesses greater than three tenths of an inch, the detection threshold increases with wall thickness. The potential for metal loss anomaly sizing was demonstrated in the second benchmarking study, again with accuracy comparable to existing magnetic flux leakage technologies. The rotating permanent magnet system has the potential for inspecting unpiggable pipelines since the magnetizer configurations can be sufficiently small with respect to the bore of the pipe to pass obstructions that limit the application of many i

J. Bruce Nestleroth; Richard J. Davis; Stephanie Flamberg

2006-09-30T23:59:59.000Z

444

Non-steady state heat conduction in composite walls  

E-Print Network [OSTI]

The problem of heat conduction in one-dimensional piecewise homogeneous composite materials is examined by providing an explicit solution of the one-dimensional heat equation in each domain. The location of the interfaces is known, but neither temperature nor heat flux are prescribed there. Instead, the physical assumptions of their continuity at the interfaces are the only conditions imposed. The problem of two semi-infinite domains and that of two finite-sized domains are examined in detail. We indicate also how to extend the solution method to the setting of one finite-sized domain surrounded on both sides by semi-infinite domains, and on that of three finite-sized domains.

Bernard Deconinck; Beatrice Pelloni; Natalie Sheils

2014-02-12T23:59:59.000Z

445

Tamper resistant magnetic stripes  

DOE Patents [OSTI]

This invention relates to a magnetic stripe comprising a medium in which magnetized particles are suspended and in which the encoded information is recorded by actual physical rotation or alignment of the previously magnetized particles within the flux reversals of the stripe which are 180.degree. opposed in their magnetic polarity. The magnetized particles are suspended in a medium which is solid, or physically rigid, at ambient temperatures but which at moderately elevated temperatures, such as 40.degree. C., is thinable to a viscosity permissive of rotation of the particles therein under applications of moderate external magnetic field strengths within acceptable time limits.

Naylor, Richard Brian (Albuquerque, NM); Sharp, Donald J. (Albuquerque, NM)

1999-01-01T23:59:59.000Z

446

Case history: Vertical barrier wall system for Superfund Site  

SciTech Connect (OSTI)

Design considerations and construction aspects are presented for the installation of a vertical barrier wall system for the Boeing Company at a Superfund Site near Seattle, WA. The construction was performed during 1996. The vertical barrier wall system included: (1) a soil-bentonite (SB) slurry wall, approximately 670 meters (2200 feet) in length, ranging from 12 to 21 meters (40 to 70 feet) in depth; (2) expansion of a cover system over the area enclosed by the SB wall; and (3) surface drainage improvements. Design and construction of the system addressed requirements of a Consent Decree for the site issued in 1993. The paper discusses the development of the design to meet remedial performance goals of preventing migration of contaminants in the soil/groundwater system and aiding aquifer restoration. Secondly, the paper details installation of the SB wall, highlighting the more significant construction issues, which included excavation of the wall through glacially deposited cobbles/boulders/till as well as addressing the severe elevation changes along the wall alignment. Thirdly, the paper presents Quality Assurance (QA) monitoring and testing performed during the construction phase.

Koelling, M.A.; Kovac, C.P.; Norris, J.E.

1997-12-31T23:59:59.000Z

447

A Survey of Databases for Analysis of Plant Cell Wall-Related Enzymes  

E-Print Network [OSTI]

Plant Cell Wall-Related Enzymes Peijian Cao & Ki-Hong Jung &plant cell wall-related enzymes. The goal of this review isfor Plant Cell Wall-Related Enzymes (plantcellwalls.ucdavis.

Cao, Peijian; Jung, Ki-Hong; Ronald, Pamela C.

2010-01-01T23:59:59.000Z

448

Conductance-Controlled Point Functionalization of Single-Walled Carbon Nanotubes  

E-Print Network [OSTI]

of Single-Walled Carbon Nanotubes Brett R. Goldsmith, 1 Johnof Single-Walled Carbon Nanotubes Brett R. Goldsmith et al.single-walled carbon nanotubes (SWNTs) to fabricate single-

Collins, Philip G

2007-01-01T23:59:59.000Z

449

Advanced Metal Fiber Wall-Flow DPF For Diesel Emission Control...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Metal Fiber Wall-Flow DPF For Diesel Emission Control Advanced Metal Fiber Wall-Flow DPF For Diesel Emission Control A new metal fiber wall-flow DPF with up to 99% efficiency and...

