National Library of Energy BETA

Sample records for m-f mail orders

  1. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  2. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  3. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  4. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  5. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  6. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  7. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  8. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  9. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  10. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  11. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  12. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  13. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  14. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  15. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  16. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  17. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  18. M F

    Gasoline and Diesel Fuel Update (EIA)

    Energy Technology Laboratory Driving Innovation ♦ Delivering Results Timothy J. Skone, PE 2015 EIA Energy Conference, Washington, D.C. June 15, 2015 Life Cycle Greenhouse Gas Emissions: Natural Gas and Power Production 2 National Energy Technology Laboratory Agenda * Importance of Understanding GHG Emissions from the Power and Natural Gas Sectors * Understanding the Life Cycle GHG Emissions of Natural Gas * Understanding the Life Cycle GHG Emissions of Power Production 3 National Energy

  19. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  20. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  1. ORDER

    Energy Savers [EERE]

    PP&L EnergyPlus Company Order No. EA-210 I. BACKGROUND Exports of electricity from the United States to a foreign country are regulated and require authorization under section 202(e) of the Federal Power Act (FPA) (16 U.S.C. §824a(e)). On May 4, 1999, PP&L EnergyPlus Company (PP&L EnergyPlus) applied to the Office of Fossil Energy (FE) of the Department of Energy (DOE) for authorization to transmit electric energy to Canada as a power marketer. PP&L EnergyPlus, a limited

  2. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  3. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  4. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  5. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  6. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  7. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  8. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  9. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  10. MODEL 9977 B(M)F-96 SAFETY ANALYSIS REPORT FOR PACKAGING

    SciTech Connect (OSTI)

    Abramczyk, G; Paul Blanton, P; Kurt Eberl, K

    2006-05-18

    This Safety Analysis Report for Packaging (SARP) documents the analysis and testing performed on and for the 9977 Shipping Package, referred to as the General Purpose Fissile Package (GPFP). The performance evaluation presented in this SARP documents the compliance of the 9977 package with the regulatory safety requirements for Type B packages. Per 10 CFR 71.59, for the 9977 packages evaluated in this SARP, the value of ''N'' is 50, and the Transport Index based on nuclear criticality control is 1.0. The 9977 package is designed with a high degree of single containment. The 9977 complies with 10 CFR 71 (2002), Department of Energy (DOE) Order 460.1B, DOE Order 460.2, and 10 CFR 20 (2003) for As Low As Reasonably Achievable (ALARA) principles. The 9977 also satisfies the requirements of the Regulations for the Safe Transport of Radioactive Material--1996 Edition (Revised)--Requirements. IAEA Safety Standards, Safety Series No. TS-R-1 (ST-1, Rev.), International Atomic Energy Agency, Vienna, Austria (2000). The 9977 package is designed, analyzed and fabricated in accordance with Section III of the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel (B&PV) Code, 1992 edition.

  11. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  12. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  13. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  14. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  15. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  16. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  17. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  18. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  19. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  20. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  1. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  2. Effect of sulfur isotopic composition of zinc and lead sulfides on the E. M. F. of electrochemical cells

    SciTech Connect (OSTI)

    Lusk, J.; Krouse, H.R.; Batts, B.D.

    1988-03-01

    A new effect is reported in which unexpectedly large voltages are produced by electrochemical cells containing sulfides at natural isotopic abundance levels. Room temperature experiments were undertaken to determine whether electrochemical cells employing silver bromide and silver beta alumina as solid electrolytes would be sufficiently sensitive to detect small variations in sulfur isotopic composition for zinc and lead sulfides. Voltages obtained for silver bromide cells tended to increase progressively over at least 20 days, and increased in a regular fashion with increasing differences in isotopic composition between charges. Voltages exceeding 150 mV were obtained for /sup delta/S/sup 3,4/ differences up to 85 per mil for zinc sulfide, but reached only about 20 mV for lead sulfide. Silver beta alumina cells with opposing zinc and lead sulfide charges yielded larger voltages and E.M.F. minimum corresponding to a +8(/plus minus/2) per mil difference. This value shows reasonable agreement with interpolated 20/degrees/C equilibrium values of between +7.5 to +9.8 obtained from the literature. Matured silver bromide cells with opposed zinc and lead sulfide charges behaved similarly but yielded lower voltages. Silver concentration cells of the opposed type are thus able to detect isotopic equilibrium and this will permit calibration of sulfur isotope thermometers down to unexpectedly low temperatures.

  3. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  4. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  5. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  6. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  7. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  8. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  9. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  10. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  11. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  13. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  14. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  15. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  16. TASK ORDER

    National Nuclear Security Administration (NNSA)

    NA0000XXX Task Order No: DE-DT000XXXX Statement of Work August 7, 2015 Task Order Title: Design, Integration, Construction, Communications, and Engineering (DICCE) Services for Port of Cat Lai, Vietnam. Scope: The Contractor shall design, construct, and integrate fully functional portal monitor and communications systems at designated sites in Vietnam. * Port of Cat Lai Requirements Documents: The following task order requirements describe key milestones and deliverables. For a more complete

  17. Ordering Information

    Gasoline and Diesel Fuel Update (EIA)

    coal industry Natural gas trade (Table 4.3) Ordering Information This publication and other Energy Information Administration (EIA) publications may be purchased from the...

  18. 1982 Orders

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOCKET FE CITE DATE NUMBER APPLICANT NAME ORDER NO. 70116.ERA 121482 82-04-LNG PhillipsMarathon 49 70552.ERA 113082 82-09-NG Northern Natural Gas 48 70541.ERA 110182...

  19. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  20. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  1. PURCHASE ORDER Mission Support Alliance, LLC ATTN: ACCOUNTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PURCHASE ORDER Mission Support Alliance, LLC ATTN: ACCOUNTS PAYABLE MSIN: Gl-80 PO BOX 650 RICHLAND WA 99352 Purchase Order Revision Release Printed Page 00046630 Mail Invoice To: 07/28/2011 1 Please Direct Inquiries to: STEVEN S. MYRICK Vendor: Title: CONTRACTING OFFICER COLUMBIA RIGGING CORP PO BOX 2717 PASCO WA 99302 MOTOR FREIGHT - P FOB Point TRUCK MISC TRUCK DEST PREPAY AND ADD Payment Terms % ERS N Reference Contract FOB Days Net 30 Days Transit Type Carrier Name Primary Ship To: HANFORD

  2. Polymers with increased order

    DOE Patents [OSTI]

    Sawan, Samuel P.; Talhi, Abdelhafid; Taylor, Craig M.

    1998-08-25

    The invention features polymers with increased order, and methods of making them featuring a dense gas.

  3. Compliance Order on Consent

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Compliance Order on Consent Compliance Order on Consent The Compliance Order on Consent provides the requirements for environmental cleanup of hazardous constituents for LANL. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email What is the Compliance Order on Consent? The Compliance Order on Consent between the State of New Mexico Environment Department and the United States Department of Energy and Los Alamos National

  4. Consent Order public meeting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Consent Order public meeting Consent Order public meeting WHEN: Apr 28, 2016 5:00 PM - 7:00 PM WHERE: Los Alamos County Council Chambers CATEGORY: Community TYPE: Meeting INTERNAL: Calendar Login Event Description On March 1, 2005, NMED, the Department of Energy (DOE) and the Regents of the University of California entered into the 2005 Consent Order that prescribed fence-to-fence cleanup requirements for the Laboratory. The public comment period on the Consent Order closes May 16, 2016

  5. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  6. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  7. READING FILE COPY F-e

    U.S. Energy Information Administration (EIA) Indexed Site

    Government Printing Office Main Order Desk (202) 512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing...

  8. Portsmouth Administrative Consent Order

    Broader source: Energy.gov [DOE]

    Portsmouth Administrative Consent Order ensures compliance by DOE at the Portsmouth Site with the Resource Recovery and Compensation Act, the Comprehensive Environmental Response, Compensation, and...

  9. HSI Tape Ordering

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tape Ordering HSI Tape Ordering General Procedure If you are retrieving multiple files from HPSS, it is best to order your retrieval requests in a way that makes sense for the HPSS system. In HPSS, files initially go onto a disk cache and migrate to tape as time passes. This means that files that were put into HPSS at the same time could end up spread across multiple tapes. Since each tape must by loaded into the reader, it will be fastest if you order your requests so that you are pulling all

  10. Directives System Order

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1995-10-16

    The order prescribes the process for development of Policy Statements, Orders, Notices, Manuals and Guides, which are intended to guide, inform, and instruct employees in the performance of their jobs, and enable them to work effectively within the Department and with agencies, contractors, and the public.

  11. U.S. Department of Energy INTER-ENTLTY WORK ORDER

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    INTER-ENTLTY WORK ORDER 1. Work Order Number: MOSRV00115 2. MionthlYear to be recorded, Amendmeat Number. 0 May-14 Authorze r 3. Authorizing Contractoreor RidOffie: DOE-Richhad Operations Offiee (Ofkce ofRiver Protection) 4. -Athorig Contractor or Fidld Offike OPI Code. RL90 5. Allotment Symbol: RL9191 6. Budget Analyst: PhilDailey Telephone: 509-376-2050 E-Mail: plilip-dahyrdit.doe.gov 7. ORP Technical Point o(Contact Signanre: Brian Hakies ,4" _ I Date, 2h 8. Authoiting Tank Far

  12. Consent Order Update

    Broader source: Energy.gov [DOE]

    At the September 24, 2014 Board meeting Pete Maggiore DOE, Provided Information on the Consent Order Work that Needs to be Completed. Information on the Fiscal Year Work Plan was also Provided.

  13. Order 13287, Preserve America

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    14 In response to requirements of Executive Order 13287, Preserve America Office of History and Heritage Resources Office of the Executive Secretariat U.S. Department of Energy September 2014 An Assessment of Historic Properties and Preservation Activities at the U.S. Department of Energy Table of Contents Introduction ............................................................................................................................................ 3 Part I. Background and Overview

  14. NMED Consent Order

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    begins environmental sampling in townsite September 25, 2008 Vicinity of Upper LA Canyon Investigated as Part of NMED Consent Order LOS ALAMOS, New Mexico, September 25, 2008-Environmental sampling, conducted on behalf of Los Alamos National Laboratory in the town of Los Alamos near upper Los Alamos Canyon, has begun. Known as the Upper Los Alamos Canyon Project, this effort is an environmental assessment of areas that have been or could have been affected by Laboratory operations from the days

  15. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  16. DOE - Fossil Energy: Orders-2013

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Order Granting Blanket Authority to Export Natural Gas to Mexico 3366 13-146-NG 121213 Iberdrola Energy Services, LLC Order Granting Blanket Authority to ImportExport Natural ...

  17. Paperclips Etc. Special Order Form

    Broader source: Energy.gov (indexed) [DOE]

    PSS-02.2 (March 7, 2011) Replaces PSS-02.1 PAPERCLIPS Etc. SPECIAL Orders Form This form is used to order supplies that are not readily available in the DOE HQ self-service supply...

  18. Price Quotes and Isotope Ordering

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ordering Price Quotes and Isotope Ordering Isotopes produced at Los Alamos National Laboratory are saving lives, advancing cutting-edge research and keeping the U.S. safe. Isotope...

  19. ORDER

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    rack or container with the firing chamber empty. During normal operations, long guns (e.g., rifles, shotguns, submachine guns) must not be carried with a round in the...

  20. Public Order and Safety Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    | Activity Subcategories | Energy Use Public Order and Safety Buildings... Volunteer fire stations tend not to be government owned, which probably explains why 33 percent of...

  1. DOE Order on Quality Assurance

    Broader source: Energy.gov [DOE]

    The purpose of this order is to ensure that Department of Energy (DOE), including National Nuclear Security Administration (NNSA), products and services meet or exceed customers’ requirements and...

  2. High-Order/Low-Order methods for ocean modeling

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Newman, Christopher; Womeldorff, Geoff; Chacón, Luis; Knoll, Dana A.

    2015-06-01

    We examine a High Order/Low Order (HOLO) approach for a z-level ocean model and show that the traditional semi-implicit and split-explicit methods, as well as a recent preconditioning strategy, can easily be cast in the framework of HOLO methods. The HOLO formulation admits an implicit-explicit method that is algorithmically scalable and second-order accurate, allowing timesteps much larger than the barotropic time scale. We demonstrate how HOLO approaches, in particular the implicit-explicit method, can provide a solid route for ocean simulation to heterogeneous computing and exascale environments.

  3. ESPC ENABLE Draft Task Order

    Broader source: Energy.gov [DOE]

    Document provides a draft for an agency to use when forming an ESPC ENABLE contract and making a task order award. This draft task order provides the framework for a contract that agencies and energy service companies can tailor to the particular needs of each site or project.

  4. Averen: Order (2010-CW-0711)

    Broader source: Energy.gov [DOE]

    DOE ordered Averen, Inc. to pay a $5,000 civil penalty after finding Averen had failed to certify that certain models of faucets comply with the applicable water conservation standards.

  5. Danco: Order (2015-CW-28006)

    Broader source: Energy.gov [DOE]

    DOE ordered Danco, Inc. to pay a $8,000 civil penalty after finding Danco had failed to certify that certain models of faucets comply with the applicable water conservation standards.

  6. Amerisink: Order (2010-CW-0710)

    Broader source: Energy.gov [DOE]

    DOE ordered Amerisink, Inc. to pay a $5,000 civil penalty after finding Amerisink had failed to certify that certain models of faucets comply with the applicable water conservation standards.

  7. Kohler: Order (2014-CW-30003)

    Broader source: Energy.gov [DOE]

    DOE ordered Kohler Co. to pay a $8,000 civil penalty after finding Kohler had failed to certify that certain models of water closets comply with the applicable water conservation standards.

  8. ETL: Order (2015-CW-29003)

    Broader source: Energy.gov [DOE]

    DOE ordered ETL, LLC to pay a $8,000 civil penalty after finding ETL had failed to certify that certain models of showerheads comply with the applicable water conservation standards.

  9. Quorum: Order (2014-CE-32013)

    Broader source: Energy.gov [DOE]

    DOE ordered Davoil, Inc. d/b/a Quorum International, Inc. to pay a $8,000 civil penalty after finding Quorum had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  10. Amerikooler: Order (2013-CE-5307)

    Broader source: Energy.gov [DOE]

    DOE ordered Amerikooler, Inc. to pay a $8,000 civil penalty after finding Amerikooler had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  11. Trastar: Order (2013-CE-49003)

    Broader source: Energy.gov [DOE]

    DOE ordered Trastar Inc. to pay a $8,000 civil penalty after finding Trastar had failed to certify that certain basic models of traffic signal modules and pedestrian modules comply with the applicable energy conservation standards.

  12. Almo: Order (2012-CE-1416)

    Broader source: Energy.gov [DOE]

    DOE ordered Almo Corporation to pay a $6,500 civil penalty after finding Almo had failed to certify that certain models of residential refrigerators comply with the applicable energy conservation standards.

  13. Curtis: Order (2015-CE-14021)

    Broader source: Energy.gov [DOE]

    DOE ordered Curtis International, Ltd. to pay a $5,800 civil penalty after finding Curtis had failed to certify that refrigerator-freezer basic model FR9211 complies with the applicable energy conservation standards.

  14. Electrolux: Order (2014-CE-23015)

    Broader source: Energy.gov [DOE]

    DOE ordered Electrolux North America, Inc. to pay a $16,000 civil penalty after finding Electrolux had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  15. Sunpentown: Order (2012-CE-1505)

    Broader source: Energy.gov [DOE]

    DOE ordered Sunpentown International Inc. to pay a $12,160 civil penalty after finding Sunpentown had failed to certify that certain models of room air conditioners comply with the applicable energy conservation standards.

  16. Sears: Order (2012-CE-3606)

    Broader source: Energy.gov [DOE]

    DOE ordered Sears, Roebuck & Co. to pay an $8,000 civil penalty after finding Sears had failed to certify that Sears dehumidifiers comply with the applicable energy conservation standard.

  17. Electrolux: Order (2015-CE-14020)

    Broader source: Energy.gov [DOE]

    DOE ordered Electrolux North America, Inc. to pay a $20,000 civil penalty after finding Electrolux had failed to certify that certain models of refrigerator-freezers comply with the applicable energy conservation standards.

  18. Electrolux: Order (2012-CE-1901)

    Broader source: Energy.gov [DOE]

    DOE ordered Electrolux North America to pay a $6,500 civil penalty after finding Electrolux had failed to certify that certain dishwashers comply with the applicable energy conservation standard.

  19. TCP: Order (2011-CE-3501)

    Broader source: Energy.gov [DOE]

    DOE ordered Technical Consumer Products, Inc. to pay a $3,000 civil penalty after finding TCP had failed to certify that a certain model of medium base compact fluorescent lamp (CFL) complies with the applicable energy conservation standards.

  20. Legacy: Order (2015-CE-14025)

    Broader source: Energy.gov [DOE]

    DOE ordered The Legacy Companies to pay a $8,000 civil penalty after finding Legacy had failed to certify that refrigerator Maxx-Ice brand basic model MCR3U complies with the applicable energy conservation standards.

  1. Eurodib: Order (2014-CE-45001)

    Broader source: Energy.gov [DOE]

    DOE ordered Eurodib Inc. to pay a $8,000 civil penalty after finding Eurodib had failed to certify that certain models of automatic commercial ice makers comply with the applicable energy conservation standards.

  2. Winix: Order (2012-CE-3607)

    Broader source: Energy.gov [DOE]

    DOE ordered Cloud 9 Marketing, Inc. d/b/a Winix, Inc., to pay a $8,000 civil penalty after finding Winix had failed to certify that certain models of dehumidifiers comply with the applicable energy conservation standards.

  3. Aircooler: Order (2013-CE-5338)

    Broader source: Energy.gov [DOE]

    DOE ordered Aircooler Corporation to pay a $8,000 civil penalty after finding Aircooler had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  4. Satco: Order (2013-CE-2702)

    Broader source: Energy.gov [DOE]

    DOE ordered Satco Products, Inc. to pay a $8,000 civil penalty after finding Satco had failed to certify that certain models of general service fluorescent lamps comply with the applicable energy conservation standards.

  5. Perlick: Order (2011-SE-1401)

    Broader source: Energy.gov [DOE]

    DOE ordered Perlick Corporation to pay a $400 civil penalty after finding Perlick had manufactured and distributed in commerce in the U.S. at least two noncompliant model HP48RO, electric refrigerators.

  6. Smeg: Order (2014-CE-23003)

    Broader source: Energy.gov [DOE]

    DOE ordered Smeg USA, Inc. to pay a $16,000 civil penalty after finding Smeg had failed to certify that certain models of refrigerators/refrigerator-freezers/freezers, dishwashers, and cooking products comply with the applicable energy conservation standards.

  7. Leotek: Order (2013-CE-4903)

    Broader source: Energy.gov [DOE]

    DOE ordered Leotek Electronics USA Corp. to pay a $8,000 civil penalty after finding Leotek had failed to certify that certain models of traffic signal modules and pedestrian modules comply with the applicable energy conservation standards.

