Powered by Deep Web Technologies
Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

LG: Order (2015-CE-14022)  

Broader source: Energy.gov [DOE]

DOE ordered LG Electronics USA, Inc. to pay a $8,000 civil penalty after finding LG had failed to certify that various refrigerator-freezer basic models comply with the applicable energy conservation standards.

2

L:LCB:lg  

Office of Legacy Management (LM)

L:LCB:lg L:LCB:lg '. ,. ), .; ..:.;; ~ .,. Fhazmon sAmi.now uatsri.als co. 7356 sanca !.tonioa Boulevard Eollymod 46, Calif. Attr Mr. J. 2. Alburger CslItlI%LOIll - Ootober, 9, l&2 ,:;.. ~. Tk have your letter dabed Ootobor~B, 1962 &ah is euffioient to give w a better plotwe of the we wblch you propose to make ofuraniumoorrpovndE inluud.now'paintpignonts. We are attaahing licanse number C-2663 uhi&.permits you to purchase three pounds ofuraniumoompounda for demlop3mt mrk. 1% want ybu to understand in admum, hovemar, that we till bc reluctant to JESUS additional liconm3e for production of lumin- ow paints exceptforpignenta to be wed ex~lwiwly inprodu~ta having ntilitaqy or olearly defined industrial &ility. znclosurea Lioewe Eoo, C-2863

3

LG: Order (2014-SE-15011)  

Broader source: Energy.gov [DOE]

DOE ordered LG Electronics USA, Inc. to pay a $1,479,860 civil penalty after finding LG had manufactured and distributed in commerce in the U.S. at least 7,438 units of basic model LT143CNR, a noncompliant room air conditioner.

4

Changing Demographics in Latvia by Changing Ethnic Law  

E-Print Network [OSTI]

This thesis examines language and citizenship laws in Latvia to determine how they have been used to change Latvia's internal ethnic identity and external geopolitical relations. A discourse analysis of two of the region's major news sources...

Cooper, Zachary L.

2008-08-04T23:59:59.000Z

5

LG Siltron | Open Energy Information  

Open Energy Info (EERE)

LG Siltron LG Siltron Jump to: navigation, search Name LG Siltron Place Seoul, Korea (Republic) Sector Services, Solar Product Developer and manufacturer of silicon wafers for the semiconductor industry; services the solar sector. Coordinates 37.557121°, 126.977379° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.557121,"lon":126.977379,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

6

Latvia: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Latvia: Energy Resources Latvia: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":57,"lon":25,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

7

LG Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff LG  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Electronics v. DOE - Defendants' Brief in Opposition to Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff LG Electronics' Motion for a Preliminary Injunction LG Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff LG Electronics' Motion for a Preliminary Injunction December 23, 2009 DOE filed a brief in opposition to LG Electronic's motion for preliminary injunction. Issuance of an injunction would prevent DOE from revoking an exception to a 2008 agreement whereby LG could temporarily continue to test certain fill tubes and ice ejection heaters for ENERGY STAR compliance while they are in the "off" rather than the "on" position. On January 18, 2010, the U.S. District Court for the District of Columbia issued its decision in Civil Action No. 09-2297, denying LG's

8

LG: Noncompliance Determination (2014-SE-15011) | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

July 30, 2014 DOE issued a Notice of Noncompliance Determination to LG Electronics USA, Inc. finding that room air conditioner basic model LT143CNR does not comport with the...

9

GV1 Solar Power Plant | Open Energy Information  

Open Energy Info (EERE)

GV1 Solar Power Plant GV1 Solar Power Plant Jump to: navigation, search Name GV1 Solar Power Plant Facility GV1 Sector Solar Facility Type Concentrating Solar Power Developer Greenvolts Location Tracy, California Coordinates 37.7396513°, -121.4252227° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.7396513,"lon":-121.4252227,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

10

SUSTAINABILITY POLICY University Policy No: GV0800 (1794) Classification: Governance  

E-Print Network [OSTI]

SUSTAINABILITY POLICY University Policy No: GV0800 (1794) Classification: Governance Approving resources in a responsible manner, and work towards a sustainable future in cooperation with organizations to assist the University Community in incorporating Sustainability into decision making and provides

Victoria, University of

11

LG Dismisses Lawsuit against DOE over Energy Star Enforcement | Department  

Broader source: Energy.gov (indexed) [DOE]