450

A High Resolution Ultrawideband Wall Penetrating Erman Engin, Berkehan iftiolu, Meri zcan and brahim Tekin  

E-Print Network [OSTI]

for underground mine detection [1], [2], through the wall imaging [3], cancerous tissue detection applications [4 respiratory activity of a human behind a 23 cm thick brick wall. Keywords: UWB Radar, Wall penetrating Radar

Yanikoglu, Berrin

451

SISGR – Domain Microstructures and Mechanisms for Large, Reversible and Anhysteretic Strain Behaviors in Phase Transforming Ferroelectric Materials  

SciTech Connect (OSTI)

This four-year project (including one-year no-cost extension) aimed to advance fundamental understanding of field-induced strain behaviors of phase transforming ferroelectrics. We performed meso-scale phase field modeling and computer simulation to study domain evolutions, mechanisms and engineering techniques, and developed computational techniques for nanodomain diffraction analysis; to further support above originally planned tasks, we also carried out preliminary first-principles density functional theory calculations of point defects and domain walls to complement meso-scale computations as well as performed in-situ high-energy synchrotron X-ray single crystal diffraction experiments to guide theoretical development (both without extra cost to the project thanks to XSEDE supercomputers and DOE user facility Advanced Photon Source).

Wang, Yu

2013-12-06T23:59:59.000Z

452

Potential formation in a collisionless plasma produced in an open magnetic field in presence of volume negative ion source  

SciTech Connect (OSTI)

The electric potential near a wall for a multi-species plasma with volume produced negative ions in presence of axially varying magnetic field is studied following an analytical-numerical approach. A constant negative ion source is assumed throughout the plasma volume, along with finite temperature positive ions and Boltzmann electrons. The particles are assumed to be guided by an open magnetic field that has its maximum at the centre, and field strength decreasing towards the walls. The one dimensional (1D) Poisson equation is derived using an analytical approach, and then solved numerically to study the potential profiles. Effect of (a) negative ion production rate, (b) magnetic field profile, and (c) negative ion temperature on the potential profile has been investigated. A potential peak appears near the wall when the negative ion temperature and density are sufficiently high. Also, the presence of negative ions further decreases the potential in the plasma region for a finite Debye Length (?{sub D})

Phukan, Ananya, E-mail: ananya.phukan26@gmail.com; Goswami, K. S.; Bhuyan, P. J. [Centre of Plasma Physics, Institute for Plasma Research Sonapur, Kamrup (M), Assam 782402 (India)

2014-08-15T23:59:59.000Z

453

Conceptual design of the INTOR first-wall system  

SciTech Connect (OSTI)

The design concept and performance characteristics of the first-wall design for the phase-1 INTOR (International Tokamak Reactor) study is described. The reference design consists of a water-cooled stainless steel panel. The major uncertainty regarding the performance of the bare stainless steel wall relates to the response of a thin-melt layer predicted to form on limited regions during a plasma disruption. A more-complex backup design, which incorporates radiatively cooled graphite tiles on the inboard wall, is briefly described.

Smith, D.L.; Majumdar, S.; Mattas, R.F.; Turner, L.; Jung, J.; Abdou, M.A.; Bowers, D.; Trachsel, C.; Merrill, B.

1981-10-01T23:59:59.000Z

454

Crystalline mesoporous zirconia catalysts having stable tetragonal pore wall structure  

DOE Patents [OSTI]

Methods are disclosed for the preparation of new sulfated mesoporous zirconia materials/catalysts with crystalline pore walls of predominantly tetragonal crystal structure, characterized by nitrogen physical sorption measurement, X-ray diffraction, transmission electron microscopy and catalytic tests using n-butane isomerization to iso-butane and alkylation of 1-naphthol with 4-tert-butylstyrene as probe reactions. Sulfate deposition is preferred for the transformation of a mesoporous precursor with amorphous pore walls into a material with crystalline pore walls maintaining the mesoporous characteristics. 17 figs.

Sachtler, W.M.H.; Huang, Y.Y.