  8. Litex: Order (2014-CE-32011)

    Broader source: Energy.gov [DOE]

    DOE ordered Litex Industries, Limited to pay a $8,000 civil penalty after finding Litex had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  9. TMP: Order (2013-CE-5334)

    Broader source: Energy.gov [DOE]

    DOE ordered TMP Manufacturing Company, Inc. to pay a $8,000 civil penalty after finding TMP had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  10. Sylvane: Order (2013-CE-36005)

    Broader source: Energy.gov [DOE]

    DOE ordered Sylvane, Inc. to pay a $4,000 civil penalty after finding Sylvane had failed to certify that certain models of dehumidifiers comply with the applicable energy conservation standards.

  11. Northland: Order (2014-CE-23002)

    Broader source: Energy.gov [DOE]

    DOE ordered Northland Corporation d/b/a AGA Marvel to pay a $16,000 civil penalty after finding Northland had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  12. Keystone: Order (2013-CE-2601)

    Broader source: Energy.gov [DOE]

    DOE ordered Keystone Technologies, LLC to pay a $8,000 civil penalty after finding Keystone had failed to certify that certain models of fluorescent lamp ballasts comply with the applicable energy conservation standards.

  13. Emerson: Order (2014-CE-54001)

    Broader source: Energy.gov [DOE]

    DOE ordered Emerson Electric Co. to pay a $8,000 civil penalty after finding Emerson had failed to certify that certain models of metal halide lamp fixtures comply with the applicable energy conservation standards.

  14. Perlick: Order (2013-SE-14002)

    Broader source: Energy.gov [DOE]

    DOE ordered Perlick Corporation to pay a $60,725 civil penalty after finding Perlick had manufactured and distributed in commerce in the U.S. 347 units of basic model HP48RR, a noncompliant refrigerator.

  15. Dacor: Order (2014-CE-23010)

    Broader source: Energy.gov [DOE]

    DOE ordered Dacor to pay a $8,000 civil penalty after finding Dacor had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  16. Whirlpool: Order (2014-CE-21010)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Whirlpool Corporation to pay a $8,000 civil penalty after finding Whirlpool had failed to certify that certain models of residential clothes dryers comply with the applicable energy conservation standards.

  17. DHI: Order (2014-CE-32004)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered DHI Corp. to pay a $8,000 civil penalty after finding DHI had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  18. Vaxcel: Order (2014-CE-32006)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Vaxcel International Co., Ltd. to pay a $8,000 civil penalty after finding Vaxcel had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  19. Leer: Order (2013-CE-5325)

    Broader source: Energy.gov [DOE]

    DOE ordered Leer, Inc. to pay a $8,000 civil penalty after finding Leer had failed to certify that certain models of walk-in cooler and freezer (WICF) components comply with the applicable energy conservation standards.

  20. Daewoo: Order (2010-CE-0410)

    Broader source: Energy.gov [DOE]

    DOE ordered Daewoo International, Inc. to pay a $5,000 civil penalty after finding Daewoo had failed to certify that certain models of residential clothes dryers comply with the applicable energy conservation standards.

  1. Simkar: Order (2012-SE-5408)

    Broader source: Energy.gov [DOE]

    DOE ordered Simkar Corporation to pay a $28,193 civil penalty after finding Simkar had manufactured and distributed in commerce in the U.S. 326 units of a variety of noncompliant metal halide lamp fixtures basic models.

  2. LG: Order (2015-CE-14022)

    Broader source: Energy.gov [DOE]

    DOE ordered LG Electronics USA, Inc. to pay a $8,000 civil penalty after finding LG had failed to certify that various refrigerator-freezer basic models comply with the applicable energy conservation standards.

  3. Atosa: Order (2015-CE-42037)

    Broader source: Energy.gov [DOE]

    DOE ordered Atosa Catering Equipment, Inc. to pay a $8,000 civil penalty after finding Atosa had failed to certify that certain models of self-contained commercial refrigeration equipment with doors comply with the applicable energy conservation standards.

  4. Barron: Order (2013-CE-48004)

    Broader source: Energy.gov [DOE]

    DOE ordered Barron Lighting Group, Inc. to pay a $8,000 civil penalty after finding Barron had failed to certify that certain models of illuminated exit signs comply with the applicable energy conservation standards.

  5. Harrington: Order (2014-SW-28011)

    Broader source: Energy.gov [DOE]

    DOE ordered Harrington Brass Works to pay a $10,000 civil penalty after finding Harrington had manufactured and distributed in commerce in the U.S. 832 units of individual model 20-210-026, a noncompliant faucet.

  6. Avanti: Order (2013-CE-2105)

    Broader source: Energy.gov [DOE]

    DOE ordered Avanti Products, LLC to pay a $8,000 civil penalty after finding Avanti had failed to certify that certain models of residential clothes dryers comply with the applicable energy conservation standards.

  7. Acuity: Order (2013-CE-4802)

    Broader source: Energy.gov [DOE]

    DOE ordered Acuity Brands Lighting to pay a $8,000 civil penalty after finding Acuity had failed to certify that certain models of illuminated exit signs comply with the applicable energy conservation standards.

  8. Haier: Order (2011-CE-2104)

    Broader source: Energy.gov [DOE]

    DOE ordered Haier to pay an $20,000 civil penalty after finding Haier had failed to certify that Haier residential clothes dryers comply with the applicable energy conservation standard.

  9. Nicor: Order (2014-CE-32016)

    Broader source: Energy.gov [DOE]

    DOE ordered Nicor, Inc. to pay a $8,000 civil penalty after finding Nicor had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  10. Hydac: Order (2012-SE-4107)

    Broader source: Energy.gov [DOE]

    DOE ordered Hydac Technology Corporation to pay a $29,000 civil penalty after finding Hydac had manufactured and distributed in commerce in the U.S. noncompliant electric motors.

  11. BSH: Order (2013-CE-2001)

    Broader source: Energy.gov [DOE]

    DOE ordered BSH Home Appliances Corp. to pay a $8,000 civil penalty after finding BSH had failed to certify that certain models of residential clothes washers comply with the applicable energy/water conservation standards.

  12. Versonel: Order (2014-CE-21009)

    Broader source: Energy.gov [DOE]

    DOE ordered Smart Surplus, Inc. d/b/a Versonel to pay a $8,000 civil penalty after finding Versonel had failed to certify that certain models of refrigerators and residential clothes dryers comply with the applicable energy conservation standards.

  13. Whirlpool: Order (2013-SE-1420)

    Broader source: Energy.gov [DOE]

    DOE ordered Whirlpool Corporation to pay a $5,329,800 civil penalty after finding Whirlpool had manufactured and distributed in commerce in the U.S. at least 26,649 units of basic model 8TAR81 noncompliant refrigerator-freezer.

  14. Order 430.1D

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 In response to requirements of Executive Order 13287, Preserve America Office of History and Heritage Resources Office of the Executive Secretariat U.S. Department of Energy September 2014 An Assessment of Historic Properties and Preservation Activities at the U.S. Department of Energy Table of Contents Introduction ............................................................................................................................................ 3 Part I. Background and Overview

  15. Order 580.1D

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    580.1D Title: PERSONAL PROPERTY MANAGEMENT Owner: Thomas Wilson, Jr., Office of Institutional Operations Approving Official: Bradley J. Tomer, Chief Operating Officer, Office of the Director {signature} /s/ Bradley J. Tomer Approval Date: 8/3/12 Last Reviewed Date: 8/3/12 Cancellation: Order 580.1C, Personal Property Management TABLE OF CONTENTS 1. PURPOSE ..................................................................................................................................... 2 2.

  16. Teddico: Order (2012-SE-5409)

    Broader source: Energy.gov [DOE]

    DOE ordered The Electrical Design, Development and Implementation Company d/b/a Teddico to pay a $18,994 civil penalty after finding Teddico had manufactured and distributed in commerce in the U.S. 218 units of a variety of noncompliant metal halide lamp fixtures basic models.

  17. Topaz: Order (2014-CE-35005)

    Broader source: Energy.gov [DOE]

    DOE ordered Topaz Lighting Corp. to pay a $8,000 civil penalty after finding Topaz had failed to certify that certain basic models of medium base compact fluorescent lamps, general service fluorescent lamps, and illuminated exit signs comply with the applicable energy conservation standards.

  18. Midea: Order (2013-SE-1505)

    Broader source: Energy.gov [DOE]

    DOE ordered GD Midea Air-Conditioning Equipment Co. Ltd. to pay a $416,800 civil penalty after finding Midea had manufactured and distributed in commerce in the U.S. atleast 14,968 units of basic model MWJ1-08ERN1-BI8, a noncompliant room air conditioner.

  19. Bigwall: Order (2014-SE-15006)

    Broader source: Energy.gov [DOE]

    DOE ordered Bigwall Enterprises, Inc. to abide by the terms of the Notice of Noncompliance Determination, issued on February 11, 2014, after finding Bigwall Enterprises, Inc. had privately labeled and distributed in commerce in the U.S. at least 600 units of PerfectAire brand room air conditioner model PACH8000.

  20. AHT: Order (2015-SE-42031)

    Broader source: Energy.gov [DOE]

    DOE ordered AHT Cooling Systems, Inc. to pay a $179,040 civil penalty after finding AHT had manufactured and distributed in commerce in the U.S. at least 1,032 units of commercial refrigeration equipment model RIO S 68 L F, a noncompliant product.

  1. PQL: Order (2013-CE-27001)

    Broader source: Energy.gov [DOE]

    DOE ordered P.Q.L., Inc. to pay a $8,000 civil penalty after finding PQL had failed to certify that various basic models of medium base compact fluorescent lamps, general service fluorescent lamps, fluorescent lamp ballasts, and illuminated exit signs comply with the applicable energy conservation standards.

  2. Watermark: Order (2011-SW-2908)

    Broader source: Energy.gov [DOE]

    DOE ordered Watermark Designs, Ltd. to pay a $4,200 civil penalty after finding Watermark Designs, Ltd. had manufactured and distributed in commerce in the U.S. sixty-three units of basic model SH-FAL90, a noncompliant showerhead.

  3. Hicon: Order (2013-SE-1426)

    Broader source: Energy.gov [DOE]

    DOE ordered Ningbo Hicon International Industry Company, Ltd. to pay a $1,912,714 civil penalty after finding Hicon had manufactured and distributed in commerce in the U.S. 115,126 units of basic model BD-200, a noncompliant freezer.

  4. Midea: Order (2014-SW-20001)

    Broader source: Energy.gov [DOE]

    DOE ordered Hefei Rongshida Washing Equipment Manufacturing Co., Ltd. ("Hefei Rongshida"), a subsidiary of Midea Group, to pay a $64,780 civil penalty after finding Hefei Rongshida had manufactured and distributed in commerce in the U.S. 324 units of MAE80-S1702GPS, a noncompliant residential clothes washer.

  5. Kichler: Order (2014-CE-32007)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered The L.D. Kichler Co. d/b/a Kichler Lighting to pay a $8,000 civil penalty after finding Kichler had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  6. Yosemite: Order (2014-CE-32015)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Northern Central Distributing, Inc. d/b/a Yosemite Home Dcor to pay a $8,000 civil penalty after finding Yosemite had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  7. Philips: Order (2012-SE-2605)

    Broader source: Energy.gov [DOE]

    DOE ordered Philips Lighting Electronics N. A. to pay a $82,478 civil penalty after finding Philips had manufactured and distributed in commerce in the U.S. 7,498 units of basic model VEL-1S40-SC, noncompliant fluorescent lamp ballasts.

  8. LG: Order (2014-SE-15011)

    Broader source: Energy.gov [DOE]

    DOE ordered LG Electronics USA, Inc. to pay a $1,479,860 civil penalty after finding LG had manufactured and distributed in commerce in the U.S. at least 7,438 units of basic model LT143CNR, a noncompliant room air conditioner.

  9. Universal: Order (2013-SE-26004)

    Broader source: Energy.gov [DOE]

    DOE ordered Universal Lighting Technologies, Inc. to pay a $7,264 civil penalty after finding Universal had manufactured and distributed in commerce in the U.S. 454 units of model B140R277HP, a noncompliant fluorescent lamp ballast.

  10. ELCO: Order (2014-SE-54005)

    Broader source: Energy.gov [DOE]

    DOE ordered ELCO Lighting to pay a $14,000 civil penalty after finding ELCO had failed to certify that certain models of illuminated exit signs and metal halide lamp fixtures comply with the applicable energy conservation standards and had failed to provide requested test data.

  11. Friedrich: Order (2014-SE-15010)

    Broader source: Energy.gov [DOE]

    DOE ordered Friedrich Air Conditioning Co. to pay a $1.5 million civil penalty after finding Friedrich had manufactured and distributed in commerce in the U.S. 8,241 units of Friedrich model SQ10N10, a noncompliant room air conditioner.

  12. YMGI: Order (2011-SCE-1605)

    Broader source: Energy.gov [DOE]

    DOE ordered YMGI Group LLC to pay a $31,400 civil penalty after finding (1) YMGI had failed to certify that certain models of residential central air conditioners comply with the applicable energy conservation standards and (2) YMGI had distributed in commerce model TTWC-18K-31B, a through-the-wall air conditioner that does not meet the applicable energy conservation standard.

  13. Cooper: Order (2012-SE-4701)

    Broader source: Energy.gov [DOE]

    DOE ordered Cooper Power Systems, LLC to abide by the Compromise Agreement, which waived the civil penalty after finding Cooper had inadvertently distributed in commerce in the U.S. three models (total of five units) of distribution transformers. Cooper agrees to abide by the terms of a Notice of Noncompliance Determination to be issued pursuant to 10 C.F.R. § 429.114.

  14. International Refrigeration: Order (2012-CE-1510) | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    International Refrigeration: Order (2012-CE-1510) International Refrigeration: Order (2012-CE-1510) July 20, 2012 DOE ordered International Refrigeration Products to pay an 8,000 ...

  15. ORDER FOR SUPPLIES OR SERVICES

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 DE-DT0004203 12EM002688 EMCBC U.S. Department of Energy EM Consolidated Business Center 250 E. 5th Street, Suite 500 DEBRA MARKELONIS VISIONARY SOLUTIONS, LLC 111 UNION VALLEY ROAD, SUITE B OAK RIDGE TN 378308036 See Schedule 12. F.O.B. POINT Destination 1 Days After Award EMCBC - Carlsbad US Department of Energy Carlsbad Project Office Carlsbad NM 88221 EMCBC - Carlsbad ITEM NO. (a) SUPPLIES OR SERVICES (b) QUANTITY ORDERED (c) UNIT (d) UNIT PRICE (e) AMOUNT (f) QUANTITY ACCEPTED (g) X X 2

  16. ORDER FOR SUPPLIES OR SERVICES

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 DE-DT0005972 13EM002307 EMCBC U.S. Department of Energy EM Consolidated Business Center 250 E. 5th Street, Suite 500 DEBRA MARKELONIS VISIONARY SOLUTIONS, LLC 2553 QUALITY LANE KNOXVILLE TN 37931 See Schedule 12. F.O.B. POINT Destination 1 Days After Award EMCBC - Carlsbad US Department of Energy Carlsbad Project Office Carlsbad NM 88221 EMCBC - Carlsbad ITEM NO. (a) SUPPLIES OR SERVICES (b) QUANTITY ORDERED (c) UNIT (d) UNIT PRICE (e) AMOUNT (f) QUANTITY ACCEPTED (g) X 2 Destination

  17. Executive Order 13423: Strengthening Federal Environmental, Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Executive Order 13423: Strengthening Federal Environmental, Energy, and Transportation Management Executive Order 13423: Strengthening Federal Environmental, Energy, and ...

  18. On the scalability of the Albany/FELIX first-order Stokes approximation ice sheet solver for large-scale simulations of the Greenland and Antarctic ice sheets

    Office of Scientific and Technical Information (OSTI)

    013C This space is reserved for the Procedia header, do not use it On the scalability of the Albany/FELIX first-order Stokes approximation ice sheet solver for large-scale simulations of the Greenland and Antarctic ice sheets Irina Kalashnikova1, Raymond S. Tuminaro2, Mauro Perego2, Andrew G. Salinger2, and Stephen F. Price3 1 Quantitative Modeling & Analysis Dept., Sandia National Laboratories, Livermore, CA, USA Phone: (925)294-2474, E-mail: ikalash@sandia.gov 2 Computational Mathematics

  19. Scaling exponents for ordered maxima

    SciTech Connect (OSTI)

    Ben-Naim, E.; Krapivsky, P. L.; Lemons, N. W.

    2015-12-22

    We study extreme value statistics of multiple sequences of random variables. For each sequence with N variables, independently drawn from the same distribution, the running maximum is defined as the largest variable to date. We compare the running maxima of m independent sequences and investigate the probability SN that the maxima are perfectly ordered, that is, the running maximum of the first sequence is always larger than that of the second sequence, which is always larger than the running maximum of the third sequence, and so on. The probability SN is universal: it does not depend on the distribution from which the random variables are drawn. For two sequences, SN~N–1/2, and in general, the decay is algebraic, SN~N–σm, for large N. We analytically obtain the exponent σ3≅1.302931 as root of a transcendental equation. Moreover, the exponents σm grow with m, and we show that σm~m for large m.

  20. Scaling exponents for ordered maxima

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Ben-Naim, E.; Krapivsky, P. L.; Lemons, N. W.

    2015-12-22

    We study extreme value statistics of multiple sequences of random variables. For each sequence with N variables, independently drawn from the same distribution, the running maximum is defined as the largest variable to date. We compare the running maxima of m independent sequences and investigate the probability SN that the maxima are perfectly ordered, that is, the running maximum of the first sequence is always larger than that of the second sequence, which is always larger than the running maximum of the third sequence, and so on. The probability SN is universal: it does not depend on the distribution frommore » which the random variables are drawn. For two sequences, SN~N–1/2, and in general, the decay is algebraic, SN~N–σm, for large N. We analytically obtain the exponent σ3≅1.302931 as root of a transcendental equation. Moreover, the exponents σm grow with m, and we show that σm~m for large m.« less

  1. Executive Order 13673 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    673 Executive Order 13673 Executive Order 13673, proposed Federal Acquisition Regulation rule, and proposed Department of Labor guidance are available at: Executive Order 13673 Proposed Federal Acquisition Regulation Rule Proposed Department of Labor Guidance Informational slides about the Executive Order are available below: File Executive Order 13673

  2. Order - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Order by Website Administrator application/vnd.openxmlformats-officedocument.wordprocessingml.document icon order template.docx - application/vnd.openxmlformats-officedocument.wordprocessingml.document, 48 KB (49165

  3. Public Order and Safety | Open Energy Information

    Open Energy Info (EERE)

    Safety Jump to: navigation, search Building Type Public Order and Safety Definition Buildings used for the preservation of law and order or public safety. Sub Categories police...

  4. Implementation of Executive Order 12114 Environmental Effects...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Implementation of Executive Order 12114 Environmental Effects Abroad of Major Federal Actions: Final Guideline (DOE, 1981) Implementation of Executive Order 12114 Environmental ...

  5. Consent Order EA-2005-01

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    20585 July 28, 2005 Mr. T. E. Logan, President Bechtel Hanford, Inc. 3070 George Washington Way Richland, WA 99352 Consent Order 2005-01 Subject: Consent Order Incorporating ...