LG Dismisses Lawsuit against DOE over Energy Star Enforcement LG Dismisses Lawsuit against DOE over Energy Star Enforcement LG Dismisses Lawsuit against DOE over Energy Star Enforcement May 28, 2010 - 2:32pm Addthis DOE announced today that LG Electronics voluntarily dismissed its lawsuit against DOE over the Department's decision to require LG to use the same energy efficiency tests as other manufacturers and to withdraw the Energy Star label from certain LG refrigerators. The Department's decision also had the effect of requiring LG to cease distributing those refrigerators in commerce no later than March 17, 2010. LG had sought a preliminary injunction against DOE's action last December but lost. LG then proceeded to remove the Energy Star label from the affected products and ceased distributing them in commerce by the March deadline. Nevertheless, the

12

LG Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff...  

Broader source: Energy.gov (indexed) [DOE]

As a result, LG was required to remove the ENERGY STAR label from certain models of refrigerator-freezers. Memorandum Opinion Document Available for Download LG Electronics v. DOE...

13

EUDEEP (Smart Grid Project) (Latvia) | Open Energy Information  

Open Energy Info (EERE)

Latvia) Latvia) Jump to: navigation, search Project Name EUDEEP Country Latvia Coordinates 56.879635°, 24.603189° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":56.879635,"lon":24.603189,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

14

DOE Reaches Agreement with LG Electronics, USA, On Refrigerator Energy  

Broader source: Energy.gov (indexed) [DOE]

Reaches Agreement with LG Electronics, USA, On Refrigerator Reaches Agreement with LG Electronics, USA, On Refrigerator Energy Matter DOE Reaches Agreement with LG Electronics, USA, On Refrigerator Energy Matter November 14, 2008 - 4:47pm Addthis ENERGY STAR® Program Continues to Help American Consumers Make Energy Efficient Choices WASHINGTON - The U.S. Department of Energy (DOE) today announced an agreement with LG Electronics, USA, Inc. (LG), resolving concerns related to energy usage measurements reported on LG French Door refrigerators with through-the-door ice and water service. The ENERGY STAR® program helps American consumers make energy efficient choices, saving billions of dollars while protecting the environment by using identified energy efficient products and practices. "DOE believes that the actions LG plans to take will benefit consumers and

15

SUBJECT: MEMORANDUM DAu&!Lg)_)~Q-----__  

Office of Legacy Management (LM)

SUBJECT: SUBJECT: MEMORANDUM DAu&!Lg)_)~Q-----__ :::I: R~&a~.a cp"pwy ALTERNATE . -- --- ------------------ NAME : ---------------------- CITY: e.&mrd --B---s-------- STATE: -&+- -------------------------- date contacted ------------- TYPE OF OPERATION ----------------- 0 Research b Devrlopment q Facility Type 0 Production scale testing 8 Pilot Scale Bench Seal e Process 0 Theoretical Studies 0 Sample & Analysis @ Manuf l cturing 0 University IJ Research Organization 0 Government Sponsored Facility 0 Other --------------------- 0 Production Cl Disposal /Storage TY?Z OF CONTRACT ---------------- 0 Prime 0 Subcontract& 7 Purchase Order 0 Other information (i.e., cost + fixed fee, unit price, time & material, ate) ----e-w

16

Deputy Secretary of Energy Meets with President of Latvia | Department of  

Broader source: Energy.gov (indexed) [DOE]

of Energy Meets with President of Latvia of Energy Meets with President of Latvia Deputy Secretary of Energy Meets with President of Latvia April 4, 2011 - 6:07pm Addthis Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs On Friday, Deputy Secretary of Energy Daniel Poneman met with President Zatlers of Latvia, and the two discussed a range of energy issues; including energy security and the need for diversified resources, development opportunities in the liquid natural gas and shale gas markets, and the need to create an integrated Baltic energy market. Deputy

17

LG Chem, Argonne sign licensing deal to make, commercialize advanced...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

LG Chem, Argonne sign licensing deal to make, commercialize advanced battery material By Angela Hardin * January 6, 2011 Tweet EmailPrint Patented cathode technology will help...

18

LG: Proposed Penalty (2014-SE-15011) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Penalty that LG Electronics USA, Inc. manufactured and distributed noncompliant room air conditioner basic model LT143CNR in the U.S. Federal law subjects manufacturers and...