1998-07-28T23:59:59.000Z

455

Understanding Quasi-Periodic Fieldlines and Their Topology in Toroidal Magnetic Fields  

E-Print Network [OSTI]

the periodicity analysis of these two functions, we are able to devise a heuristic yet robust and reliable surfaces. Different from our previous method [12], in this work we resort to the periodicity analysis the wall of the fusion reactor. To distinguish the magnetic island chains from other flux surfaces, we

Chen, Guoning

456

Free magnetohydrodynamic shear layers in the presence of rotation and magnetic fielda)  

E-Print Network [OSTI]

Free magnetohydrodynamic shear layers in the presence of rotation and magnetic fielda) E. J. Spence and numerical study of hydrodynamic and magnetohydrodynamic free shear layers and their stability. We first typically reach zero velocity at the bounding wall. A shear layer is called "free" when it exists

Ji, Hantao

457

Tailored Distribution of Single-Wall Carbon Nanotubes from Arc Plasma Synthesis Using Magnetic Fields  

Science Journals Connector (OSTI)

We would like to acknowledge PPPL Offsite Research Program supported by the Office of Fusion Energy Sciences for supporting arc experiments. ...

Olga Volotskova; Jeffrey A. Fagan; Ji Yeon Huh; Frederick R. Phelan Jr.; Alexey Shashurin; Michael Keidar

2010-08-13T23:59:59.000Z

458

National High Magnetic Field Laboratory: An Introduction to Magnets...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

resistive magnet is here at the Magnet Lab: It can generate a sustained magnetic field of 35 tesla. (Were not counting here our world-record hybrid magnet or the stronger,...

459

3D analysis of magnetization distribution magnetized by capacitor-discharge impulse magnetizer  

Science Journals Connector (OSTI)

Method for calculating the magnetization distribution magnetized by capacitor-discharge impulse magnetizer is expanded to 3D, and the calculated flux distribution is compared with measured one.

Norio Takahashi

2001-01-01T23:59:59.000Z

460

Spin and orbital magnetization loops obtained using magnetic Compton scattering  

SciTech Connect (OSTI)

We present an application of magnetic Compton scattering (MCS) to decompose a total magnetization loop into spin and orbital magnetization contributions. A spin magnetization loop of SmAl{sub 2} was measured by recording the intensity of magnetic Compton scattering as a function of applied magnetic field. Comparing the spin magnetization loop with the total magnetization one measured by a vibrating sample magnetometer, the orbital magnetization loop was obtained. The data display an anti-coupled behavior between the spin and orbital magnetizations and confirm that the orbital part dominates the magnetization.

Itou, M.; Sakurai, Y. [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan)] [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan); Koizumi, A. [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)] [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)

2013-02-25T23:59:59.000Z

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Exciton-phonon bound complex in single-walled carbon nanotubes revealed by high-field magneto-optical spectroscopy  

SciTech Connect (OSTI)

High-field magneto-optical spectroscopy was performed on highly enriched (6,5) single-walled carbon nanotubes. Spectra of phonon sidebands in both 1st and 2nd sub-bands were unchanged by an external magnetic field up to 52?T. The dark K-momentum singlet (D-K-S) exciton, which plays an important role for the external quantum efficiency of the system for both sub-bands in the near-infrared and the visible light region, respectively, was clarified to be the origin of the phonon sidebands.

Zhou, Weihang; Nakamura, Daisuke; Takeyama, Shojiro, E-mail: takeyama@issp.u-tokyo.ac.jp [Institute for Solid State Physics, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan)] [Institute for Solid State Physics, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan); Sasaki, Tatsuya; Saito, Hiroaki [Institute for Solid State Physics, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan) [Institute for Solid State Physics, University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan); Department of Applied Physics, University of Tokyo, Hongo 113-8656 (Japan); Liu, Huaping [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)] [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Kataura, Hiromichi [Nanosystem Research Institute, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562 (Japan)] [Nanosystem Research Institute, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562 (Japan)

2013-12-02T23:59:59.000Z

462

Recent lunar magnetism  

E-Print Network [OSTI]

The magnetization of young lunar samples (magnetic fields (e.g. core dynamo and long-lived impact plasma fields) have not been present within the last 1.5 Ga. To better ...

Buz, Jennifer

2011-01-01T23:59:59.000Z

463

Metallic Magnetic Hetrostructures  

E-Print Network [OSTI]

This work studied sputter deposited conventional spin valves (SV) and related structures. In SV layered structures, two ferromagnetic layers are separated by a non-magnetic spacer. Under an external magnetic field, the relative orientation...

Leung, Chi Wah

464

Plasma Magnetic Insulation  

Science Journals Connector (OSTI)

29 June 1987 research-article Plasma Magnetic Insulation B. B. Kadomtsev Theoretically the strong magnetic field of a tokamak should confine electrons and ions in a high-temperature...