  6. Physician Treatment Order | Department of Energy

    Energy Savers [EERE]

    Physician Treatment Order Physician Treatment Order FEDERAL OCCUPATIONAL HEALTH Physician Treatment Orders - FOH-24 Form (formerly 229-B) PDF icon FOH-24 Physician Treatment Orders.pdf More Documents & Publications Allergy Injection Policy Handicapped Parking Guidance Before the House Foreign Affairs Subcommittee on Asia, the Pacific and the Global Environment

  7. GreenOrder | Open Energy Information

    Open Energy Info (EERE)

    York Zip: 10016 Product: Founded in 2000, GreenOrder is a sustainability strategy and marketing firm References: GreenOrder1 This article is a stub. You can help OpenEI by...

  8. LLNS Beryllium Consent Order Fact Sheet

    Energy Savers [EERE]

    - LLNS Beryllium Consent Order SUMMARY OF CONSENT ORDER In November 2010, the U.S. Department of Energy (DOE) and the National Nuclear Security Administration (NNSA) issued a consent order to Lawrence Livermore National Security, LLC (LLNS) for deficiencies related to LLNS's implementation of DOE's Chronic Beryllium Disease Prevention Program (CBDPP) regulation at Lawrence Livermore National Laboratory. The consent order requires LLNS to implement corrective actions that will ensure LLNS meets

  9. DNA Clone Ordering from Shotgun Clone Libraries

    Energy Science and Technology Software Center (OSTI)

    1995-11-28

    CORD is an implementation of an algorithm for determining the order of clones from shotgun clone libraries.

  10. Executive Order 13423- Strengthening Federal Environmental, Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Environmental, Energy, and Transportation Management Executive Order 13423- Strengthening Federal Environmental, Energy, and Transportation Management It is the policy of ...

  11. Executive Order 12123 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2123 Executive Order 12123 Document covers the extracted pages of Executive Order 12123. PDF icon eo13123.pdf More Documents & Publications EO 13123-Greening the Government Through Efficient Energy Management Project Reports for Yukon-Kuskokwim Health Corporation - 2002 Project Executive Order 13221-Energy Efficient Standby Power Devices

  12. Antenna factorization in strongly ordered limits

    SciTech Connect (OSTI)

    Kosower, David A.

    2005-02-15

    When energies or angles of gluons emitted in a gauge-theory process are small and strongly ordered, the emission factorizes in a simple way to all orders in perturbation theory. I show how to unify the various strongly ordered soft, mixed soft-collinear, and collinear limits using antenna factorization amplitudes, which are generalizations of the Catani-Seymour dipole factorization function.

  13. I REMARKS ON THE TOPOLOGY OF GAUGE FIELDS*

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    » ; * * " \ ) I O O l i n O A O U 3 N 3 9 6 6 L I M d v This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Telephone orders may be directed to: Superintendent of Documents U.S. Government Printing Office Main Order Desk (202)512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing Office P.O. Box

  14. Executive Order 13007 Indian Sacred Sites (1996)

    Office of Environmental Management (EM)

    6771 Federal Register / Vol. 61, No. 104 / Wednesday, May 29, 1996 / Presidential Documents Executive Order 13007 of May 24, 1996 Indian Sacred Sites By the authority vested in me as President by the Constitution and the laws of the United States, in furtherance of Federal treaties, and in order to protect and preserve Indian religious practices, it is hereby ordered: Section 1. Accommodation of Sacred Sites. (a) In managing Federal lands, each executive branch agency with statutory or

  15. Resonant radiation from oscillating higher order solitons

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Driben, R.; Yulin, A. V.; Efimov, A.

    2015-07-15

    We present radiation mechanism exhibited by a higher order soliton. In a course of its evolution the higher-order soliton emits polychromatic radiation resulting in formation of multipeak frequency comb-like spectral band. The shape and spectral position of this band can be effectively controlled by the relative strength of the third order dispersion. An analytical description is corroborated by numerical simulations. Research showed that for longer pulses the described effect persists also under the action of higher order perturbations such as Raman and self-steepening.

  16. Engineered Solutions: Order (2010-CE-2112)

    Broader source: Energy.gov [DOE]

    DOE issued an Order after entering into a Compromise Agreement with Engineered Solutions, Inc. to resolve a case involving the failure to certify dehumidifier basic model SD109.

  17. Executive Order 13583, Establishing a Coordinated Government...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    13583, Establishing a Coordinated Government-Wide Initiative to Promote Diversity and Inclusion in the Federal Workforce Executive Order 13583, Establishing a Coordinated...

  18. NMED Presentation on Revised Consent Order

    Broader source: Energy.gov [DOE]

    At the November 12, 2015 Special NNMCAB Meeting NMED Secretary Ryan Flynn provided a presentation on the Revisions to the 2005 Order on Consent.

  19. President Truman Orders Development of Thermonuclear Weapon ...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo Gallery Jobs Apply for Our Jobs Our Jobs Working at NNSA Blog Home About Us Our History NNSA Timeline President Truman Orders Development of Thermonuclear Weapon...

  20. Consent Order, Brookhaven Science Associates, LLC

    Broader source: Energy.gov [DOE]

    Worker Safety and Health Enforcement Consent Order issued to Brookhaven Science Associates, LLC relating to an electrical shock event that occurred at the Brookhaven National Laboratory.

  1. West Valley Demonstration Project Administrative Consent Order...

    Office of Environmental Management (EM)

    State New York Agreement Type Consent Order Legal Driver(s) RCRA Scope Summary Protect human health and the environment from releases of hazardous waste andor hazardous...

  2. West Valley Demonstration Project Administrative Consent Order...

    Office of Environmental Management (EM)

    Department of Energy (DOE) enter into this Order regarding ... C. In the event that the terms and conditions of this ... EM HOME | DOE HOME | SEARCH | WEBSITE OUTLINE FEEDBACK ...

  3. NPS Director's Order | Open Energy Information

    Open Energy Info (EERE)

    NPS Director's Order Author NPS Recipient NPS Published Publisher Not Provided, 02232010 DOI Not Provided Check for DOI availability: http:crossref.org Online Internet...

  4. Implementing Executive Order 13423 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for Federal Agencies on E.O. 13514 Section 12, Federal Fleet Management OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy and Economic Performance

  5. Executive Order 13514: Comprehensive Federal Fleet Management...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Handbook offers guidance on meeting the fleet management requirements outlined in section 12 of Executive Order 13514: Federal Leadership in Environmental, Energy, and Economic ...

  6. Hexagonal Ordering of Nanoparticles | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    electron microscope, researchers can see the hexagonal ordering of nanoparticles in a gold nanoparticle membranes (right). This configuration helps researchers to simulate their...

  7. Consent Order, Brookhaven Science Associates, LLC | Department...

    Energy Savers [EERE]

    Consent Order issued to Brookhaven Science Associates, LLC relating to an electrical shock event that occurred at the Brookhaven National Laboratory. On November 23,...

  8. Order, chaos and nuclear dynamics: An introduction

    SciTech Connect (OSTI)

    Swiatecki, W.J.

    1990-08-01

    This is an introductory lecture illustrating by simple examples the anticipated effect on collective nuclear dynamics of a transition from order to chaos in the motions of nucleons inside an idealized nucleus. The destruction of order is paralleled by a transition from a rubber-like to a honey-like behaviour of the independent-particle nuclear model. 10 refs., 6 figs.

  9. cd ordering | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CD-DVD Ordering System Please complete the following information so the National Energy Technology Lab (NETL) can promptly process your order. Below is a sample of the fields required to order a CD or DVD. If any fields are left blank you may not receive your disk. Data gathered by this form will be used only by the NETL. and will not be distributed for any other purpose. Data transferred via the Internet to this database should not be considered secure. Last Name: Doe First Name: John Middle

  10. Portsmouth Integration Director's Final Findings and Order

    Broader source: Energy.gov [DOE]

    Portsmouth Integration Director's Final Findings and Order purpose is to: integrate the on-site work required for specific units to avoid duplication of effort, and efficiently perform sitewide...

  11. Artisan Manufacturing: Order (2010-CW-0712)

    Broader source: Energy.gov [DOE]

    DOE ordered Artisan Manufacturing Company, Inc., to pay a $5,000 civil penalty after finding Artisan Manufacturing had failed to certify that certain models of faucets comply with the applicable water conservation standard.

  12. Zoe Industries: Order (2010-CW-1405)

    Broader source: Energy.gov [DOE]

    DOE ordered Zoe Industries, Inc. to pay a $5,000 civil penalty after finding Zoe had failed to certify that certain models of showerheads comply with the applicable water conservation standards.

  13. Penguin Toilets: Order (2010-CW-1615)

    Broader source: Energy.gov [DOE]

    DOE ordered Penguin Toilets, LLC to pay a $5,000 civil penalty after finding Penguin Toilets had failed to certify that certain models of water closets comply with the applicable water conservation standards.

  14. American Valve: Order (2010-CW-1411)

    Broader source: Energy.gov [DOE]

    DOE ordered American Valve, Inc. to pay a $5,000 civil penalty after finding American Valve had failed to certify that certain showerhead models comply with the applicable water conservation standards.

  15. Afeel: Order (2010-CW-07/1414)

    Broader source: Energy.gov [DOE]

    DOE ordered Afeel Corporation to pay a $10,000 civil penalty after finding Afeel had failed to certify that certain models of showerheads and faucets comply with the applicable water conservation standards.

  16. Allen Co: Order (2010-CW-0715)

    Broader source: Energy.gov [DOE]

    DOE ordered Allen Co. to pay a $5,000 civil penalty after finding Allen Co. had failed to certify that certain models of faucets comply with the applicable water conservation standards.

  17. AM Conservation: Order (2010-CW-1415)

    Broader source: Energy.gov [DOE]

    DOE ordered AM Conservation Group, Inc. to pay a $5,000 civil penalty after finding AM Conservation had failed to certify that certain models of showerheads comply with the applicable water conservation standards.

  18. Explosive Safety Manual, to a New Order

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2010-12-02

    This memorandum provides justification for the conversion of Department of Energy (DOE) Manual (M) 440.1-1A, DOE Explosives Safety Manual, dated 1-9-06, into a new DOE Order.

  19. Danby Products: Order (2012-CE-1415)

    Broader source: Energy.gov [DOE]

    DOE ordered Danby Products to pay a $9,900 civil penalty after finding Danby had failed to certify that certain models of refrigerators and freezers comply with the applicable energy conservation standard.

  20. Kold Pack: Order (2013-CE-5323)

    Broader source: Energy.gov [DOE]

    DOE ordered Kold Pack, Inc. to pay a $8,000 civil penalty after finding Kold Pack had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  1. Fagor America: Order (2014-CE-23018)

    Broader source: Energy.gov [DOE]

    DOE ordered Fagor America, Inc. to pay a $6,500 civil penalty after finding Fagor America had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  2. HKC-US: Order (2013-SE-33002)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered HKC-US, LLC to pay a $6,500 civil penalty after finding HKC-US had failed to certify that one basic model of ceiling fan light kit complies with the applicable energy conservation standards.

  3. Basement Systems: Order (2010-CE-2110)

    Broader source: Energy.gov [DOE]

    DOE issued an Order after entering into a Compromise Agreement with Basement Systems, Inc. after finding Basement Systems had failed to certify that certain models of dehumdifiers comply with the applicable energy conservation standards.

  4. Clean Cities: Coalitions in Order of Designation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Order Atlanta, GA September 8th, 1993 1 Denver, CO September 13th, 1993 2 Philadelphia, PA September 22nd, 1993 3 Delaware October 12th, 1993 4 Washington, DC October...

  5. Commercial Cooler: Order (2013-CE-5343)

    Broader source: Energy.gov [DOE]

    DOE ordered Commercial Cooler, Inc. to pay a $8,000 civil penalty after finding Commercial Cooler had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  6. Custom Coolers: Order (2013-CE-5315)

    Broader source: Energy.gov [DOE]

    DOE ordered Custom Coolers, LLC to pay a $8,000 civil penalty after finding Custom Coolers had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  7. Viking Range: Order (2014-CE-23014)

    Broader source: Energy.gov [DOE]

    DOE ordered Viking Range, LLC to pay a $8,000 civil penalty after finding Viking Range had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  8. American Range: Order (2014-CE-23006)

    Broader source: Energy.gov [DOE]

    DOE ordered American Range Corporation to pay a $8,000 civil penalty after finding American Range had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  9. Neptun Light: Order (2012-SE-3504)

    Broader source: Energy.gov [DOE]

    DOE ordered Neptun Light, Inc. to pay a $13,000 civil penalty after finding Neptun Light had failed to certify that certain models of medium base compact fluorescent lamps comply with the applicable energy conservation standards.

  10. Stiebel Eltron: Order (2010-CE-1711)

    Broader source: Energy.gov [DOE]

    DOE ordered Stiebel Eltron, Inc. to pay a $5,000 civil penalty after finding Stiebel Eltron had failed to certify that certain models of water heaters comply with the applicable energy conservation standards.

  11. Refrigerator Manufacturers: Order (2013-CE-5341)

    Broader source: Energy.gov [DOE]

    DOE ordered Refrigerator Manufacturers, LLC to pay a $8,000 civil penalty after finding Refrigerator Manufacturers had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  12. Nostalgia Products: Order (2014-CE-14017)

    Broader source: Energy.gov [DOE]

    DOE ordered Nostalgia Products Group, LLC to pay a $8,000 civil penalty after finding Nostalgia Products had failed to certify that certain models of refrigerators and refrigerator-freezers comply with the applicable energy conservation standards.

  13. Fisher & Paykel: Order (2014-CE-23012)

    Broader source: Energy.gov [DOE]

    DOE ordered Fisher & Paykel Appliances, Inc. to pay a $8,000 civil penalty after finding Fisher & Paykel had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  14. Central Moloney: Order (2013-SE-4702)

    Broader source: Energy.gov [DOE]

    DOE ordered Central Moloney, Inc. to pay a $2,500 civil penalty after finding Central Moloney had manufactured and distributed noncompliant liquid-immersed distribution transformers in commerce in the U.S.

  15. Consent Order EA-2000-07

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... this matter does not constitute a reimbursable cost. VIII This Consent Order is issued under DOE's authority in Section 234A of the Atomic Energy Act of 1954, as amended (42 ...

  16. USA Manufacturing: Order (2013-CE-5336)

    Broader source: Energy.gov [DOE]

    DOE ordered USA Manufacturing to pay a $8,000 civil penalty after finding USA Manufacturing had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  17. Ramblewood Green: Order (2014-CE-23017)

    Broader source: Energy.gov [DOE]

    DOE ordered Ramblewood Green Ltd. to pay a $8,000 civil penalty after finding Ramblewood Green had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  18. Royal Centurion: Order (2012-CE-3608)

    Broader source: Energy.gov [DOE]

    DOE ordered Royal Centurion, Inc., to pay a $8,000 civil penalty after finding Royal Centurion had failed to certify that certain models of dehumidifiers comply with the applicable energy conservation standards.

  19. Executive Order 13007 Indian Sacred Sites (1996)

    Broader source: Energy.gov [DOE]

    Executive Order 13007 Indian Sacred Sites (1996). Designed to protect and preserve Indian religious practices, this EO directs each federal agency that manages federal lands to “(1) accommodate...

  20. Golden Cooler: Order (2013-CE-5345)

    Broader source: Energy.gov [DOE]

    DOE ordered Golden Cooler to pay a $8,000 civil penalty after finding Golden Cooler had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  1. Home Depot: Order (2014-CE-32017)

    Broader source: Energy.gov [DOE]

    DOE ordered The Home Depot, Inc. to pay a $8,000 civil penalty after finding Home Depot had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  2. Jamison Door: Order (2013-CE-5348)

    Broader source: Energy.gov [DOE]

    DOE ordered Jamison Door Company to pay a $6,000 civil penalty after finding Jamison Door had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  3. Task Order Awarded for Environmental Technical Services

    Broader source: Energy.gov [DOE]

    Cincinnati - The Department of Energy (DOE) today awarded a task order for environmental technical services to Professional Project Services, Inc., of Oak Ridge, TN, for support services at the Paducah Gaseous Diffusion Plant located near Paducah, KY.

  4. Living Direct: Order (2011-CE-1904)

    Broader source: Energy.gov [DOE]

    DOE ordered Living Direct, Inc. to pay a $6,000 civil penalty after finding Living Direct had failed to certify that certain models of dishwashers, refrigerator-freezers and freezers comply with the applicable energy conservation standards.

  5. Hunter Fan: Order (2014-CE-32008)

    Broader source: Energy.gov [DOE]

    DOE ordered Hunter Fan Company to pay a $8,000 civil penalty after finding Hunter Fan had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  6. Worker Safety and Health Enforcement Consent Order

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... On behalf of my respective organization, I hereby agree to and accept the terms of the foregoing Consent Order. S. Boulden III 'rector Office of Enforcement and Oversight Office of ...

  7. National Comfort Products: Order (2014-SE-16014)

    Broader source: Energy.gov [DOE]

    DOE ordered National Comfort Products to pay a $16,000 civil penalty after finding National Comfort Products had failed to certify that certain models of central air conditioners and heat pumps comply with the applicable energy conservation standards.

  8. CATERING ORDER;SA 4500-CCC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4500-CCC (4-2015) Supersedes (11-2014) issue CATERING ORDER Your Name: I certify that I have Completed and had my Manager complete: FIN100.1.TNT.6 Obtain Business Meeting Meal ...

  9. Hudson Reed: Order (2011-SW-2909)

    Broader source: Energy.gov [DOE]

    DOE ordered Hudson Reed, Ltd. to pay a $3,000 civil penalty after finding Hudson Reed had manufactured and distributed in commerce in the U.S. 18 units of basic model HEAD16, a noncompliant showerhead.

  10. Executive Order 11990: Protection Of Wetlands

    Broader source: Energy.gov [DOE]

    In order to avoid to the extent possible the long and short term adverse impacts associated with the destruction or modification of wetlands and to avoid direct or indirect support of new...

  11. Engineered Products: Order (2012-SE-5401)

    Broader source: Energy.gov [DOE]

    DOE ordered Engineered Products Company to pay a $480 civil penalty after finding EPCO had manufactured/privately labeled and distributed in commerce in the U.S. 19 units of basic model 15701, a metal halide lamp fixture.

  12. Midea Washing Appliance: Order (2011-CE-1903)

    Broader source: Energy.gov [DOE]

    DOE ordered Midea Washing Appliance Mfg. Co., Ltd. to pay a $6,000 civil penalty after finding Midea Washing Appliance had failed to certify that certain models of dishwashers comply with the applicable energy conservation standards.

  13. Anthony International: Order (2013-CE-5357)

    Broader source: Energy.gov [DOE]

    DOE ordered Anthony International to pay a $8,000 civil penalty after finding Anthony International had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  14. Heat Controller: Order (2011-CE-1507)

    Broader source: Energy.gov [DOE]

    DOE ordered Heat Controller, Inc. to pay a $6,000 civil penalty after finding Heat Controller had failed to certify that certain models of room air conditioners comply with the applicable energy conservation standards.

  15. Imperial Manufacturing: Order (2013-CE-5322)

    Broader source: Energy.gov [DOE]

    DOE ordered Imperial Manufacturing, Inc. to pay a $8,000 civil penalty after finding Imperial Manufacturing had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  16. Zoe Industries: Order (2011-SW-2912)

    Broader source: Energy.gov [DOE]

    DOE ordered Zoe Industries, Inc. to pay a $25,000 civil penalty after finding Zoe had manufactured and distributed in commerce in the U.S. at least 2,235 units of basic model 150043, a noncompliant showerhead.