19

LgCOOleS, Se*&,,  

Office of Legacy Management (LM)

; "Ofice Mem ; "Ofice Mem . m *" ' ' *IilCl:t Consists of & " ' / Of LgCOOleS, Se*&,, es * UNITED STATES G-OVERNM NT <;$)~~ 3i;t-j /Lj ' , ~~~' jCjC;O c) TO I LT. :s. Clnr!te, ,;or,~~~,~' , -.,,..:-:-Y"' r~-;i~.L.-Z.:r DATE: uL"C!.,?r 6, 1' ?L9 A meting mj: !1:1d in i:1CG bet,. _ ^ .- ',cel representatives 51 ;.2rshz:i sr.3 the A;.35 to nwotiztc .the prices for producing FY-1: (brow oxise), _1 I%-; (green salt and .?T-12 (he::.-iZluoriic) fcr the sc2or.d 3,uarter of fisc21 1950, (Cctober, Z:ove-r.ber, 2c?Ce.:lxr l?L?). Th-: foll;:~:i;.E xttcndcd the mztin:: "-Tsh-:, -.,q ..__ _id.l - 1;. 2. 9till;Iell

20

Attenuation of multiphase surface waves in the Basin and Range province, part I: Lg and Lg coda  

Science Journals Connector (OSTI)

......regional phases Pg and Lg at the Nevada Test Site, J. geophys. Res., 86...1987. A study of P waves from Nevada Test Site explosions: near source informations...1986. Yield estimates of Nevada test site explosions obtained from seismic......

J. Xie; B. J. Mitchell

1990-07-01T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

An Energy Overview of the Republic of Latvia  

SciTech Connect (OSTI)

The DOE Office of Fossil Energy is maintaining a web site that is meant to provide useful business- and energy-related information about countries and regions of the world for exporters, project developers, and researchers. The site consists of more than 130 country pages (organized into seven different world regions), with each country page having its own set of links to information sources about that country. There are also more than 30 Country Energy Overviews at the web site -- each of these is a comprehensive review of a specific country's entire energy situation, including sections on Energy Policy, Oil, Natural Gas, Coal, Hydroelectric/Renewables, Nuclear Power, Energy Transmission Infrastructure, Electricity, Electric Industry Overview, Environmental Activities, Privatization, Trade, and Economic Situation. The specific country highlighted in this Country Energy Overview is Latvia. The site is designed to be dynamic. Updates to the overviews will be made as need and resources permit.

anon.

2003-10-20T23:59:59.000Z

22

Advocacy Coalitions in East European Sex Tourism: The Case of Latvia  

E-Print Network [OSTI]

The widening of the European Union and the emergence of budget airlines have brought with them a host of challenges to new member states like Latvia. A result of the economic polarization and its disproportionate effect ...

Dean, Laura A.

2011-12-31T23:59:59.000Z

23

SCH-MGMT 597LG Humanitarian Logistics Spring 2012  

E-Print Network [OSTI]

SCH-MGMT 597LG ­ Humanitarian Logistics and Healthcare Spring 2012 Class Time: Tuesdays of people affected by them. Logistics plays a central role in all phases of disaster management and supporting humanitarian operations. The fundamental task of a logistics system is to deliver the appropriate

Nagurney, Anna

24

SCH-MGMT 597LG Humanitarian Logistics Spring 2014  

E-Print Network [OSTI]

SCH-MGMT 597LG ­ Humanitarian Logistics and Healthcare Spring 2014 Class Time: Tuesdays of people affected by them. Logistics plays a central role in all phases of disaster management and supporting humanitarian operations. The fundamental task of a logistics system is to deliver the appropriate

Nagurney, Anna

25

TEE-0025 - In the Matter of LG Electronics, Inc. | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

5 - In the Matter of LG Electronics, Inc. 5 - In the Matter of LG Electronics, Inc. TEE-0025 - In the Matter of LG Electronics, Inc. This Decision and Order considers an Application for Exception filed by LG Electronics, Inc. (LG) seeking exception relief from the provisions of 10 C.F.R. Part 430, Energy Conservation Program for Consumer Products: Energy Conservation Standards for Refrigerators, Refrigerator-Freezers and Freezers (Refrigerator Efficiency Standards). In its exception request, LG asserts that the firm would suffer a gross inequity if required to adhere to the Refrigerator Efficiency Standards, codified at 10 C.F.R. § 430.32. If LG's Application for Exception were granted, LG would receive exception relief from the energy efficiency standard applicable to a new automatic defrost refrigerator-freezer, with bottom mounted freezer and