1987-01-01T23:59:59.000Z

465

Magnetic assisted statistical assembly  

E-Print Network [OSTI]

The objective of this thesis is to develop a process using magnetic forces to assemble micro-components into recesses on silicon based integrated circuits. Patterned SmCo magnetic thin films at the bottom of recesses are ...

Cheng, Diana I

2008-01-01T23:59:59.000Z

466

Magnetic Nanoparticle NANOMATERIALS  

E-Print Network [OSTI]

Magnetic Nanoparticle Metrology NANOMATERIALS We are developing best practice metrology for characterization of magnetic nanoparticle systems (e.g. blocking temperature, anisotropy, property distributions, T nanoparticles and provide guidelines to the FDA to properly compare systems when approving nanoparticle systems

467

Uranium Monochalcogenides: Magnetic Form Factor and Magnetic Neutron Scattering  

Science Journals Connector (OSTI)

Fig. R.66. UY. (A) Magnetic form factor. The radial ?j i? integrals, which contribute to the neutron magnetic fo...

R. Tro?

2009-01-01T23:59:59.000Z

468

LHC Magnet Program | Superconducting Magnet Division  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Magnet Program Magnet Program The Superconducting Magnet Division is building a number of dipole magnets for the Large Hadron Collider (LHC), which is now under construction at CERN in Geneva, Switzerland. Scheduled to begin operation in 2007, this machine will collide beams of protons with the unprecedented energy of 7 TeV per beam to explore the nature of matter at its most basic level (RHIC can collide beams of protons with energies of 0.25 TeV, but is mostly used to collide heavy ions with energies of 0.1 TeV per nucleon). The magnets are being built as part of the US program, recommended by the High Energy Physics Advisory Panel (HEPAP) and approved by Congress, to contribute to the construction and, later, use of that frontier machine by the US high energy physics community. Fermi National Accelerator Laboratory (FNAL) and

469

E-Print Network 3.0 - anterior vaginal wall Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

vaginal wall Search Powered by Explorit Topic List Advanced Search Sample search results for: anterior vaginal wall Page: << < 1 2 3 4 5 > >> 1 Anterior repair using Bologna...

470

E-Print Network 3.0 - aligned single-walled carbon Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Summary: Thermal conductivity measurement of vertically-aligned single-walled carbon nanotubes by 3 omega... the high-purity vertically aligned single-walled carbon nanotubes 2,...

471

E-Print Network 3.0 - aligned double-walled carbon Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Summary: , and H. M. Cheng. Polarized raman analysis of aligned double- walled carbon nanotubes. Physical Review B... Nonlinear Oscillations of a Double-Walled Carbon Nanotube...

472

E-Print Network 3.0 - antibody-functionalized single-walled carbon...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

5 > >> 1 Molecular Dynamics Simulation of Nucleation Process of Single-Walled Carbon Nanotubes Summary: Molecular Dynamics Simulation of Nucleation Process of Single-Walled Carbon...

473

E-Print Network 3.0 - aligned single wall Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Summary: Thermal conductivity measurement of vertically-aligned single-walled carbon nanotubes by 3 omega... the high-purity vertically aligned single-walled carbon nanotubes 2,...

474

Budding of domains in mixed bilayer membranes  

E-Print Network [OSTI]

We propose a model that accounts for budding behavior of domains in lipid bilayers, where each of the bilayer leaflets has a coupling between its local curvature and local lipid composition. The compositional asymmetry between the two monolayers leads to an overall spontaneous curvature. The membrane free-energy contains three contributions: bending energy, line tension, and a Landau free-energy for a lateral phase separation. Within a mean-field treatment, we obtain various phase diagrams which contain fully-budded, dimpled and flat states. In particular, for some range of membrane parameters, the phase diagrams exhibit a tricritical behavior as well as three-phase coexistence region. The global phase diagrams can be divided into three types and are analyzed in terms of the curvature-composition coupling parameter and domain size.

Wolff, Jean; Andelman, David

2014-01-01T23:59:59.000Z

475

Budding of domains in mixed bilayer membranes  

E-Print Network [OSTI]

We propose a model that accounts for budding behavior of domains in lipid bilayers, where each of the bilayer leaflets has a coupling between its local curvature and local lipid composition. The compositional asymmetry between the two monolayers leads to an overall spontaneous curvature. The membrane free-energy contains three contributions: bending energy, line tension, and a Landau free-energy for a lateral phase separation. Within a mean-field treatment, we obtain various phase diagrams which contain fully-budded, dimpled and flat states. In particular, for some range of membrane parameters, the phase diagrams exhibit a tricritical behavior as well as three-phase coexistence region. The global phase diagrams can be divided into three types and are analyzed in terms of the curvature-composition coupling parameter and domain size.