  17. Bull Outdoor Products: Order (2015-CE-14014)

    Broader source: Energy.gov [DOE]

    DOE ordered Bull Outdoor Products, Inc. to pay a $8,000 civil penalty after finding Bull had failed to certify that refrigerator basic model BC-130 complies with the applicable energy conservation standards.

  18. Elmira Stove Works: Order (2011-CE-1407)

    Broader source: Energy.gov [DOE]

    DOE ordered Elmira Stove Works to pay a $6,000 civil penalty after finding Elmira Stove Works had failed to certify that certain models of refrigerator-freezers comply with the applicable energy conservation standard.

  19. Southeast Cooler: Order (2013-CE-5331)

    Broader source: Energy.gov [DOE]

    DOE ordered Southeast Cooler Corp. to pay a $8,000 civil penalty after finding Southeast Cooler had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  20. DOE - Fossil Energy: Orders Issued in 2012

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Nations 3127 FE12-71-NG 072412 Iberdrola Renewables, LLC Order Granting Blanket ... Prior Authority 2773 3080 FE12-31-NG 032712 Iberdrola Canada Energy Services, Ltd. ...

  1. Cospolich Refrigerator: Order (2013-CE-5314)

    Broader source: Energy.gov [DOE]

    DOE ordered Cospolich Refrigerator Co, Inc. to pay a $8,000 civil penalty after finding Cospolich Refrigerator had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  2. Dade Engineering: Order (2013-CE-5316)

    Broader source: Energy.gov [DOE]

    DOE ordered Dade Engineering Corp. to pay a $8,000 civil penalty after finding Dade Engineering had failed to certify that certain models of walk-in cooler and freezer (WICF) components comply with the applicable energy conservation standards.

  3. Hisense USA: Order (2010-CE-1211)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE issued an Order after entering into a Compromise Agreement with Hisense USA Corp. after finding Hisense USA had failed to certify that certain models of residential refrigerators, refrigerator-freezers, and freezers comply with the applicable energy conservation standards.

  4. Polar King: Order (2013-CE-5328)

    Broader source: Energy.gov [DOE]

    DOE ordered Polar King International Inc. to pay a $8,000 civil penalty after finding Polar King had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  5. Prizer-Painter: Order (2014-CE-23005)

    Broader source: Energy.gov [DOE]

    DOE ordered Prizer-Painter Stove Works, Inc. to pay a $8,000 civil penalty after finding Prizer-Painter had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  6. Exploring intertwined orders in cuprate superconductors (Journal...

    Office of Scientific and Technical Information (OSTI)

    YBa2Cu3O6+x and La2-xBaxCuO4, the maximum ordering strength is peaked at the hole concentration of 18 in both cases. There are also possible connections more with the quantum...

  7. Peerless-Premier: Order (2014-CE-23007)

    Broader source: Energy.gov [DOE]

    DOE ordered Peerless-Premier Appliance Co. to pay a $8,000 civil penalty after finding Peerless-Premier had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  8. Fagor America: Order (2013-CEW-19001)

    Broader source: Energy.gov [DOE]

    DOE ordered Fagor America, Inc. to pay a $13,000 civil penalty after finding Fagor America had failed to certify that certain models of residential refrigerator-freezers and dishwashers comply with the applicable energy and water conservation standards.

  9. K.Grill: Order (2011-SW-2902)

    Broader source: Energy.gov [DOE]

    DOE ordered Kenneth Grill to pay a $10,000 civil penalty after finding Mr. Grill had manufactured and distributed in commerce in the U.S. at least 5,000 noncompliant showerheads.

  10. Quietside Corp: Order (2010-CE-1710)

    Broader source: Energy.gov [DOE]

    DOE ordered Quietside Corporation to pay a $5,000 civil penalty after finding Quietside Corp. had failed to certify that certain models of water heaters comply with the applicable energy conservation standards.

  11. AGA Marvel: Order (2011-CE-1905)

    Broader source: Energy.gov [DOE]

    DOE ordered AGA Marvel to pay a $6,000 civil penalty after finding AGA Marvel had failed to certify that certain models of dishwashers comply with the applicable energy conservation standards.

  12. Aero-Tech: Order (2010-CE-1012)

    Broader source: Energy.gov [DOE]

    DOE issued an Order and closed this case against Aero-Tech Light Bulb Co., without civil penalty, after DOE found that Aero-Tech manufactured and/or privately labeled incandescent reflector lamps, but did not violate DOE regulations.

  13. Cal Flame: Order (2015-CE-14015)

    Broader source: Energy.gov [DOE]

    DOE ordered Cal Flame to pay a $8,000 civil penalty after finding Cal Flame had failed to certify that refrigerator basic model BBQ09849P-H complies with the applicable energy conservation standards.

  14. Distinctive Appliances: Order (2015-CE-14019)

    Broader source: Energy.gov [DOE]

    DOE ordered Distinctive Appliances Distributing, Inc. to pay a $16,000 civil penalty after finding Distinctive Appliances had failed to certify that certain models of Fhiaba-brand refrigerator-freezers comply with the applicable energy conservation standards.

  15. Distinctive Appliances: Order (2014-CE-23020)

    Broader source: Energy.gov [DOE]

    DOE ordered Distinctive Appliances Distributing, Inc. to pay a $8,000 civil penalty after finding Distinctive Appliances had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  16. Manitowoc Foodservice: Order (2012-CE-5309)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Manitowoc Foodservice to pay an $6,000 civil penalty after finding Manitowoc Foodservice had failed to certify that Manitowoc walk-in coolers and freezers (WICFs) and their components comply with the applicable energy conservation standard.

  17. Navien America: Order (2010-CE-1712)

    Broader source: Energy.gov [DOE]

    DOE ordered Navien America, Inc. to pay a $5,000 civil penalty after finding Navien America had failed to certify that certain models of water heaters comply with the applicable energy conservation standards.

  18. Paragon Sales: Order (2012-CE-1417)

    Broader source: Energy.gov [DOE]

    DOE ordered Paragon Sales Co., Inc., to pay a $6,000 civil penalty after finding Paragon Sales had failed to certify that certain models of Liebherr residential freezers comply with the applicable energy conservation standards.

  19. Jandy Pool Products: Order (2010-CE-1111)

    Broader source: Energy.gov [DOE]

    DOE ordered Jandy Pool Products, Inc. to pay a $10,000 civil penalty after finding Jandy Pool Products had failed to certify that certain models of pool heaters comply with the applicable energy conservation standards.

  20. Mackle Company: Order (2011-CE-2102)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered The Mackle Company, Inc., to pay a $6,000 civil penalty after finding Mackle Co. had failed to certify that basic model D110, a clothes dryer, complies with the applicable energy conservation standards.

  1. Minibar North America: Order (2014-CE-14010)

    Broader source: Energy.gov [DOE]

    DOE ordered Minibar North America, Inc. to pay a $8,000 civil penalty after finding Minibar had failed to certify that certain models of refrigerators comply with the applicable energy conservation standards.

  2. National Comfort Products: Order (2010-SE-0307)

    Broader source: Energy.gov [DOE]

    DOE ordered National Comfort Products to pay an $8,000 civil penalty after finding NCP had failed to conduct the required testing to certify that certain models of central air conditioners comply with the applicable energy conservation standard.

  3. MC Appliance: Order (2014-CE-20002)

    Broader source: Energy.gov [DOE]

    DOE ordered MC Appliance Corporation to pay a $16,000 civil penalty after finding MC Appliance had failed to certify that certain models of residential clothes washers and residential clothes dryers comply with the applicable energy conservation standards.

  4. Minka-Aire: Order (2014-CE-32018)

    Broader source: Energy.gov [DOE]

    DOE ordered Minka Lighting Inc. to pay a $8,000 civil penalty after finding Minka had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  5. ORDER NO. 3465: LNG DEVELOPMENT COMPANY, LLC

    Broader source: Energy.gov [DOE]

    ORDER CONDITIONALLY GRANTING LONG-TERM MULTI-CONTRACT AUTHORIZATION TO EXPORT LIQUEFIED NATURAL GAS BY VESSEL FROM THE OREGON LNG TERMINAL IN WARRENTON, CLATSOP COUNTY, OREGON TO NON-FREE TRADE AGREEMENT NATIONS

  6. Excellence Opto: Order (2013-CE-49002)

    Broader source: Energy.gov [DOE]

    DOE ordered Excellence Opto, Inc. to pay a $8,000 civil penalty after finding Excellence Opto had failed to certify that certain models of traffic signal modules and pedestrian modules comply with the applicable energy conservation standards.

  7. BSH Home Appliances: Order (2014-CE-23013)

    Broader source: Energy.gov [DOE]

    DOE ordered BSH Home Appliances Corporation to pay a $12,000 civil penalty after finding BSH Home Appliances had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  8. ET Industries: Order (2012-SE-2902)

    Broader source: Energy.gov [DOE]

    DOE ordered ET Industries, Inc. to pay a $39,000 civil penalty after finding ET Industries had manufactured and distributed in commerce in the U.S. 974 units of basic model TH-1, a noncompliant showerhead.

  9. Capital Cooking: Order (2014-CE-23008)

    Broader source: Energy.gov [DOE]

    DOE ordered Capital Cooking Equipment, Inc. to pay a $8,000 civil penalty after finding Capital Cooking had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  10. Purcell-Murray: Order (2014-CE-23019)

    Broader source: Energy.gov [DOE]

    DOE ordered Purcell-Murray Company, Inc. to pay a $8,000 civil penalty after finding Purcell-Murray had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  11. Goodman Manufacturing: Order (2012-CE-1509)

    Broader source: Energy.gov [DOE]

    DOE ordered Goodman Manufacturing Company L.P. to pay an $8,000 civil penalty after finding Goodman Manufacturing had failed to certify that certain room air conditioners comply with the applicable energy conservation standard.

  12. Barclay Products: Order (2013-CW-3005)

    Broader source: Energy.gov [DOE]

    DOE ordered Barclay Products, Ltd. to pay a $8,000 civil penalty after finding Barclay Products had failed to certify that certain models of water closets comply with the applicable water conservation standards.

  13. Eaton Cooper: Order (2015-CE-48003)

    Broader source: Energy.gov [DOE]

    DOE ordered Eaton Cooper Lighting to pay a $8,000 civil penalty after finding Eaton Cooper had failed to certify that certain models of illuminated exit signs comply with the applicable energy conservation standards.

  14. ORDER 3768: PIERIDAE ENERGY (USA) LTD.

    Broader source: Energy.gov [DOE]

    OPINION AND ORDER GRANTING LONG-TERM, MULTI-CONTRACT AUTHORIZATION TO EXPORT U.S.-SOURCED NATURAL GAS BY PIPELINE TO CANADA FOR LIQUEFACTION AND RE-EXPORT IN THE FORM OF LIQUEFIED NATURAL GAS TO...

  15. Euro Chef USA: Order (2014-CE-23004)

    Broader source: Energy.gov [DOE]

    DOE ordered Euro Chef USA Inc. to pay a $8,000 civil penalty after finding Euro Chef USA had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  16. Duro Corporation: Order (2014-CE-23009)

    Broader source: Energy.gov [DOE]

    DOE ordered Duro Corporation to pay a $8,000 civil penalty after finding Duro Corporation had failed to certify that certain models of cooking products comply with the applicable energy conservation standards.

  17. Mackle Company: Order (2010-SE-0106)

    Broader source: Energy.gov [DOE]

    DOE ordered Mackle Company, Inc. to pay a $27,200 civil penalty after finding the company had failed to certify that a variety of refrigerators, refrigerator-freezers, and freezers comply with the applicable energy conservation standards.

  18. Act One: Order (2013-CE-49001)

    Broader source: Energy.gov [DOE]

    DOE ordered Act One Communications, Inc. to pay a $8,000 civil penalty after finding Act One had failed to certify that certain basic models of traffic signal modules and pedestrian modules comply with the applicable energy conservation standards.

  19. GE Appliances: Order (2010-CE-2113)

    Broader source: Energy.gov [DOE]

    DOE issued an Order after entering into a Compromise Agreement with General Electric Appliances after finding GE Appliances had failed to certify that certain models of dehumidifiers comply with the applicable energy conservation standards.

  20. Acme Kitchenettes: Order (2011-CE-1406)

    Broader source: Energy.gov [DOE]

    DOE ordered Acme Kitchenettes Corp. to pay a $6,000 civil penalty after finding Acme Kitchenettes had failed to certify that certain models of refrigerators comply with the applicable energy conservation standards.

  1. International Refrigeration: Order (2012-CE-1510)

    Broader source: Energy.gov [DOE]

    DOE ordered International Refrigeration Products to pay an $8,000 civil penalty after finding International Refrigeration had failed to certify that certain room air conditioners comply with the applicable energy conservation standard.

  2. Volume International: Order (2014-CE-32014)

    Broader source: Energy.gov [DOE]

    DOE ordered Volume International Corporation to pay a $8,000 civil penalty after finding Volume International had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  3. Orders Granting Natural Gas, LNG & CNG Authorizations Issued...

    Office of Environmental Management (EM)

    Orders Granting Natural Gas, LNG & CNG Authorizations Issued in 2014 Orders Granting Natural Gas, LNG & CNG Authorizations Issued in 2014 Order 3378 - Encana Natural Gas Inc. Order...

  4. Orderings for incomplete factorization preconditioning of nonsymmetric

    Office of Scientific and Technical Information (OSTI)

    problems (Journal Article) | SciTech Connect Orderings for incomplete factorization preconditioning of nonsymmetric problems Citation Details In-Document Search Title: Orderings for incomplete factorization preconditioning of nonsymmetric problems Numerical experiments are presented whereby the effect of reorderings on the convergence of preconditioned Krylov subspace methods for the solution of nonsymmetric linear systems is shown. The preconditioners used in this study are different

  5. Consent Order EA-2005-01

    Energy Savers [EERE]

    20585 July 28, 2005 Mr. T. E. Logan, President Bechtel Hanford, Inc. 3070 George Washington Way Richland, WA 99352 Consent Order 2005-01 Subject: Consent Order Incorporating Agreement between U.S. Department of Energy and Bechtel Hanford, Inc. Dear Mr. Logan: The Department of Energy (DOE) has reviewed Bechtel Hanford, Inc.'s (Bechtel Hanford) investigation and supporting documentation associated with two events occurring at the 618-2 Burial Ground in December 2004. These events resulted in

  6. NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661

    Gasoline and Diesel Fuel Update (EIA)

    61- NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. AH telephone orders should be directed to: U.S. Government Printing Office McPherson Square Bookstore 1510 H Street, N.W. Washington, DC 20005 (202)653-2050 FAX (202)376-5055 9 a.m. to 5 p.m., eastern time, M-F All mail orders should be directed to: Superintendent of Documents U.S.

  7. HODIF:High-Order Discretizations, Interpolations and

    Energy Science and Technology Software Center (OSTI)

    2006-06-20

    This software, a library, contains FORTRAN77 subroutines to calculate first and second derivatives up to 8th order, interpolations (1D and 2D) up to 10th order and filters up to 14th order. Only even orders are addressed and finite-difference stencils are implemented on a vertex-centered mesh. The primary aim of this library is to be used in block-structured adaptive mesh simulations where high order is desired. The interpolants in this library are essentially designed to domore » prolongations and restrictions between levels of rfinement - however, they assume that the refinement ratio is 2. The filters are provided to remove high wavenumber content from solutions in case Runge phenomenon occurs - a common occurrence in case of marginal resolution of the solution. Details of the derivation and use are to be found in "Using high-order methods on adaptively refined block-structured meshes - discretizations, interpolations and filters", by J. Ray, C.A. Kennedy, S. Lefantzi and H.N. Najm, Sandia Technical Report, SAND2005-7981. The software comes with a User's Guide and examples how to use it.« less

  8. Order Module--DOE Order 422.1, CONDUCT OF OPERATIONS | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OPERATIONS Order Module--DOE Order 422.1, CONDUCT OF OPERATIONS The general approach to implementing DOE O 422.1 is for contractors to develop, for DOE line management approval, ...

  9. Fe-based long range ordered alloys

    DOE Patents [OSTI]

    Liu, Chain T; Inouye, Henry; Schaffhauser, Anthony C.

    1980-01-01

    Malleable long range ordered alloys having high critical ordering temperatures exist in the V(Co,Fe).sub.3 and V(Co,Fe,Ni).sub.3 system having the composition comprising by weight 22-23% V, 35-50% Fe, 0-22% Co and 19-40% Ni with an electron density no greater than 8.00. Excellent high temperature properties occur in alloys having compositions comprising by weight 22-23% V, 35-45% Fe, 0-10% Co, 25-35% Ni; 22-23% V, 28-33% Ni and the remainder Fe; and 22-23% V, 19-22% Ni, 19-22% Co and the remainder Fe. The alloys are fabricable by casting, deforming and annealing for sufficient time to provide ordered structure.

  10. Fe-based long range ordered alloys

    DOE Patents [OSTI]

    Liu, C.T.

    Malleable long range ordered alloys with high critical ordering temperatures exist in the V(Co,Fe)/sub 3/ and V(Co,Fe,Ni)/sub 3/ system. The composition comprising by weight 22 to 23% V, 35 to 50% Fe, 0 to 22% Co and 19 to 40% Ni with an electron density no greater than 8.00. Excellent high temperature properties occur in alloys having compositions comprising by weight 22 to 23% V, 35 to 45% Fe, 0 to 10% Co, 25 to 35% Ni; 22 to 23% V, 28 to 33% Ni and the remainder Fe; and 22 to 23% V, 19 to 22% Co and the remainder Fe. The alloys are fabricable by casting, deforming and annealing for sufficient time to provide ordered structure.

  11. Administrative Order, June 13, 2000 Summary

    Office of Environmental Management (EM)

    Administrative Order No. 00NWPKW-1251 State Washington Agreement Type Administrative Order Legal Driver(s) RCRA Scope Summary Resolve Ecology's October 12, 1999 finding that DOE failed to complete Major TPA Milestone M-32 with respect to Double-Shell Tank (DST) integrity assessments Parties DOE; CH2M Hill Hanford Group; State of Washington Department of Ecology Date 6/13/2000 SCOPE * Require DOE and CH2M Hill Hanford Group to comply with the Revised Code of Washington, HWMA, Washington

  12. Nationwide Industries: Order (2011-CW-2803)

    Broader source: Energy.gov [DOE]

    DOE ordered Nationwide Industries, Inc., d/b/a Banner Faucets to pay a $6,000 civil penalty after finding Nationwide Industries had failed to certify that certain models of faucets and showerheads comply with the applicable water conservation standards.

  13. Hudson-Reed: Order (2010-CW-1403)

    Broader source: Energy.gov [DOE]

    DOE ordered Hudson-Reed Limited to pay an $80,000 civil penalty after finding (1) Hudson-Reed had failed to certify that certain models of showerheads comply with the applicable water conservation standard and (2) Hudson-Reed had distributed in commerce in the U.S. certain models of showerheads that did not comply with the applicable water conservation standard.

  14. American Standard: Order (2013-CW-3001)

    Broader source: Energy.gov [DOE]

    DOE ordered AS America, Inc., d/b/a American Standard Brands to pay a $8,000 civil penalty after finding American Standard had failed to certify that certain models of water closets comply with the applicable water conservation standards.

  15. R-Cold: Order (2013-CE-5354)

    Broader source: Energy.gov [DOE]

    DOE ordered R-Cold, Inc. to pay a $8,000 civil penalty after finding R-Cold had failed to certify that any basic models of walk-in cooler or freezer components comply with the applicable energy conservation standards.

  16. GE Lighting Solutions: Order (2013-SE-4901)

    Broader source: Energy.gov [DOE]

    DOE ordered General Electric Lighting Solutions, LLC to pay a $5,360 civil penalty after finding GE Lighting Solutions had manufactured and distributed in commerce in the U.S. 30 units of basic model DR4-RTFB-23B and 177 units (of which 85 units remain in inventory) of basic model DR4-RTFB-77A-002, noncompliant traffic signal modules.

  17. Commercial Display Systems: Order (2013-CE-5350)

    Broader source: Energy.gov [DOE]

    DOE ordered Commercial Display Systems, LLC to pay a $8,000 civil penalty after finding Commercial Display Systems had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  18. Advance Energy Technologies: Order (2013-CE-5302)

    Broader source: Energy.gov [DOE]

    DOE ordered Advance Energy Technologies, Inc., to pay a $8,000 civil penalty after finding Advance Energy Technologies had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standard.

  19. General Restaurant Equipment: Order (2013-CE-5344)

    Broader source: Energy.gov [DOE]

    DOE ordered General Restaurant Equipment Co. to pay a $8,000 civil penalty after finding General Restaurant Equipment had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  20. Commercial Refrigerator Door: Order (2013-CE-5351)

    Broader source: Energy.gov [DOE]

    DOE ordered Commercial Refrigerator Door Company, Inc. to pay a $8,000 civil penalty after finding Commercial Refrigerator Door had failed to certify that a variety of models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  1. Sanden Vendo America: Order (2014-SE-52002)

    Broader source: Energy.gov [DOE]

    DOE ordered Sanden Vendo America Inc. to pay a $6,200 civil penalty after finding Sanden Vendo America had manufactured and distributed in commerce in the U.S. 31 units of Class A refrigerated bottled or canned beverage vending machine model Vue30 (with 1128127 cassette refrigeration deck), a noncompliant product.

  2. Royal Pacific: Order (2013-SE-33004)

    Broader source: Energy.gov [DOE]

    DOE ordered Royal Pacific, Ltd. to pay a $8,000 civil penalty after finding Royal Pacific had failed to certify that various basic models of medium base compact fluorescent lamps, ceiling fans, ceiling fan light kits, and illuminated exit signs comply with the applicable energy conservation standards.

  3. Lutron Electronics: Order (2012-SE-3796)

    Broader source: Energy.gov [DOE]

    DOE ordered Lutron Electronics Co., Inc. to pay a $13,000 civil penalty after finding Lutron Electronics had manufactured and distributed in commerce in the U.S. at least 79,000 units of various basic models, noncompliant Class A external power supplies.

  4. Mueller Streamline: Order (2011-SW-2802)

    Broader source: Energy.gov [DOE]

    DOE ordered Mueller Streamline Co. to pay a $25,000 civil penalty after finding Mueller Streamline had privately labeled and distributed in commerce in the U.S. approximately 17,412 units of model 120-003NL noncompliant faucets.

  5. American Cooler Technologies: Order (2013-CE-5305)

    Broader source: Energy.gov [DOE]

    DOE ordered American Cooler Technologies to pay a $8,000 civil penalty after finding American Cooler Technologies had failed to certify that certain models of walk-in coolers or freezers (WICF) components comply with the applicable energy conservation standards.

  6. Nordyne: Order (2010-CE-01/0210)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Nordyne, LLC d/b/a Garrison Heating and Cooling Products to pay a $10,000 civil penalty after finding Nordyne had failed to certify that certain models of central air conditioners and central air conditioning heat pumps comply with the applicable energy conservation standard.

  7. Matthews Fan: Order (2014-CE-32012)

    Broader source: Energy.gov [DOE]

    DOE ordered Matthews-Gerbar, Ltd. d/b/a Matthews Fan Company to pay a $8,000 civil penalty after finding Matthews had failed to certify that certain models of ceiling fans comply with the applicable energy conservation standards.

  8. Duracold Refrigeration Manufacturing: Order (2013-CE-5342)

    Broader source: Energy.gov [DOE]

    DOE ordered Duracold Refrigeration Manufacturing Company, LLC to pay a $8,000 civil penalty after finding Duracold Refrigeration Manufacturing had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  9. North Star Refrigerator: Order (2013-CE-5355)

    Broader source: Energy.gov [DOE]

    DOE ordered North Star Refrigerator Co., Inc. to pay a $8,000 civil penalty after finding North Star Refrigerator had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  10. Thermo Products: Order (2011-SE-1603)

    Broader source: Energy.gov [DOE]

    DOE ordered Thermo Products, LLC, to pay a $6,000 civil penalty after finding Thermo Products had failed to conduct the required testing to certify that certain models of central air conditioning heat pumps comply with the applicable energy conservation standard.

  11. Schott Gemtron: Order (2013-CE-5358)

    Broader source: Energy.gov [DOE]

    DOE ordered Schott Gemtron Corp. to pay a $6,000 civil penalty after finding Schott Gemtron had failed to certify that the Kodiak model line of walk-in cooler and freezer doors complies with the applicable energy conservation standards.

  12. PermaTherm: Order (2013-CE-5356)

    Broader source: Energy.gov [DOE]

    DOE ordered PermaTherm, Inc. to pay a $8,000 civil penalty after finding PermaTherm had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  13. Golden Opportunity: Order (2014-CE-20003)

    Broader source: Energy.gov [DOE]

    DOE ordered Golden Opportunity, Inc. to pay a $8,000 civil penalty after finding Golden Opportunity had failed to certify that certain models of room air conditioners, central air conditioners/heat pumps, and residential clothes washers comply with the applicable energy conservation standards.

  14. Mile High: Order (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE ordered Mile High Equipment, LLC to pay a $17,525 civil penalty after finding Mile High had manufactured and distributed in commerce in the U.S. approximately 109 units of lce-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW, a noncompliant product.

  15. Watermark Designs: Order (2010-CW-1404)

    Broader source: Energy.gov [DOE]

    DOE ordered Watermark Designs Holdings, Ltd. d/b/a Watermark Designs, Ltd. to pay a $135,104 civil penalty after finding Watermark Designs had failed to certify that various models of showerheads comply with the applicable water conservation standards.

  16. Heat Controller: Order (2014-SE-15004)

    Broader source: Energy.gov [DOE]

    DOE ordered Heat Controller, Inc. to abide by the terms of a February 11, 2014 Notice of Noncompliance Determination, after finding Heat Controller had privately labeled and distributed in commerce in the U.S. at least 7,314 noncompliant units of Comfort-Aire branded room air conditioner models CGREG-81H and REG-81J.

  17. MC Appliance: Order (2012-CE-1508)

    Broader source: Energy.gov [DOE]

    DOE ordered CNA International Inc. d/b/a MC Appliance Corporation to pay a $8,000 civil penalty after finding MC Appliance had failed to certify that certain models of room air conditioners comply with the applicable energy conservation standards.

  18. Diversified Panel Systems: Order (2013-CE-5346)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Diversified Panel Systems, Inc. to pay a $8,000 civil penalty after finding Diversified Panel Systems had failed to certify that certain models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  19. Kingspan Insulated Panels: Order (2013-CE-5353)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered Kingspan Insulated Panels, Inc. to pay a $8,000 civil penalty after finding Kingspan Insulated Panels had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  20. Metl-Span: Order (2013-CE-5352)

    Broader source: Energy.gov [DOE]

    DOE ordered Metl-Span LLC to pay a $8,000 civil penalty after finding Metl-Span had failed to certify that any basic models of walk-in cooler and freezer components comply with the applicable energy conservation standards.

  1. Ingersoll-Rand: Order (2012-SE-1608)

    Broader source: Energy.gov [DOE]

    DOE ordered Ingersoll-Rand to pay a $800 civil penalty after finding Ingersoll-Rand had manufactured and distributed in commerce in the U.S. four units of basic model 2TTA0060A4000C, a noncompliant central air conditioner.

  2. Exploring intertwined orders in cuprate superconductors

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Tranquada, John M.

    2014-11-22

    In this study, the concept of intertwined orders has been introduced to describe the cooperative relationship between antiferromagnetic spin correlations and electron (or hole) pair correlations that develop in copper-oxide superconductors. This contrasts with systems in which, for example, charge-density-wave (CDW) order competes for Fermi surface area with superconductivity. La2-xBaxCuO4 with x = 0.125 provides an example in which the ordering of spin stripes coincides with the onset of two-dimensional superconducting correlations. The apparent frustration of the interlayer Josephson coupling has motivated the concept of the pair-density-wave superconductor, a state that theoretical calculations show to be energetically competitive with themore » uniform d-wave superconductor. Even at x = 0.095, where there is robust superconductivity below 32 K in zero field, the coexistence of strong, low-energy, incommensurate spin excitations implies a spatially modulated and intertwined pair wave function. Recent observations of CDW order in YBa2Cu3O6+x and other cuprate families have raised interesting questions regarding the general role of charge modulations and the relation to superconductivity. While there are differences in the doping dependence of the modulation wave vectors in YBa2Cu3O6+x and La2-xBaxCuO4, the maximum ordering strength is peaked at the hole concentration of 1/8 in both cases. There are also possible connections with the quantum oscillations that have been detected about the same hole concentration but at high magnetic fields. Resolving these relationships remains a research challenge.« less

  3. Short range smectic order driving long range nematic order: Example of cuprates

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Markiewicz, R. S.; Lorenzana, J.; Seibold, G.; Bansil, A.

    2016-01-27

    We present a model for describing the combined presence of nematic and ‘smectic’ or stripe-like orders seen in recent scanning tunneling microscopy (STM) experiments on cuprates. The smectic order is treated as an electronic charge density wave with an associated Peierls distortion or a ‘Pomeranchuk wave’. This primary order is restricted to nanoscale domains by disorder effects, while the secondary coupling to strain generates the nematic order with a considerably longer range. Lastly, a variety of experimental results are shown to be consistent with our theoretical predictions.

  4. Environmental embrittlement in ordered intermetallic alloys

    SciTech Connect (OSTI)

    Liu, C.T.; Stoloff, N.S.

    1992-12-31

    Ordered intermetallics based on aluminides and silicides possess many promising properties for elevated-temperature applications; however, poor fracture resistance and limited fabricability restrict their use as engineering material. Recent studies have shown that environmental embrittlement is a major cause of low ductility and brittle fracture in many ordered intermetallic alloys. There are two types of environmental embrittlement observed in intermetallic alloys. One is hydrogen-induced embrittlement occurring at ambient temperatures in air. The other is oxygen-induced embrittlement in oxidizing atmospheres at elevated temperatures. In most cases, the embrittlements are due to a dynamic effect involving generation and penetration of embrittling agents (i.e., hydrogen or oxygen ) during testing. Diffusion of embrittling agents plays a dominant role in fracture of these intermetallic alloys. This chapter summarizes recent progress in understanding and reducing environmental embrittlement in these alloys.

  5. A practical exercise in assessing order compliance

    SciTech Connect (OSTI)

    Hallinan, E.J.

    1993-01-01

    Two orders impacting DOE nuclear safety analyses were issued in 1992: DOE 5480.22, Technical Safety Requirements,'' and DOE 5480.23, Nuclear Safety Analysis Reports.'' Both orders required submitting plans and schedules for compliance with the new requirements by 6 months from the issuance dates. These assessments resulted in a major effort by the Westinghouse Savannah River Co. (WSRC) for some 30 current and future safety analyses that span three Program Secretarial Offices. Further, the local field office expressed a vital interest in determining the shape of compliance for site nuclear operations. Thus, a team of about 20 people were involved in: Interpreting and obtaining concurrence with implementation issues; identifying applicable nuclear facilities; baselining the status of compliance with previous requirements; comparing new to previous requirements; scheduling future activities to achieve compliance with the new requirements; estimating baseline and additional costs; and obtaining management approvals.

  6. Ordered transport and identification of particles

    DOE Patents [OSTI]

    Shera, E.B.

    1993-05-11

    A method and apparatus are provided for application of electrical field gradients to induce particle velocities to enable particle sequence and identification information to be obtained. Particle sequence is maintained by providing electroosmotic flow for an electrolytic solution in a particle transport tube. The transport tube and electrolytic solution are selected to provide an electroosmotic radius of >100 so that a plug flow profile is obtained for the electrolytic solution in the transport tube. Thus, particles are maintained in the same order in which they are introduced in the transport tube. When the particles also have known electrophoretic velocities, the field gradients introduce an electrophoretic velocity component onto the electroosmotic velocity. The time that the particles pass selected locations along the transport tube may then be detected and the electrophoretic velocity component calculated for particle identification. One particular application is the ordered transport and identification of labeled nucleotides sequentially cleaved from a strand of DNA.

  7. Ordered transport and identification of particles

    DOE Patents [OSTI]

    Shera, E. Brooks

    1993-01-01

    A method and apparatus are provided for application of electrical field gradients to induce particle velocities to enable particle sequence and identification information to be obtained. Particle sequence is maintained by providing electroosmotic flow for an electrolytic solution in a particle transport tube. The transport tube and electrolytic solution are selected to provide an electroosmotic radius of >100 so that a plug flow profile is obtained for the electrolytic solution in the transport tube. Thus, particles are maintained in the same order in which they are introduced in the transport tube. When the particles also have known electrophoretic velocities, the field gradients introduce an electrophoretic velocity component onto the electroosmotic velocity. The time that the particles pass selected locations along the transport tube may then be detected and the electrophoretic velocity component calculated for particle identification. One particular application is the ordered transport and identification of labeled nucleotides sequentially cleaved from a strand of DNA.

  8. Optical waveguides having flattened high order modes

    DOE Patents [OSTI]

    Messerly, Michael Joseph; Beach, Raymond John; Heebner, John Edward; Dawson, Jay Walter; Pax, Paul Henry

    2014-08-05

    A deterministic methodology is provided for designing optical fibers that support field-flattened, ring-like higher order modes. The effective and group indices of its modes can be tuned by adjusting the widths of the guide's field-flattened layers or the average index of certain groups of layers. The approach outlined here provides a path to designing fibers that simultaneously have large mode areas and large separations between the propagation constants of its modes.

  9. Ordered organic-organic multilayer growth

    DOE Patents [OSTI]

    Forrest, Stephen R.; Lunt, Richard R.

    2016-04-05

    An ordered multilayer crystalline organic thin film structure is formed by depositing at least two layers of thin film crystalline organic materials successively wherein the at least two thin film layers are selected to have their surface energies within .+-.50% of each other, and preferably within .+-.15% of each other, whereby every thin film layer within the multilayer crystalline organic thin film structure exhibit a quasi-epitaxial relationship with the adjacent crystalline organic thin film.

  10. Ordered organic-organic multilayer growth

    DOE Patents [OSTI]

    Forrest, Stephen R; Lunt, Richard R

    2015-01-13

    An ordered multilayer crystalline organic thin film structure is formed by depositing at least two layers of thin film crystalline organic materials successively wherein the at least two thin film layers are selected to have their surface energies within .+-.50% of each other, and preferably within .+-.15% of each other, whereby every thin film layer within the multilayer crystalline organic thin film structure exhibit a quasi-epitaxial relationship with the adjacent crystalline organic thin film.

  11. AeroSys: Order (2011-SCE-1624)

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE ordered AeroSys, Inc. (AeroSys) to pay a $100,000 civil penalty after finding AeroSys had (1) failed to certify that certain models of space-constrained central air conditioners and air conditioning heat pumps comply with the applicable energy conservation standards; and (2) manufactured and distributed in commerce in the U.S. units of noncompliant models of space-constrained central air conditioners and air conditioning heat pumps.

  12. Battelle Consent Order (WCO-2014-01)

    Energy Savers [EERE]

    20585 October 24, 2014 Mr. Michael Kluse Laboratory Director Battelle Memorial Institute Pacific Northwest National Laboratory 790 6th Street MSIN: K1-46 Richland, Washington 99354 WCO-2014-01 Dear Mr. Kluse: This letter transmits the consent order between the Office of Enterprise Assessments' Office of Enforcement and Battelle Memorial Institute (Battelle) to resolve the Department of Energy's (DOE) investigation into the deficiencies identified by Battelle related to the Pacific Northwest

  13. FEMA - Executive Order11988 - Floodplain Management 1977 | Open...

    Open Energy Info (EERE)

    Order11988 - Floodplain Management 1977 Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Executive OrderExecutive Order: FEMA - Executive...

  14. TEMPORARY BADGE CHECKOUT SHEET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOSIMETER ASSIGNMENT CHECK SHEET (Please type or print clearly) 1. Last Name: 2. First Name: 3. M.I.: 4. DOB (mmddyy): 5. SSN * : 6. Bengal ID: 7. Sex: M F 8. E-mail: 9. Home...

  15. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SRR-ESH-2013-00054 Revision 1 August 28, 2013 Page 1 of 6 Consent Order of Dismissal, Section III.7 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 7,845 kgals Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B b) Process volume of saltstone grout disposed and vault/disposal unit location (including cell

  16. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SRR-ESH-2014-00039 Revision 1 August 28, 2014 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 8,770 kgals Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cell 5B b) Process volume of saltstone grout disposed and vault/disposal unit location

  17. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SRR-ESH-2014-00076 Revision 1 Posted Date: December 2, 2014 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 9,066 kgal Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cell 5B b) Process volume of saltstone grout disposed and vault/disposal

  18. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SRR-ESH-2014-00113 Revision 1 Posted Date: March 2, 2015 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 9,894 kgal Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cell 5B b) Process volume of saltstone grout disposed and vault/disposal unit

  19. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SRR-ESH-2015-00014 Revision 1 Posted Date: May 29, 2015 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 9,894 kgal Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cell 5B b) Process volume of saltstone grout disposed and vault/disposal unit

  20. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SRR-ESH-2015-00110 Revision 1 Post Date: February 29, 2016 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 10, 722 kgal Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cells 5A and 5B b) Process volume of saltstone grout disposed and

  1. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SRR-ESH-2016-00025 Revision 0 Post Date: February 29, 2016 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 10, 744 kgal SDU 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells A and B SDU 5, Cells A and B b) Process volume of saltstone grout disposed and

  2. Consent Order of Dismissal, Section III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SRR-ESH-2015-00052 Revision 1 Post Date: August 28, 2015 Page 1 of 6 Z-Area Saltstone Disposal Facility Permit General Condition B.5.a-h Information and Consent Order of Dismissal, Section III.7 Permit Condition Requirement Estimated Value Updated Value Comments B.5 a) Cumulative process volume of salt waste disposed to date Not Applicable 9,948 kgal Vault 4, Cells B, D, E, F, H, J, K, L SDU 2, Cells 2A and 2B SDU 5, Cell 5B b) Process volume of saltstone grout disposed and vault/disposal unit

  3. Revised Guidelines for Implementing Executive Order 11988, "Floodplain...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guidelines for Implementing Executive Order 11988, "Floodplain Management," and Executive ... Revised Guidelines for Implementing Executive Order 11988, "Floodplain Management," and ...