Jean Wolff; Shigeyuki Komura; David Andelman

2014-10-14T23:59:59.000Z

476

Magnetic susceptibility in QCD  

E-Print Network [OSTI]

Magnetic susceptibility in the deconfined phase of QCD is calculated in a closed form using a recent general expression for the quark gas pressure in magnetic field. Quark selfenergies are entering the result via Polyakov line factors and ensure the total paramagnetic effect, increasing with temperature. A generalized form of magnetic susceptibility in nonzero magnetic field suitable for experimental and lattice measurements is derived, showing a good agreement with available lattice data.

V. D. Orlovsky; Yu. A. Simonov

2014-05-12T23:59:59.000Z

477

Domain growth in the clock model  

Science Journals Connector (OSTI)

The development of order in the clock (ZN) model is studied following a quench from the disordered phase to a low-temperature unstable state below the ferromagnetic critical point. Growth laws for the average size of domains are obtained by computer simulation for N=3, 4, 8, 16, and 26 degenerate states. In disagreement with recent Monte Carlo work, no pinning by vortices is observed.

Kimmo Kaski; Martin Grant; J. D. Gunton

1985-03-01T23:59:59.000Z

478

Magnetism Theory Group / POSTECH Magnetism Theory Group / POSTECH  

E-Print Network [OSTI]

Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH J.H . Park et al. #12;'s of FeinCsm e tal The chargeandorbitalordering geom etryin YB a C o 2 O 5 S. K. Kwon etal .Magnetism Theory

Min, Byung Il

479

HYDRATE DISSOCIATION IN A 1-D DOMAIN  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HYDRATE DISSOCIATION IN A 1-D DOMAIN HYDRATE DISSOCIATION IN A 1-D DOMAIN I. Domain Description 1-D Cartesian system, L x W x H = 1.5 m x 1.0 m x 1.0 m Discretization: 30 x 1 x 1 in (x,y,z) Uniform Δx = 0.05 m each; Δy = Δz = 1 m II. Initial Conditions Pressure: P i = 8 MPa Temperature: T i = 2 o C (for thermal stimulation), T i = 6 o C (for depressurization) Saturations: S H = 0.5, S A = 0.5, S G = 0.0 III. Boundary Conditions At x = X max : No mass or heat flow At x = 0: Constant S A = 1.0 (1) Constant P 0 = P i Constant T 0 = 45 o C Thermal stimulation (2) Constant T 0 = T i = 6 o C Constant P 0 = 2.8 MPa Depressurization to a pressure above the Q-point, no ice formation (3) Constant T 0 = T i = 6 o C Constant P 0 = 0.5 MPa Depressurization to a pressure below the Q-point,

480

NREL: News Feature - NREL Breaks Down Walls for Biofuels  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

NREL Breaks Down Walls for Biofuels NREL Breaks Down Walls for Biofuels November 30, 2009 Researchers at the National Renewable Energy Laboratory (NREL) and ethanol producers are racing to come up with ways to make ethanol from cellulosic biomass that are cheaper and easier to produce than current methods. But they are hitting a wall. Cell walls in plants are making the production of cellulosic ethanol a challenge. So researchers are creating their own computer program to help model and break down the tiny fibers of cellulose - or fibrils - found in plant cells. Although ethanol is becoming more available to consumers, NREL is working closely with the U.S. Department of Energy (DOE) to meet a quickly approaching goal to produce competitively priced ethanol for $1.50 per gallon by 2012. Why the rush? DOE believes this is the price at which

Note: This page contains sample records for the topic "magnetic domain walls" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Experimental Investigation of Natural Convection in Trombe Wall Systems  

E-Print Network [OSTI]

In this paper, experiments with a passive solar building with Trombe wall in the north cold climate are carried out and discussed, and the natural convection heat transfer process has been investigated. The relativity of the factors affecting indoor...

Chen, B.; Zhao, J.; Chen, C.; Zhuang, Z.