  4. Hybrid reduced order modeling for assembly calculations

    SciTech Connect (OSTI)

    Bang, Y.; Abdel-Khalik, H. S.; Jessee, M. A.; Mertyurek, U.

    2013-07-01

    While the accuracy of assembly calculations has considerably improved due to the increase in computer power enabling more refined description of the phase space and use of more sophisticated numerical algorithms, the computational cost continues to increase which limits the full utilization of their effectiveness for routine engineering analysis. Reduced order modeling is a mathematical vehicle that scales down the dimensionality of large-scale numerical problems to enable their repeated executions on small computing environment, often available to end users. This is done by capturing the most dominant underlying relationships between the model's inputs and outputs. Previous works demonstrated the use of the reduced order modeling for a single physics code, such as a radiation transport calculation. This manuscript extends those works to coupled code systems as currently employed in assembly calculations. Numerical tests are conducted using realistic SCALE assembly models with resonance self-shielding, neutron transport, and nuclides transmutation/depletion models representing the components of the coupled code system. (authors)

  5. Magnetic and charge ordering in nanosized manganites

    SciTech Connect (OSTI)

    Zhang, T. Wang, X. P.; Fang, Q. F.; Li, X. G.

    2014-09-15

    Perovskite manganites exhibit a wide range of functional properties, such as colossal magneto-resistance, magnetocaloric effect, multiferroic property, and some interesting physical phenomena including spin, charge, and orbital ordering. Recent advances in science and technology associated with perovskite oxides have resulted in the feature sizes of microelectronic devices down-scaling into nanoscale dimensions. The nanoscale perovskite manganites display novel magnetic and electronic properties that are different from their bulk and film counterparts. Understanding the size effects of perovskite manganites at the nanoscale is of importance not only for the fundamental scientific research but also for developing next generation of electronic and magnetic nanodevices. In this paper, the current understanding and the fundamental issues related to the size effects on the magnetic properties and charge ordering in manganites are reviewed, which covers lattice structure, magnetic and electronic properties in both ferromagnetic and antiferromagnetic based manganites. In addition to review the literatures, this article identifies the promising avenues for the future research in this area.

  6. Amendment No. 3 to Delegation Order No. 204-108 Delegation Order for

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Approval of Power Marketing Administration Power and Transmission Rates - DOE Directives, Delegations, and Requirements 204.108, Amendment No. 3 to Delegation Order No. 204-108 Delegation Order for Approval of Power Marketing Administration Power and Transmission Rates by johnsonmd Functional areas: Miscellaneous 0204_108.pdf -- PDF Document, 8 KB ID: 204.108 Type: Delegation Delegant: Hazel R. O'Leary, Secretary of Energy Delegate: Administrators of the Southeastern, Southwestern, and

  7. Bond order potential module for LAMMPS

    Energy Science and Technology Software Center (OSTI)

    2012-09-11

    pair_bop is a module for performing energy calculations using the Bond Order Potential (BOP) for use in the parallel molecular dynamics code LAMMPS. The bop pair style computes BOP based upon quantum mechanical incorporating both sigma and pi bondings. By analytically deriving the BOP pair bop from quantum mechanical theory its transferability to different phases can approach that of quantum mechanical methods. This potential is extremely effective at modeling 111-V and II-VI compounds such asmore » GaAs and CdTe. This potential is similar to the original BOP developed by Pettifor and later updated by Murdock et al. and Ward et al.« less

  8. Adaptive h -refinement for reduced-order models: ADAPTIVE h -refinement for reduced-order models

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Carlberg, Kevin T.

    2014-11-05

    Our work presents a method to adaptively refine reduced-order models a posteriori without requiring additional full-order-model solves. The technique is analogous to mesh-adaptive h-refinement: it enriches the reduced-basis space online by ‘splitting’ a given basis vector into several vectors with disjoint support. The splitting scheme is defined by a tree structure constructed offline via recursive k-means clustering of the state variables using snapshot data. This method identifies the vectors to split online using a dual-weighted-residual approach that aims to reduce error in an output quantity of interest. The resulting method generates a hierarchy of subspaces online without requiring large-scale operationsmore » or full-order-model solves. Furthermore, it enables the reduced-order model to satisfy any prescribed error tolerance regardless of its original fidelity, as a completely refined reduced-order model is mathematically equivalent to the original full-order model. Experiments on a parameterized inviscid Burgers equation highlight the ability of the method to capture phenomena (e.g., moving shocks) not contained in the span of the original reduced basis.« less

  9. Task Order Price Evaluation Worksheet for ESPCs | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Task Order Price Evaluation Worksheet for ESPCs Task Order Price Evaluation Worksheet for ESPCs Document lists a series of site-specific proposal data questions to answer for a task order. Microsoft Office document icon Download the Task Order Price Evaluation Worksheet. More Documents & Publications Task Order Price Evaluation Worksheet for SUPER ESPC Descriptions of ESPC Task Order Schedules and Placement of Pricing Information (IDIQ Attachment J-5) ESPC Task Order Financial Schedules

  10. Executive Order 13423 Implementing Instructions | Department of Energy

    Energy Savers [EERE]

    423 Implementing Instructions Executive Order 13423 Implementing Instructions INSTRUCTIONS FOR IMPLEMENTING EXECUTIVE ORDER 13423 "Strengthening Federal Environmental, Energy, and Transportation Management" PDF icon Executive Order 13423 Implementing Instructions More Documents & Publications Implementing Executive Order 13423 Guidance for Federal Agencies on E.O. 13514 Section 12, Federal Fleet Management OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental,

  11. Multiple-Award Contracts and Governmentwide Acquisition Contracts Including Delivery Orders and Task Orders

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Chapter 16.5 (May 2011) 1 Multiple-Award Contracts and Governmentwide Acquisition Contracts Including Delivery Orders and Task Orders References Federal Acquisition Regulation (FAR) Subparts 1.1 Purpose, Authority, Issuance - 1.108 FAR conventions 2.1 Definitions 5.3 Synopses of Contract Awards 5.4 Release of Information 6 Competition Requirements 8.4 Federal Supply Schedules 9.1 Responsible Prospective Contractors - 9.105 Procedures 9.4 Debarment, Suspension and Ineligibility - 9.406 Debarment

  12. DOE Order 482.1 | Department of Energy

    Office of Environmental Management (EM)

    Order 482.1 DOE Order 482.1 DOE FACILITIES TECHNOLOGY PARTNERING PROGRAMS DOE Order 482.1 More Documents & Publications DOE Cooperative Research and Development Agreements DOE M...

  13. FEMA - Executive Order 11990 - Protection of Wetlands 1977 |...

    Open Energy Info (EERE)

    FEMA - Executive Order 11990 - Protection of Wetlands 1977 Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Executive OrderExecutive Order: FEMA -...

  14. PQL: Order (2013-CE-27001) | Department of Energy

    Energy Savers [EERE]

    Order (2013-CE-27001) PQL: Order (2013-CE-27001) August 7, 2015 DOE ordered P.Q.L, Inc. to pay a $12,500 civil penalty after finding PQL had failed to certify that certain models of medium base compact fluorescent lamps comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and PQL. PDF icon PQL: Order (2013-CE-27001) More Documents & Publications PQL: Proposed Penalty (2013-CE-27001) PQL: Order

  15. Perlick: Order (2013-SE-14001) | Department of Energy

    Energy Savers [EERE]

    Order (2013-SE-14001) Perlick: Order (2013-SE-14001) May 14, 2015 DOE ordered Perlick Corporation to pay a $168,200 civil penalty after finding Perlick had manufactured and distributed in commerce in the U.S. 841 units of basic model HP24F, a noncompliant freezer. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Perlick. PDF icon Perlick: Order (2013-SE-14001) More Documents & Publications Perlick: Proposed Penalty (2013-SE-14001) Perlick: Order

  16. Guidance for Meeting Executive Order 13514 Water Goals | Department...

    Energy Savers [EERE]

    Water Efficiency Guidance for Meeting Executive Order 13514 Water Goals Guidance for Meeting Executive Order 13514 Water Goals The Federal Energy Management Program offers...

  17. Executive Order 13221-Energy Efficient Standby Power Devices...

    Energy Savers [EERE]

    221-Energy Efficient Standby Power Devices Executive Order 13221-Energy Efficient Standby Power Devices Executive Order 13221-Energy Efficient Standby Power Devices PDF icon ...

  18. New Guidelines for Implementing Executive Order 11988, "Floodplain...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guidelines for Implementing Executive Order 11988, "Floodplain Management," And Executive Order 13690, "Establishing a Federal Flood Risk Management Standard..." New Guidelines for ...

  19. Nevada Test Site FFCA Consent Order, May 10, 1996 Summary

    Office of Environmental Management (EM)

    Federal Facility Agreement and Consent Order (FFACO) State Nevada Agreement Type Federal Facility Agreement and Consent Order Legal Driver(s) FFCAct Scope Summary Identify sites of ...

  20. Idaho National Engineering Laboratory Consent Order, June 14...

    Office of Environmental Management (EM)

    Idaho National Engineering & Environmental Laboratory Consent Order 39-4413 State Idaho Agreement Type Consent Order Legal Driver(s) RCRA Scope Summary Resolve situations which...

  1. DOE Awards Small Business Task Order for Technical Support to...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order for Technical Support to the Office of Environmental Management DOE Awards Small Business Task Order for Technical Support to the Office of Environmental Management June 27, ...

  2. DOE Order 435.1 Performance Assessment Savannah River Site |...

    Energy Savers [EERE]

    Order 435.1 Performance Assessment Savannah River Site DOE Order 435.1 Performance Assessment Savannah River Site Performance Assessments (PA) are analyses conducted for low level ...

  3. Compliance Order issued to Los Alamos National Laboratory | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Compliance Order issued to Los Alamos National Laboratory Compliance Order issued to Los Alamos National Laboratory Pursuant to the authority of the Secretary of Energy under ...

  4. Almo: Order (2012-CE-1416) | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    PDF icon 2012-CE-1416AlmoOrder More Documents & Publications Almo: Proposed Penalty (2012-CE-1416) International Refrigeration: Order (2012-CE-1510) Commercial Display Systems: ...

  5. DOE Celebrates 20-Year Anniversary of Executive Order 12898 on...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Celebrates 20-Year Anniversary of Executive Order 12898 on Environmental Justice DOE Celebrates 20-Year Anniversary of Executive Order 12898 on Environmental Justice April 8, ...

  6. White House Announces New Executive Order To Reduce Greenhouse...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    White House Announces New Executive Order To Reduce Greenhouse Gas Emissions in the Federal Government White House Announces New Executive Order To Reduce Greenhouse Gas Emissions ...

  7. OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy and Economic Performance OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy ...

  8. American Indian Policy and Relevant DOE and Executive Orders...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tribal Programs American Indian Policy and Relevant DOE and Executive Orders American Indian Policy and Relevant DOE and Executive Orders Over the course of American history, ...

  9. Ordered Nanoparticle Catalysts article is an Energy Focus > Archived...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ordered Nanoparticle Catalysts article is an Energy Focus January 24th, 2013 A Nature Materials paper on ordered nanoparticle catalysts has been highlighted as an "Energy...

  10. Notice of Emergency Action - Emergency Order To Resume Limited...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Emergency Action - Emergency Order To Resume Limited Operation at the Potomac River ... Notice of Emergency Action - Emergency Order To Resume Limited Operation at the Potomac ...

  11. Exotic magnetic orderings in the kagome Kondo-lattice model ...

    Office of Scientific and Technical Information (OSTI)

    Exotic magnetic orderings in the kagome Kondo-lattice model Title: Exotic magnetic orderings in the kagome Kondo-lattice model Authors: Barros, Kipton ; Venderbos, Jrn W. F. ; ...

  12. Charge flow model for atomic ordering in nonisovalent alloys...

    Office of Scientific and Technical Information (OSTI)

    Charge flow model for atomic ordering in nonisovalent alloys Title: Charge flow model for atomic ordering in nonisovalent alloys Authors: Wang, Shuzhi ; Wang, Lin-Wang Publication ...

  13. Text Processing an Order or Guide - DOE Directives, Delegations...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an Order or Guide Processing a Policy or Notice Processing an Order or Guide Canceling a Directive by Website Administrator Development from justification memorandum through review...

  14. Descriptions of ESPC Task Order Schedules and Placement of Pricing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pricing Information (IDIQ Attachment J-5) Descriptions of ESPC Task Order Schedules and Placement of Pricing Information (IDIQ Attachment J-5) Document provides task order ...

  15. Magnetic and nematic orderings in spin-1 antiferromagnets with...

    Office of Scientific and Technical Information (OSTI)

    Magnetic and nematic orderings in spin-1 antiferromagnets with single-ion anisotropy Citation Details In-Document Search Title: Magnetic and nematic orderings in spin-1 ...

  16. Westinghouse Lighting: Order (2010-CE-09/1001) | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Westinghouse Lighting: Order (2010-CE-091001) December 9, 2010 DOE ordered Westinghouse Lighting Corporation to pay a 50,000 civil penalty after finding Westinghouse Lighting had ...

  17. FERC Order No. 792 - Interconnection Agreement | Open Energy...

    Open Energy Info (EERE)

    FERC Order No. 792 - Interconnection Agreement Abstract FERC Order No. 792, Small Generator Interconnection Agreement, current through June 3, 2013. Form Type Other Form Topic...

  18. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  19. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  20. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  1. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  2. Rad-Hydro with a High-Order, Low-Order Method

    SciTech Connect (OSTI)

    Wollaber, Allan Benton; Park, HyeongKae; Lowrie, Robert Byron; Rauenzahn, Rick M.; Cleveland, Mathew Allen

    2015-08-04

    Moment-based acceleration via the development of high-order, low-order (HO-LO) algorithms has provided substantial accuracy and efficiency enhancements for solutions of the nonlinear, thermal radiative transfer equations by CCS-2 and T-3 staff members. Accuracy enhancements over traditional, linearized methods are obtained by solving a nonlinear, timeimplicit HO-LO system via a Jacobian-free Newton Krylov procedure. This also prevents the appearance of non-physical maximum principle violations (temperature spikes) associated with linearization. Efficiency enhancements are obtained in part by removing effective scattering from the linearized system. In this highlight, we summarize recent work in which we formally extended the HO-LO radiation algorithm to include operator-split radiation-hydrodynamics.

  3. Ductile long range ordered alloys with high critical ordering temperature and wrought articles fabricated therefrom

    DOE Patents [OSTI]

    Liu, Chain T.; Inouye, Henry

    1979-01-01

    Malleable long range ordered alloys having high critical ordering temperatures exist in the V(Fe, Co).sub.3 and V(Fe, Co, Ni).sub.3 systems. These alloys have the following compositions comprising by weight: 22-23% V, 14-30% Fe, and the remainder Co or Co and Ni with an electron density no more than 7.85. The maximum combination of high temperature strength, ductility and creep resistance are manifested in the alloy comprising by weight 22-23% V, 14-20% Fe and the remainder Co and having an atomic composition of V(Fe .sub.0.20-0.26 C Co.sub.0.74-0.80).sub.3. The alloy comprising by weight 22-23% V, 16-17% Fe and 60-62% Co has excellent high temperature properties. The alloys are fabricable into wrought articles by casting, deforming, and annealing for sufficient time to provide ordered structure.

  4. DOE Orders Mirant Power Plant to Operate Under Limited Circumstances |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Orders Mirant Power Plant to Operate Under Limited Circumstances DOE Orders Mirant Power Plant to Operate Under Limited Circumstances Docket No. EO-05-01. Order No. 202-05-3: Secretary of Energy Samuel W. Bodman today issued an order requiring Mirant Corporation's Potomac River Generating Station in Alexandria, Virginia (Mirant) to immediately resume limited operation. The order will help provide electric reliability for Washington, D.C., and will do so at the lowest

  5. Philips: Order (2014-SE-48006) | Department of Energy

    Energy Savers [EERE]

    Order (2014-SE-48006) Philips: Order (2014-SE-48006) April 14, 2015 DOE ordered Philips Lighting North America Corp. to pay a $75,000 civil penalty after finding Philips had manufactured and distributed in commerce in the U.S. at least 12,275 units of a variety of illuminated exit sign models. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Philips. PDF icon Philips: Order (2014-SE-48006) More Documents & Publications Philips: Proposed Penalty

  6. RPI: Order (2015-CE-42065) | Department of Energy

    Energy Savers [EERE]

    Order (2015-CE-42065) RPI: Order (2015-CE-42065) November 6, 2015 DOE ordered RPI Industries, Inc. to pay a $8,000 civil penalty after finding RPI had failed to certify that certain models of commercial refrigeration equipment comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and RPI. PDF icon RPI: Order (2015-CE-42065) More Documents & Publications RPI: Proposed Penalty (2015-CE-42065) Cal Flame:

  7. Everest Refrigeration: Order (2015-SE-42001) | Department of Energy

    Energy Savers [EERE]

    Order (2015-SE-42001) Everest Refrigeration: Order (2015-SE-42001) June 9, 2015 DOE ordered Bu Sung America Corporation (dba Everest Refrigeration) to pay a $12,080 civil penalty after finding Bu Sung had manufactured and distributed in commerce in the U.S. at least 64 units of noncompliant commercial refrigerator basic model ESGR3. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Bu Sung. PDF icon Everest Refrigeration: Order (2015-SE-42001) More

  8. Morris: Order (2013-SE-5403) | Department of Energy

    Energy Savers [EERE]

    Order (2013-SE-5403) Morris: Order (2013-SE-5403) July 21, 2015 DOE ordered Morris Products, Inc. to pay a $170,720 civil penalty after finding Morris had manufactured and distributed in commerce in the U.S. a large quantity of noncompliant metal halide lamp fixtures. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Morris. PDF icon Morris: Order (2013-SE-5403) More Documents & Publications Morris: Proposed Penalty (2013-SE-5403) Morris:

  9. Computer media security considerations: DOE Order 5635. 1A and DOE Order 5637. 1

    SciTech Connect (OSTI)

    Clever, J.J.

    1988-01-01

    This paper suggests that the examples for marking computer and word processing media and the written specifications for marking word processing media, contained in Chapter III, DOE Order 5635.1A, are technically incorrect. SNLA study indicates that strict compliance can lead to damage to the computer media drive and/or media itself. A model for technically appropriate marking is recommended which would facilitate longer distance visual identification of sensitive media, allow proper human readable identification of the classification levels, categories, special access/handling, and accountability/control data as applicable to the specific media. A diskette labeling example is provided which will meet the model requirements and which will not adversely act to cause damage to either the computer drive or the media. 5 refs., 15 figs.

  10. DOE Order 420.1C Briefing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Order 420.1C Briefing August 2013 PowerPoint Briefing of Changes to DOE O 420.1C and Expectations for Effective Implementation The revised Order clarifies, streamlines and ...

  11. Construction of energy-stable projection-based reduced order...

    Office of Scientific and Technical Information (OSTI)

    Construction of energy-stable projection-based reduced order models Prev Next Title: Construction of energy-stable projection-based reduced order models Our paper aims to ...

  12. Nevada Test Site FFCA Consent Order, March 27, 1996 Summary

    Office of Environmental Management (EM)

    Test Site Federal Facility Compliance Act Consent Order, March 27, 1996 State Nevada Agreement Type Consent Order Legal Driver(s) FFCAct Scope Summary Enforce the STP and establish ...