2006-01-01T23:59:59.000Z

482

Accident Simulation Tests on a Wet-Wall LNG Design  

Science Journals Connector (OSTI)

The “wet wall” design concept for containing cryogenic Hquids has been successfully employed in the Apollo space program [1...] and may be described as a double-hulled tank with a liquid-tight insulation system. ...

P. O. Metz; R. W. Lautensleger; D. A. Sarno

1977-01-01T23:59:59.000Z

483

High-R Walls - Building America Top Innovation | Department of...  

Broader source: Energy.gov (indexed) [DOE]

R values and the need for vented cladding to reduce condensation potential with some insulation types. Research on common high-R wall assemblies has shown that the measured R-value...

484

Superconductivity in Bundles of Double-Wall Carbon Nanotubes  

E-Print Network [OSTI]

We present electrical and thermal specific heat measurements that show superconductivity in double-wall carbon nanotube (DWCNT) bundles. Clear evidence, comprising a resistance drop as a function of temperature, magnetoresistance ...

Shi, Wu

485

Building America Case Study: Evaluating Through-Wall Air Transfer...  

Energy Savers [EERE]

the performance of market-available through-wall air transfer fans with respect to Air Conditioning Contractors of America (ACCA) Manual RS and ASHRAE Standard 55-2010...

486

Xylan deposition on secondary wall of Fagus crenata fiber  

Science Journals Connector (OSTI)

...Delignified and/or xylanase-treated secondary walls of Fagus crenata fibers were examined by field emission scanning electron microscopy. Microfibrils with a smooth surface were visible in the innermost surface

T. Awano; K. Takabe; M. Fujita

2002-02-01T23:59:59.000Z

487

Characterization of double walled carbon nanotubes-polyvinylidene fluoride nanocomposites  

E-Print Network [OSTI]

One of the main objectives of this thesis is to disperse double-walled carbon nanotubes (DWNT) in a polyvinylidene fluoride (PVDF) matrix, and to characterize the resulting composite using electrical, thermal, and mechanical characterization...

Almasri, Atheer Mohammad

2007-04-25T23:59:59.000Z

488

Dynamic analysis of concrete coupled wall structures : a parametric study  

E-Print Network [OSTI]

Concrete coupled wall structure is a system that can efficiently dissipate energy under the effect of lateral loads. It has been widely used in medium height buildings for several decades. While researchers have conducted ...

Huang, Elaine Annabelle, 1981-

2005-01-01T23:59:59.000Z

489

Conserval aka SolarWall | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search Name: Conserval (aka SolarWall) Place: Toronto, Ontario, Canada Zip: M3J2N5 Sector: Solar Product: Makes solar passive heating and cooling...

490

RESEARCH: Argonne's Super Magnet  

Science Journals Connector (OSTI)

RESEARCH: Argonne's Super Magnet ... The world's largest superconducting magnet has been successfully built and operated by Argonne National Laboratory, at Argonne, Ill. ... The magnet will be part of Argonne's bubble chamber, also the world's largest, which should be completed on schedule this summer. ...

1969-02-03T23:59:59.000Z

491

Noble gas magnetic resonator  

DOE Patents [OSTI]

Precise measurements of a precessional rate of noble gas in a magnetic field is obtained by constraining the time averaged direction of the spins of a stimulating alkali gas to lie in a plane transverse to the magnetic field. In this way, the magnetic field of the alkali gas does not provide a net contribution to the precessional rate of the noble gas.

Walker, Thad Gilbert; Lancor, Brian Robert; Wyllie, Robert

2014-04-15T23:59:59.000Z

492

Magnetism in transition metals  

Science Journals Connector (OSTI)

By using the Hubbard tight-binding-type Hamiltonian and the cluster Bethe-lattice approximation we calculate for Fe the Curie temperature TC=2250 K and the temperature dependence of the magnetic moments and the magnetization. Moreover, we show how previous theories for itinerant magnets may be extended to include short-range spin correlations.

J. L. Morán-López; K. H. Bennemann; M. Avignon

1981-06-01T23:59:59.000Z

493

A Study in Magnetism  

Science Journals Connector (OSTI)

... this century, for the simple comprehensiveness and original beauty of his researches in electricity and magnetism; chiefly, perhaps, for his discovery of magneto-electricity—the kind of electricity that ... space surrounding a magnet was thrown into a peculiar condition by the presence of the magnetism. Two centuries previously another Englishman, as uniquely great if not greater, Dr. Gilbert ...

SILVANUS P. THOMPSON

1878-11-28T23:59:59.000Z

494

Field measurements of earth pressure on a cantilever retaining wall  

E-Print Network [OSTI]

. The measurements were made before and after backfilling for a duration of 385 days. The effects of a clay surcharge were studied. The total thrust of the measured lateral earth pressures was com- pared to total thrust determined from a Culmann graphical... to bearing pressures calculated by conventional methods. The measured bearing pressures compared reasonably well with the calculated pressures. Wall movement data indicated that the wall tilted or rotated toward the backfill during sand backfilling...

Schulze, Larry Wayne

2012-06-07T23:59:59.000Z

495

Excess free energy of supercooled liquids at disordered walls  

E-Print Network [OSTI]

Using a novel thermodynamic integration scheme, we compute the excess free energy, $\\gamma$, of a glass-forming, binary Lennard-Jones liquid in contact with a frozen amorphous wall, formed by particles frozen into a similar structure as the liquid. We find that $\\gamma$ is non-zero, becoming negative at low temperature. This indicates that the thermodynamics of the system is perturbed by the effect of the amorphous wall.

Benjamin, Ronald

2014-01-01T23:59:59.000Z

496

Field measurement of lateral earth pressures on retaining walls  

E-Print Network [OSTI]

. The measured pressures are compared with the computed Coulomb and Rankine pressures for the active case. The measured pressures on the cantilever wall are in close agreement with the theoretical pressures on the upper half of the wall, but the measured... Pressure Variance with Time and Temperature. INTRODUCTION Present Status of the Question -- The latera1 earth pressure theories developed by Coulomb in 1776 and Rankine in 1S57 are known as the classical earth pressure theories (5)*. The basic equation...

Riggins, Michael

2012-06-07T23:59:59.000Z

497

Potential digestibilities and digestion kinetics of forage cell wall components  

E-Print Network [OSTI]

LITERATURE REVIEW. EXPERIMENTAL PROCEDURES. Chemical Analysis Colorimetric Determinations Statistical Evaluation. 10 13 15 IV RESULTS AND DISCUSSION 16 V Characteristics of Forage Kinetics of Cell Wall Digestion SUMMARY AND CONCLUSIONS... and both of these variables appear to be the result of several dynamic processes. The amount of structural carbohydrates, the main constituents of the fibrous cell wall, ruminants can digest appears to be limited by the potential digestibility...

Tauskey, William Henry

1973-01-01T23:59:59.000Z

498

LiveWall Operational Evaluation: Seattle Law Enforcement Pilot  

SciTech Connect (OSTI)

The LiveWall concept envisioned as an outgrowth of the Precision Information Environment (PIE) project allows communications between separate groups using interactive video, audio, and a shared desktop environment; this allows everyone to participate and collaborate in real time, regardless of location. The LiveWall concept provides a virtual window to other locations, where all parties can interact and collaboratively work with each other. This functionality is intended to improve multi-site coordination amongst emergency operations centers (EOC), field operations sites and across organizations and jurisdictions to accommodate communications during routine and emergency events. For the initial LiveWall operational evaluation PNNL partnered with the Seattle Police Department (SPD). This partnership allowed for the creation of an excellent LiveWall test bed specific to law enforcement. This partnership made it possible to test the LiveWall concept with scenarios involving the many facets of the law enforcement work done by SPD. PNNL and SPD agreed that integrating the systems into operations for a real event would be the best test of the technology and give SPD staff greater visibility into the functionality and benefits offered by the LiveWall concept.

Barr, Jonathan L.; Burtner, Edwin R.; Stein, Steven L.

2013-10-01T23:59:59.000Z

499

The Task Agent Resource Function application in UAV domain  

E-Print Network [OSTI]

The Task Agent Resource Function application in UAV domain Tan Viet Anh Truong Ecole National is to present an application of TARF (Task Agent Resource Function) in UAV domain. This TARF is used to optimize of a generic mission planner for cross domain such as UAV, maritime, automotive and manned aerial vehicle (MAV

Paris-Sud XI, Université de

500

Grammar-Based Testing using Realistic Domains in PHP  

E-Print Network [OSTI]

Grammar-Based Testing using Realistic Domains in PHP Ivan Enderlin, Fr´ed´eric Dadeau, Alain-based testing in PHP. It relies on the notion of realistic domains, that make it possible to assign domains to data, by means of contract assertions written inside the source code of a PHP application. Then a test

Paris-Sud XI, Université de