  13. Task Order Awarded to Small Business for Natural Gas Services...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Task Order Awarded to Small Business for Natural Gas Services Task Order Awarded to Small Business for Natural Gas Services December 30, 2013 - 12:00pm Addthis Media Contact ...

  14. General Order No. 131-D | Open Energy Information

    Open Energy Info (EERE)

    Order No. 131-D Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: General Order No. 131-DLegal Abstract Rules relating to the planning...

  15. CPUC General Order 131-D | Open Energy Information

    Open Energy Info (EERE)

    CPUC General Order 131-D Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: CPUC General Order 131-DLegal Abstract California...

  16. President Truman Orders Development of Thermonuclear Weapon | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration Orders Development of Thermonuclear Weapon President Truman Orders Development of Thermonuclear Weapon Washington, DC President Truman instructs the Atomic Energy Commission to expedite development of a thermonuclear weapon

  17. Cancellation Notice for Policies, Notices, Orders or Manuals - DOE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Directives, Delegations, and Requirements Notice for Policies, Notices, Orders or Manuals by Website Administrator Microsoft Word Document icon CancellationNotice-PoliciesNoticesOrdersManuals (2).doc - Microsoft Word Document, 30 KB (3123

  18. Savannah River Nuclear Solutions, LLC, Consent Order NCO-2016...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Savannah River Nuclear Solutions, LLC, Consent Order NCO-2016-01 Savannah River Nuclear Solutions, LLC, Consent Order NCO-2016-01 April 19, 2016 Nuclear Safety Enforcement Consent ...

  19. Goodman Manufacturing: Order (2012-CE-1509) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-CE-1509) Goodman Manufacturing: Order (2012-CE-1509) August 7, 2012 DOE ordered Goodman Manufacturing Company L.P. to pay an 8,000 civil penalty after finding Goodman...

  20. Executive Order 11988 - Floodplain Management | Open Energy Informatio...

    Open Energy Info (EERE)

    Order 11988 - Floodplain ManagementLegal Published NA Year Signed or Took Effect 1977 Legal Citation Exec. Order No. 11988, 3 CFR 1977 (1977). DOI Not Provided Check for DOI...

  1. DOE Orders/Standards and Applicable CFRs/DEAR Crosswalk

    Office of Environmental Management (EM)

    21102 1 DOE OrdersStandards and Applicable CFRsDEAR Crosswalk DOE Order Title Date Corresponding Standards Corresponding CFRsDEAR Clauses DOE O 3790.1B Federal Employee ...

  2. Paragon Sales: Order (2012-CE-1417) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order (2012-CE-1417) July 30, 2012 DOE ordered Paragon Sales Co., Inc., to pay a 6,000 civil penalty after finding Paragon Sales had failed to certify that certain models of...

  3. Manitowoc Foodservice: Order (2012-CE-5309) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order (2012-CE-5309) July 20, 2012 DOE ordered Manitowoc Foodservice to pay an 6,000 civil penalty after finding Manitowoc Foodservice had failed to certify that Manitowoc...

  4. Electrolux: Order (2012-CE-1901) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order (2012-CE-1901) July 27, 2012 DOE ordered Electrolux North America to pay a 6,500 civil penalty after finding Electrolux had failed to certify that certain dishwashers comply...

  5. Haier: Order (2011-CE-2104) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Haier: Order (2011-CE-2104) June 12, 2012 DOE ordered Haier to pay an 20,000 civil penalty after finding Haier had failed to certify that Haier residential clothes...

  6. Danby Products: Order (2012-CE-1415) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order (2012-CE-1415) August 9, 2012 DOE ordered Danby Products to pay a 9,900 civil penalty after finding Danby had failed to certify that certain models of refrigerators...

  7. High order reflectivity of graphite (HOPG) crystals for x ray...

    Office of Scientific and Technical Information (OSTI)

    High order reflectivity of graphite (HOPG) crystals for x ray energies up to 22 keV Citation Details In-Document Search Title: High order reflectivity of graphite (HOPG) crystals ...

  8. Applied Science and Technology Task Order Fiscal Year 2009 Year...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2009 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2009 Year-End ...

  9. Applied Science and Technology Task Order Fiscal Year 2008 Year...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2008 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2008 Year-End ...

  10. Applied Science and Technology Task Order Fiscal Year 2011 Year...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2011 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2011 Year-End ...

  11. Applied Science and Technology Task Order Fiscal Year 2010 Year...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2010 Year-End Summary Report Applied Science and Technology Task Order Fiscal Year 2010 Year-End ...

  12. FERC Order No. 2003 Appendix 6 - Large Generator Interconnection...

    Open Energy Info (EERE)

    FERC Order No. 2003 Appendix 6 - Large Generator Interconnection Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 6 -...

  13. Preliminary Notice of Violation and Compliance Order, EA-1999...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order, EA-1999-04 May 26, 1999 Issued to Fluor Daniel Hanford, Inc., relating to events ... and a Compliance Order (EA-1999-04) to Fluor Daniel Hanford, Inc. for violations of 10 ...

  14. Consent Orders and Settlement Agreements | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 31, 2015 Consent Order, Fluor-B&W Portsmouth, LLC - March 12, 2015 Worker Safety and Health Enforcement Consent Order issued to Fluor-B&W Portsmouth, LLC for deficiencies in ...

  15. Secretary Bodman Signs Order to Help Restore Electricity to East...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order to Help Restore Electricity to East Texas More Quickly Secretary Bodman Signs Order to Help Restore Electricity to East Texas More Quickly September 28, 2005 - 10:58am ...

  16. Reduced-Order Model Based Feedback Control For Modified Hasegawa...

    Office of Scientific and Technical Information (OSTI)

    Reduced-Order Model Based Feedback Control For Modified Hasegawa-Wakatani Model Citation Details In-Document Search Title: Reduced-Order Model Based Feedback Control For Modified ...

  17. Lochinvar: Order (2016-CE-24001) | Department of Energy

    Energy Savers [EERE]

    Lochinvar: Order (2016-CE-24001) Lochinvar: Order (2016-CE-24001) November 2, 2015 DOE ordered Lochinvar, LLC, to pay a $8,000 civil penalty after finding Lochinvar had failed to certify that certain models of pool heaters comply with the applicable energy conservation standard. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Lochinvar. DOE regulations require a manufacturer (which includes importers) to submit reports certifying that its products have

  18. Maxlite: Order (2015-CE-27018) | Department of Energy

    Energy Savers [EERE]

    5-CE-27018) Maxlite: Order (2015-CE-27018) May 14, 2015 DOE ordered Maxlite, Inc. to pay a $8,000 civil penalty after finding Maxlite had failed to certify that certain models of general service fluorescent lamps comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Maxlite. PDF icon Maxlite: Order (2015-CE-27018) More Documents & Publications Maxlite: Proposed Penalty (2015-CE-27018) Maxlite:

  19. Higher order perturbation theory - An example for discussion (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Higher order perturbation theory - An example for discussion Citation Details In-Document Search Title: Higher order perturbation theory - An example for discussion Higher order perturbation theory is developed in the form of a Taylor series expansion to third order to calculate the thermal utilization of a nonuniform cell. The development takes advantage of the self-adjoint property of the diffusion operator to provide a simple development of this illustration of

  20. LLNS Beryllium Consent Order Fact Sheet | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LLNS Beryllium Consent Order Fact Sheet LLNS Beryllium Consent Order Fact Sheet In November 2010, the U.S. Department of Energy (DOE) and the National Nuclear Security Administration (NNSA) issued a consent order to Lawrence Livermore National Security, LLC (LLNS) for deficiencies related to LLNS's implementation of DOE's Chronic Beryllium Disease Prevention Program (CBDPP) regulation at Lawrence Livermore National Laboratory. The consent order requires LLNS to implement corrective actions that

  1. Consent Order, Battelle Energy Alliance, LLC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Consent Order, Battelle Energy Alliance, LLC Consent Order, Battelle Energy Alliance, LLC April 27, 2016 Worker Safety and Health Enforcement Consent Order issued to Battelle Energy Alliance, LLC relating to an arc flash event at the Idaho National Laboratory. On April 27, 2016, the U.S. Department of Energy's (DOE) Office of Enforcement issued a Consent Order (WCO-2016-01) to Battelle Energy Alliance, LLC, the managing and operating contractor at DOE's Idaho National Laboratory, relating to an

  2. Fujitsu: Order (2015-CE-16014) | Department of Energy

    Energy Savers [EERE]

    Fujitsu: Order (2015-CE-16014) Fujitsu: Order (2015-CE-16014) October 27, 2015 DOE ordered Fujitsu General America, Inc. to pay a $8,000 civil penalty after finding Fujitsu had failed to certify that certain models of central air conditioners and heat pumps comply with the applicable energy conservation standards prior to distributing them in commerce. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Fujitsu. DOE regulations require a manufacturer (which

  3. Goodman Manufacturing: Order (2011-SE-4301) | Department of Energy

    Energy Savers [EERE]

    Goodman Manufacturing: Order (2011-SE-4301) Goodman Manufacturing: Order (2011-SE-4301) March 2, 2012 DOE ordered Goodman Manufacturing Company, L.P., to pay a $14,800 civil penalty after finding Goodman had manufactured and distributed in commerce in the U.S. at least 74 units of commercial package air conditioner basic model CPC180*. PDF icon Goodman Manufacturing: Order (2011-SE-4301) More Documents & Publications Goodman Manufacturing: Proposed Penalty (2011-SE-4301) Goodman

  4. Technical Standards, DOE Orders and Applicable CFRs/DEAR Crosswalk -

    Energy Savers [EERE]

    February 2, 2002 | Department of Energy DOE Orders and Applicable CFRs/DEAR Crosswalk - February 2, 2002 Technical Standards, DOE Orders and Applicable CFRs/DEAR Crosswalk - February 2, 2002 February 2, 2002 DOE Orders/Standards and Applicable CFRs/DEAR Crosswalk List PDF icon Technical Standards, DOE Orders and Applicable CFRs/DEAR Crosswalk More Documents & Publications Technical Standards,DOE Standards and Corresponding Directives Crosswalk - February 2, 2002 Technical Standards,

  5. Utility: Order (2016-CE-42007) | Department of Energy

    Energy Savers [EERE]

    CE-42007) Utility: Order (2016-CE-42007) January 5, 2016 DOE ordered Utility Refrigerator to pay a $8,000 civil penalty after finding Utility had failed to certify that certain models of commercial refrigerator equipment comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Utility. PDF icon Utility: Order (2016-CE-42007) More Documents & Publications Utility: Proposed Penalty (2016-CE-42007)

  6. Sanyo Electric: Order (2010-CE-1210) | Department of Energy

    Energy Savers [EERE]

    Sanyo Electric: Order (2010-CE-1210) Sanyo Electric: Order (2010-CE-1210) October 13, 2010 DOE issued an Order and entered into a Compromise Agreement with Sanyo E&E Corp. after finding Sanyo had used an improper method to submit its certification that certain models of residential refrigerators, refrigerator-freezers, and freezers comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Sanyo. PDF

  7. Systemair: Order (2016-CE-43003) | Department of Energy

    Energy Savers [EERE]

    Systemair: Order (2016-CE-43003) Systemair: Order (2016-CE-43003) February 23, 2016 DOE ordered Systemair, Inc., to pay a $8,000 civil penalty after finding Systemair had failed to certify that its single package vertical air conditioning and heating equipment comply with the applicable energy conservation standards. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Systemair. DOE regulations require a manufacturer (which includes importers) to submit

  8. Task Order Awarded for Technical Support Services | Department of Energy

    Energy Savers [EERE]

    Task Order Awarded for Technical Support Services Task Order Awarded for Technical Support Services September 26, 2013 - 12:00pm Addthis Media Contact Lynette Chafin, 513-246-0461 Lynette.Chafin@emcbc.doe.gov Cincinnati - The Department of Energy (DOE) today awarded a Task Order for Technical Services to Project Enhancement Corporation, of Germantown, MD, for technical support services at the Environmental Management 13 (EM-13) office in Washington DC. The task order was a competitive small

  9. Frustrated Material Refuses Orderly Arrangements | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Frustrated Material Refuses Orderly Arrangements Unlike most materials, a newly discovered oxide of lead, copper, and tellurium does not show an orderly arrangement of electron spins near the temperature of "absolute zero" Kelvin (-460 °F). Approaching "absolute zero", thermal vibrations slow and typically atoms, and their electron spins, find orderly arrangements resulting in long-range symmetry. In this material the electron spins fail to find an ordered state and thus are

  10. Text Processing an Order or Guide - DOE Directives, Delegations, and

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Requirements an Order or Guide Processing a Policy or Notice Processing an Order or Guide Canceling a Directive by Website Administrator Development from justification memorandum through review and publication Justification Memorandum (Initial step towards developing an unclassified Order or Guide) Office of Primary Interest (OPI Creates a justification memorandum for non-NNSA element or justification memorandum for an NNSA element to develop or revise an Order or Guide. Obtains signature of

  11. Request that DOE rescind Order No. 202-05-03 and Order No. 202-06-01 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy that DOE rescind Order No. 202-05-03 and Order No. 202-06-01 Request that DOE rescind Order No. 202-05-03 and Order No. 202-06-01 Docket No. EO-05-01: On behalf of the City of Alexandria ("Alexandria"), and pursuant to Department of Energy ("DOE") Order No. 202-05-3 and Order No. 202-06-1, we respectfully request that the DOE immediately rescind its authorization for the operation of the Potomac River Generating Station ("PRGS") under the

  12. DOE Order 350.3 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order 350.3 DOE Order 350.3 LABOR STANDARDS COMPLIANCE, CONTRACTOR LABOR RELATIONS, AND CONTRACTOR WORKFORCE RESTRUCTURING PROGRAMS PDF icon o350 3 (2) More Documents & Publications DOE Labor Relations Training and Information Session, November 3-4, 2015 Training Materials Davis-Bacon Compliance and Performance Executive Order 13673

  13. Executive Order 13423: Strengthening Federal Environmental, Energy, and

    Energy Savers [EERE]

    Transportation Management | Department of Energy Executive Order 13423: Strengthening Federal Environmental, Energy, and Transportation Management Executive Order 13423: Strengthening Federal Environmental, Energy, and Transportation Management Full text of Executive Order 13423: Strengthening Federal Environmental, Energy, and Transportation Management. PDF icon eo13423.pdf More Documents & Publications EO 13423: Strengthening Federal Environmental, Energy, and Transportation Management

  14. GE Appliances: Order (2012-SE-1403) | Department of Energy

    Energy Savers [EERE]

    Appliances: Order (2012-SE-1403) GE Appliances: Order (2012-SE-1403) October 3, 2012 DOE ordered GE Appliances, a Division of General Electric Company to pay a $63,000 civil penalty after finding GE had privately labeled and distributed in commerce in the U.S. the 4-cubic-foot capacity refrigerator basic model SMR04GAZCS, which includes models SMR04GAZACS and SMR04GAZBCS. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and GE. PDF icon GE Appliances: Order

  15. Traulsen: Order (2015-SE-42002) | Department of Energy

    Energy Savers [EERE]

    Order (2015-SE-42002) Traulsen: Order (2015-SE-42002) August 31, 2015 DOE ordered Traulsen - ITW Food Group LLC to pay a $52,600 civil penalty after finding Traulsen had manufactured and distributed in commerce in the U.S. at least 284 units of commercial refrigerator-freezer basic model RDT132DUT-HHS, a noncompliant product. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Traulsen. PDF icon Traulsen: Order (2015-SE-42002) More Documents &

  16. Victory: Order (2015-SE-42033) | Department of Energy

    Energy Savers [EERE]

    Order (2015-SE-42033) Victory: Order (2015-SE-42033) October 27, 2015 DOE ordered Victory Refrigeration to pay a $1,600 civil penalty after finding Victory had manufactured and distributed in commerce in the U.S. at least 8 units of commercial refrigerator-freezer basic model RFS-1D-S1-EW-PT-HD, a noncompliant product. The Order adopted a Compromise Agreement, which reflected settlement terms between DOE and Victory. PDF icon Victory: Order (2015-SE-42033) More Documents & Publications

  17. DOE Awards Small Business Task Order | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order DOE Awards Small Business Task Order December 17, 2015 - 2:00pm Addthis Media Contact Lynette Chafin, 513-246-0461, Lynette.Chafin@emcbc.doe.gov Cincinnati - The Department of Energy (DOE) today announced the award of a Time and Materials Task Order to Industrial Economics, Incorporated, located in Cambridge, MA. Industrial Economics, Incorporated is a Small Business. The Task Order will have a maximum value of $1.77 million over 3 years. Work performed under this Task Order will be

  18. DOE Awards Small Business Task Order | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order DOE Awards Small Business Task Order December 17, 2015 - 10:00am Addthis Media Contact Lynette Chafin, 513-246-0461, Lynette.Chafin@emcbc.doe.gov Cincinnati - The Department of Energy (DOE) today announced the award of a Firm-Fixed Unit Rate Task Order to Sage Energy Trading of Jenks, OK. Sage Energy Trading is a Woman Owned Small Business. The Task Order will have a maximum value of $3.5 million over 2 years. Work performed under this Task Order will be performed at the Portsmouth Gaseous

  19. Revision to DOE Order 435.1 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Management » Compliance » Revision to DOE Order 435.1 Revision to DOE Order 435.1 The Office of Environmental Management has primary responsibility, within DOE, for DOE Order 435.1, the self-regulation of radioactive waste management. As part of this responsibility, EM has decided to update the Order to incorporate several changes to the regulatory process that have taken place over the last decade as well as streamline the Order to improve management of the waste. A comprehensive

  20. Scale-invariant entropy-based theory for dynamic ordering

    SciTech Connect (OSTI)

    Mahulikar, Shripad P. E-mail: spm@aero.iitb.ac.in; Kumari, Priti

    2014-09-01

    Dynamically Ordered self-organized dissipative structure exists in various forms and at different scales. This investigation first introduces the concept of an isolated embedding system, which embeds an open system, e.g., dissipative structure and its mass and/or energy exchange with its surroundings. Thereafter, scale-invariant theoretical analysis is presented using thermodynamic principles for Order creation, existence, and destruction. The sustainability criterion for Order existence based on its structured mass and/or energy interactions with the surroundings is mathematically defined. This criterion forms the basis for the interrelationship of physical parameters during sustained existence of dynamic Order. It is shown that the sufficient condition for dynamic Order existence is approached if its sustainability criterion is met, i.e., its destruction path is blocked. This scale-invariant approach has the potential to unify the physical understanding of universal dynamic ordering based on entropy considerations.

  1. Compliance Order, Los Alamos National Security, LLC - July 12, 2007 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Compliance Order, Los Alamos National Security, LLC - July 12, 2007 Compliance Order, Los Alamos National Security, LLC - July 12, 2007 July 12, 2007 Issued to Los Alamos National Security, LLC related to the Unauthorized Reproduction and Removal of Classified Matter from the Los Alamos National Laboratory On July 12, 2007, the Secretary of Energy issued a Compliance Order to Los Alamos National Security, LLC requiring the contractor to implement specific corrective

  2. Consent Order, Bechtel National, Inc. | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National, Inc. Consent Order, Bechtel National, Inc. June 2015 Nuclear Safety Enforcement Consent Order issued to Bechtel National, Inc. regarding deficiencies in facility design and authorization basis documentation, vessel welds, and quality assurance and corrective action program implementation at the Waste Treatment and Immobilization Plant. On June 1, 2015, the U.S. Department of Energy's (DOE) Office of Enforcement issued a Consent Order (NCO-2015-02) to Bechtel National, Inc., the

  3. Consent Order, UT-Battelle, LLC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    UT-Battelle, LLC Consent Order, UT-Battelle, LLC May 2015 Nuclear Safety Enforcement Consent Order issued to UT-Battelle, LLC for deficiencies associated with an airborne radiation release and radiological uptake by workers at DOE's Oak Ridge National Laboratory. On May 14, 2015, the U.S. Department of Energy's (DOE) Office of Enforcement issued a Consent Order (NCO-2015-01) to UT-Battelle, LLC, for deficiencies associated with an airborne radiation release and radiological uptake by workers

  4. White House Announces New Executive Order To Reduce Greenhouse Gas

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Emissions in the Federal Government | Department of Energy White House Announces New Executive Order To Reduce Greenhouse Gas Emissions in the Federal Government White House Announces New Executive Order To Reduce Greenhouse Gas Emissions in the Federal Government March 19, 2015 - 2:45pm Addthis The White House today announced that President Obama issued a new executive order that will cut the federal government's greenhouse gas emissions 40% over the next decade (from 2008 levels) and

  5. Executive Order 13693 Training Now Available On Demand | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Executive Order 13693 Training Now Available On Demand Executive Order 13693 Training Now Available On Demand January 4, 2016 - 8:00am Addthis Executive Order (E.O.) 13693: Recent Developments, Implementation Updates, and Opportunities Training is now available on-demand. The seminar covers the major goals of E. O. 13693 and offers examples of technologies and concepts the U.S. Department of Energy and other federal agencies are using to meet these goals. Addthis Related Articles

  6. DOE Orders Mirant Power Plant to Operate Under Limited Circumstances |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Mirant Power Plant to Operate Under Limited Circumstances DOE Orders Mirant Power Plant to Operate Under Limited Circumstances December 20, 2005 - 11:44am Addthis DOE finds emergency; determines plant will help electric reliability WASHINGTON, D.C. - Secretary of Energy Samuel W. Bodman today issued an order requiring Mirant Corporation's Potomac River Generating Station in Alexandria, Virginia (Mirant) to immediately resume limited operation. The order will help provide

  7. Executive Orders Defining Tribal Relationships | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Executive Orders Defining Tribal Relationships Executive Orders Defining Tribal Relationships Executive Order 13592 Improving American Indian and Alaska Native Educational Opportunities and Strengthening Tribal Colleges and Universities (2011). Superseded EO 13021 to ensure that all American Indian students, regardless of which institution they attend, receive support from the federal government at elementary through college levels. This EO also creates an Interagency Working Group on AI/AN

  8. OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental,

    Energy Savers [EERE]

    Energy and Economic Performance | Department of Energy OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy and Economic Performance OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy and Economic Performance PDF icon OVERVIEW OF EXECUTIVE ORDER 13XXX Federal Leadership in Environmental, Energy and Economic Performance More Documents & Publications Microsoft PowerPoint - 08 Lawrence 2010 DOE PM Workshop_EO 13514_03-01-10_presentation

  9. American Indian Policy and Relevant DOE and Executive Orders | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Tribal Programs » American Indian Policy and Relevant DOE and Executive Orders American Indian Policy and Relevant DOE and Executive Orders Over the course of American history, the Federal government's relationship with Indian Tribes has been defined and modified by treaties, executive orders, court decisions, specific legislation passed by Congress, and regulations. Important rights were guaranteed to Tribes by treaty, with many of these rights still enforceable today. Case law,

  10. Investigation of odd-order nonlinear susceptibilities in atomic vapors

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: Investigation of odd-order nonlinear susceptibilities in atomic vapors Citation Details In-Document Search Title: Investigation of odd-order nonlinear susceptibilities in atomic vapors We theoretically deduce the macroscopic symmetry constraints for arbitrary odd-order nonlinear susceptibilities in homogeneous media including atomic vapors for the first time. After theoretically calculating the expressions

  11. Implementation of Executive Order 13514, Federal Leadership in

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Environmental, Energy, and Economic Performance | Department of Energy Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance Implementation of Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance PDF icon 2010.03.31 Secretary Memo - Scope 1 GHG reduction goal.pdf More Documents & Publications Sustainable Acquisition, Federal and Department of Energy Acquisition Regulation Amendments OVERVIEW OF EXECUTIVE ORDER

  12. Executive Order 13693-Planning for Federal Sustainability in the Next

    Energy Savers [EERE]

    Decade | Department of Energy 93-Planning for Federal Sustainability in the Next Decade Executive Order 13693-Planning for Federal Sustainability in the Next Decade PDF icon Executive Order 13693-Planning for Federal Sustainability in the Next Decade More Documents & Publications EO 13690: Establishing a Federal Flood Risk Management Standard and a Process for Further Soliciting and Considering Stakeholder Input (2015) Executive Order 13423: Strengthening Federal Environmental, Energy,

  13. Guidance on Meeting Executive Order 13693 Water Provisions | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Water Efficiency » Guidance on Meeting Executive Order 13693 Water Provisions Guidance on Meeting Executive Order 13693 Water Provisions Executive Order (E.O.) 13693 became effective on October 1, 2015, and includes following five main water-related provisions. Potable Water Consumption Intensity Reduction: Reduce agency potable water consumption intensity measured in gallons per gross square foot by 36% by fiscal year (FY) 2025 through reductions of 2% annually through FY 2025

  14. Hanford Waste Treatment Plant Support Task Order Modified | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Hanford Waste Treatment Plant Support Task Order Modified Hanford Waste Treatment Plant Support Task Order Modified March 11, 2013 - 12:00pm Addthis Media Contact Lynette Chafin, 513-246-0461 Lynette.Chafin@emcbc.doe.gov Cincinnati - The Department of Energy (DOE) today awarded a modification to a task order to Aspen Resources Limited, Inc. of Boulder, Colorado for support of the Waste Treatment and Immobilization Plant (WTP) at the Hanford Site. The modification increased the value

  15. Midea America: Order (2014-SEW-20006) | Department of Energy

    Energy Savers [EERE]

    MidAtlantic_Corridor_Map091707.pdf MidAtlantic_Corridor_Map091707.pdf PDF icon MidAtlantic_Corridor_Map091707.pdf More Documents & Publications DOE Designates Southwest Area and Mid-Atlantic Area National Interest Electric Transmission Corridors October 2, 2007 FACT SHEET: Designation of National Interest Electric Transmission Corridors,As Authorized by the Energy Policy Act of 2005

    Midea America: Order (2014-SEW-20006) Midea America: Order (2014-SEW-20006) March 19, 2015 DOE ordered

  16. Energy Department Awards First Major Task Order Under Streamlined

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contracting System | Department of Energy First Major Task Order Under Streamlined Contracting System Energy Department Awards First Major Task Order Under Streamlined Contracting System October 17, 2005 - 11:59am Addthis New Mexico Firm Contracted for Ashtabula Clean-up WASHINGTON, DC - The Department of Energy (DOE) has awarded a Task Order for an estimated $19.4 million to LATA-SHARP Remediation Services, LLC for the completion of clean-up activities at the Ashtabula Closure Project (ACP)

  17. Surface Remeshing with Robust High-Order Reconstruction (Journal Article) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Surface Remeshing with Robust High-Order Reconstruction Citation Details In-Document Search Title: Surface Remeshing with Robust High-Order Reconstruction Remeshing is an important problem in variety of applications, such as finite element methods and geometry processing. Surface remeshing poses some unique challenges, as it must deliver not only good mesh quality but also good geometric accuracy. For applications such as finite elements with high-order elements (quadratic or

  18. LFRG DOE Order 435.1 | Department of Energy

    Energy Savers [EERE]

    LFRG DOE Order 435.1 LFRG DOE Order 435.1 Chapter 4 of the DOE Manual on Order 435.1, Low-level Waste Requirements, addresses the procedures whereby Department of Energy LLW Disposal Facilities will operated and maintained. Section P and Section Q describe the Performance Assessment and Composite Analysis documents that each DOE disposal facility will submit to the LFRG. To view the entire DOE Order, Manual, and Implementation Guidance documents, choose the link below to get to the main DOE

  19. Executive Order 12088: Federal Compliance with Pollution Control...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2088: Federal Compliance with Pollution Control Standards Executive Order 12088: Federal Compliance with Pollution Control Standards The head of each Executive agency is ...

  20. Executive Order 13547: Stewardship of the Ocean, Our Coasts,...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to climate change and ocean acidification, and coordinate with our national security and foreign policy interests. Download Document PDF icon Executive Order 13547: Stewardship of...

  1. Executive Order 13045, Protection of Children from Environmental...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protection of Children from Environmental Health Risks and Safety Risks Executive Order 13045, Protection of Children from Environmental Health Risks and Safety Risks Each Federal ...

  2. O:ELECTRICDETROITPP-230-1_Order.PDF

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PRESIDENTIAL PERMIT AMENDMENT INTERNATIONAL TRANSMISSION COMPANY ORDER NO. PP-230-1 I. BACKGROUND On September 26, 2000, the Office of Fossil Energy of the Department of Energy ...

  3. Updated Report on Executive Order 13,392 Implementation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Report on Executive Order 13,392 Implementation by the Department of Energy The President issued Executive Order 13,392, entitled "Improving Agency Disclosure of Information," on December 14,2005. The Executive Order established an approach to administration of the Freedom of Information Act that was "citizen-centered" and "results-oriented.'' The Executive Order also required each agency to conduct a review of its FOIA operations, to develop an agency-specific plan to

  4. FEMP First Thursday Seminar Covers Executive Order 13693 Updates |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Executive Order 13693 Updates FEMP First Thursday Seminar Covers Executive Order 13693 Updates November 6, 2015 - 5:14pm Addthis FEMP First Thursday Seminar Covers Executive Order 13693 Updates The U.S. Department of Energy Federal Energy Management Program (FEMP) will present a new First Thursday Seminar on December 3, 2015, from 1:30 p.m. to 3 p.m. Executive Order 13693: Recent Developments, Implementation Updates, and Opportunities. This seminar will provide learners

  5. Department of Energy Technical Standards Program - Order DOE...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and activities under Executive Order 12344 and Public ... This Act applies only to those DOE functions that originated ... similar requirements and test methods, unless such ...

  6. Implementation of Executive Order 13514, Federal Leadership in...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    in Environmental, Energy, and Economic Performance Implementation of Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance PDF icon ...

  7. Task Order Price Evaluation Worksheet for SUPER ESPC

    Broader source: Energy.gov [DOE]

    Document provides a worksheet for evaluating price for a task order as part of a Super Energy Savings Performance Contract (ESPC).

  8. A consistent second order projection scheme for simulating transient...

    Office of Scientific and Technical Information (OSTI)

    A consistent second order projection scheme for simulating transient viscous flow with Smoothed Particle Hydrodynamics. Citation Details In-Document Search Title: A consistent...

  9. Self-consistent second-order Green's function perturbation theory...

    Office of Scientific and Technical Information (OSTI)

    Self-consistent second-order Green's function perturbation theory for periodic systems ... Sponsoring Org: USDOE Country of Publication: United States Language: English Word Cloud ...

  10. Task Order Awarded for Audit and Review Services

    Broader source: Energy.gov [DOE]

    Cincinnati - The Department of Energy today awarded a Task Order to KPMG, LLP of McLean, VA for audit/review services that will cover a wide range of auditing services. These services will include: pricing proposals, requests for equitable adjustment, change order proposals, business systems (accounting, purchasing and billing systems), forward pricing rates, incurred costs audits, and terminations. Individual subtask orders will be placed for each specific assignment as needed from October 1, 2012 through September 30, 2013. The total not-toexceed value of the task order is $2,993,733.00.

  11. DOE Awards Research and Systems Engineering Task Order | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Research and Systems Engineering Task Order DOE Awards Research and Systems Engineering Task Order April 28, 2016 - 2:00pm Addthis Media Contact: Lynette Chafin (513) 246-0461 Lynette.Chafin@emcbc.doe.gov Cincinnati - The U.S. Department of Energy (DOE) today awarded a task order to the MITRE Corporation, of McLean Virginia. MITRE will provide research and development in support of DOE's Office of Environmental Management. The task order has an approximate value of $1.176 million,

  12. Public Utilities Commission General Order NO. 131-D | Open Energy...

    Open Energy Info (EERE)

    Public Utilities Commission General Order NO. 131-D Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: Public Utilities...

  13. Sunshine Lighting: Order (2014-SE-54008) | Department of Energy

    Energy Savers [EERE]

    Sunshine Lighting: Order (2014-SE-54008) Sunshine Lighting: Order (2014-SE-54008) July 7, 2015 DOE ordered Lighting & Supplies, Inc. d/b/a Sunshine Lighting Company ("Sunshine") to pay a $150,000 civil penalty after finding Sunshine had manufactured and distributed in commerce in the U.S. 1780 units of Sunlite brand basic model 04937-SU and 1134 units of basic model 04952-SU, noncompliant metal halide lamp fixtures. The Order adopted a Compromise Agreement, which reflected

  14. DOE - NNSA/NFO -- Test Film Order Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Home > Library > Forms > Historical Test Film Order Form U.S. DOE/NNSA - Nevada Field Office Historical Test Film Order Form The Historical Nuclear Weapons Test films which have been declassified can be ordered from the Nuclear Testing Archive for a fee per video, plus shipping and handling. The form is used only to request a film(s). A representative will contact you regarding your order and payment options. Please call 702-794-5117 or 702-794-5106. You can contact us by email to

  15. Special Report Order, Sandia Corporation - October 20, 2010 ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sandia Corporation - October 20, 2010 Special Report Order, Sandia Corporation - October 20, 2010 October 20, 2010 Issued to Sandia Corporation related to Nuclear Safety Quality ...

  16. FERC Order No. 2003 Appendix 5 - Optional Interconnection Study...

    Open Energy Info (EERE)

    5 - Optional Interconnection Study Agreement Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: FERC Order No. 2003 Appendix 5 - Optional Interconnection...

  17. Executive Order 13031-Federal Alternative Fueled Vehicle Leadership...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Executive Order 12969-Federal Acquisition and Community RightTo-Know EO 13089 -- Coral Reef Protection NATIONAL DEFENSE AUTHORIZATION ACT FOR FISCAL ...

  18. Executive Order 13158-Marine Protected Areas | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Executive Order 13158-Marine Protected Areas More Documents & Publications EO 13089 -- Coral Reef Protection ARPA-E Technical Support Memo Appendices Microsoft Word - ...

  19. BPA seeks clarification and rehearing on FERC order on Environmental...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and rehearing of the Federal Energy Regulatory Commission's order on BPA's Interim Environmental Redispatch policy. "While BPA is meeting a regulatory deadline to respond to...

  20. Executive Order 13212: 66 FR 28357 (22 May 2001)

    Energy Savers [EERE]

    Executive Order 13212: 66 FR 28357 (22 May 2001) Executive Order 13212--Actions To Expedite Energy-Related Projects May 18, 2001 By the authority vested in me as President by the Constitution and the laws of the United States of America, and in order to take additional steps to expedite the increased supply and availability of energy to our Nation, it is hereby ordered as follows: Section 1. Policy. The increased production and transmission of energy in a safe and environmentally sound manner is

  1. Executive Order 13148-Greening the Government Through Leadership...

    Energy Savers [EERE]

    and long-term planning processes, across all agency missions, activities, and functions. PDF icon Executive Order 13148-Greening the Government Through Leadership in...

  2. Contrasting behavior of intermediate-range order structures in...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Contrasting behavior of intermediate-range order structures in jadeite glass and melt Citation Details In-Document Search Title: Contrasting behavior of ...

  3. Briefing, DOE Order 475.2B, Identifying Classified Information...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    What Derivative Classifiers Should Know Briefing, DOE Order 475.2B, Identifying Classified Information, What Derivative Classifiers Should Know October 14, 2014 This briefing ...

  4. Comments on Emergency Order to Resume Limited Operation at the...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operation at the Potomac River Generating Station, Alexandria, VA from the Chesapeake Climate Action Network. Comments on Emergency Order to Resume Limited Operation at the ...

  5. DOE Sustainability Support Information Brief on Executive Order...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Sustainability Support Information Brief on Executive Order 12898, Federal Actions to Address Environmental Justice in Minority and Low-Income Populations DOE Sustainability ...

  6. Draft Revised Guidelines for Implementing Executive Order 11988, "Floodplain Management"

    Broader source: Energy.gov [DOE]

    The Federal Emergency Management Agency published the draft Revised Guidelines for Implementing Executive Order 11988, Floodplain Management for public review and comment on January 30, 2015.

  7. Executive Order 13186: Responsibilities of Federal Agencies To...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Order 13186: Responsibilities of Federal Agencies To Protect Migratory Birds Migratory bird conventions impose substantive obligations on the United States for the conservation of...

  8. Energy Department Awards First Major Task Order Under Streamlined...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Department Awards First Major Task Order Under Streamlined Contracting System October 17, 2005 - 11:59am Addthis New Mexico Firm Contracted for Ashtabula Clean-up ...

  9. Observation of Ordered Structures in Counterion Layers near Wet...

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Search Results Journal Article: Observation of Ordered Structures in Counterion Layers near Wet Charged Surfaces: A Potential Mechanism for Charge Inversion ...

  10. Exploring Mesoscopic Physics of Vacancy-Ordered Systems through...

    Office of Scientific and Technical Information (OSTI)

    Physics of Vacancy-Ordered Systems through Atomic Scale Observations of Topological Defects Citation Details In-Document Search Title: Exploring Mesoscopic Physics of ...

  11. True: Order (2015-CE-42049) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE ordered True Manufacturing Co., Inc., to pay a 36,400 civil penalty after finding ... Federal law subjects manufacturers and private labelers to civil penalties if those ...

  12. Prediction of ordered arrays of nanoparticle superlattices by...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prediction of ordered arrays of nanoparticle superlattices by self-assembly Engineering the interfaces that will solve the technological challenges of this century requires an...

  13. United States Department of the Interior - Directors Order 53...

    Open Energy Info (EERE)

    Regulatory GuidanceGuideHandbook Abstract This Director's Order sets forth the policies and procedures for administering special park uses on NPS lands. Author USDOI...

  14. FERC Order No. 792 - Interconnection Request | Open Energy Information

    Open Energy Info (EERE)

    792 - Interconnection RequestLegal Abstract FERC Order No. 792, Attachment 2, Small Generator Interconnection Request Form, current through June 3, 2014. Published NA Year...

  15. Consent Order 2005-01 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Consent Order, Bechtel Hanford, Inc - EA-2005-01 Preliminary Notice of Violation, Bechtel Hanford, Inc., - EA-2002-04 Preliminary Notice of Violation, Fluor Hanford, Incorporated - ...

  16. 3-dimensional control over lamella orientation and order in thick...

    Office of Scientific and Technical Information (OSTI)

    3-dimensional control over lamella orientation and order in thick block copolymer films Citation Details In-Document Search Title: 3-dimensional control over lamella ...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  18. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  19. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  20. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...