26

LG Solid Oxide Fuel Cell (SOFC) Model Development  

SciTech Connect (OSTI)

This report presents a summary of the work performed by LG Fuel Cell Systems Inc. during the project LG Solid Oxide Fuel Cell (SOFC) Model Development (DOE Award Number: DE-FE0000773) which commenced on October 1, 2009 and was completed on March 31, 2013. The aim of this project is for LG Fuel Cell Systems Inc. (formerly known as Rolls-Royce Fuel Cell Systems (US) Inc.) (?LGFCS?) to develop a multi-physics solid oxide fuel cell (SOFC) computer code (MPC) for performance calculations of the LGFCS fuel cell structure to support fuel cell product design and development. A summary of the initial stages of the project is provided which describes the MPC requirements that were developed and the selection of a candidate code, STAR-CCM+ (CD-adapco). This is followed by a detailed description of the subsequent work program including code enhancement and model verification and validation activities. Details of the code enhancements that were implemented to facilitate MPC SOFC simulations are provided along with a description of the models that were built using the MPC and validated against experimental data. The modeling work described in this report represents a level of calculation detail that has not been previously available within LGFCS.

Haberman, Ben; Martinez-Baca, Carlos; Rush, Greg

2013-03-31T23:59:59.000Z

27

Capturing Video Using the SONY GV-HD700 Cassette Deck In the AV Production Room (Room 261), Mann Library has a SONY GV-HD700 Digital HD Video  

E-Print Network [OSTI]

Capturing Video Using the SONY GV-HD700 Cassette Deck In the AV Production Room (Room 261), Mann Library has a SONY GV-HD700 Digital HD Video Cassette Deck. It is attached to the left side Mac Pro Creation Station, and can be used to "capture", or convert video from miniDV tapes to digital files. 1

Angenent, Lars T.

28

LG Electronics U.S.A. v. DOE, Stipulation of Voluntary Dismissal |  

Broader source: Energy.gov (indexed) [DOE]

LG Electronics U.S.A. v. DOE, Stipulation of Voluntary Dismissal LG Electronics U.S.A. v. DOE, Stipulation of Voluntary Dismissal LG Electronics U.S.A. v. DOE, Stipulation of Voluntary Dismissal May 28, 2010 LG Electronics U.S.A., Inc. v. U.S. Dept. of Energy and Steven Chu, Civil Action Number 1:09-cv-02297-JDB, Stipulation of Voluntary Dismissal. LG here voluntarily dismisses its claims against the DOE and Secretary Chu. Parties agree that DOE believes its interpretation of the November 14, 2008 Settlement Agreement is correct, but that LG interpreted the agreement fairly and in good faith. To DOE's knowledge, LG is fulfilling the obligations of that Agreeement, as well as the November 10, 2009 order. DOE's December 18, 2009 Guidance is the first industry-wide clarification for energy efficiency testing procedures for the fill tube and ice ejection

29

LG to DOE General Counsel; Re:Request for Comment on Large Capacity...  

Energy Savers [EERE]

Clothes Washers LG response to DOE's request for information regarding alternative test procedures for large-capacity clothes washer models, December 7, 2010. After DOE...

30

LG to DOE General Counsel; Re:Request for Comment on Large Capacity Clothes  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

to DOE General Counsel; Re:Request for Comment on Large Capacity to DOE General Counsel; Re:Request for Comment on Large Capacity Clothes Washers LG to DOE General Counsel; Re:Request for Comment on Large Capacity Clothes Washers LG response to DOE's request for information regarding alternative test procedures for large-capacity clothes washer models, December 7, 2010. After DOE requested the views of interested parties concerning implementation of an alternative test procedure for large-capacity clothes washer models, i.e., those in excess of 3.8 cu ft, LG Vice President of Government Relations and Communications, John I. Taylor, submits this letter outlining LG's views on the set of "unique circumstances." LG response to DOE's request for information regarding alternative test procedures for large-capacity clothes washer models, December 7, 2010.

31

U.S. District Court Upholds DOE's Action Against LG to Enforce ENERGY STAR  

Broader source: Energy.gov (indexed) [DOE]

District Court Upholds DOE's Action Against LG to Enforce District Court Upholds DOE's Action Against LG to Enforce ENERGY STAR Requirements U.S. District Court Upholds DOE's Action Against LG to Enforce ENERGY STAR Requirements January 19, 2010 - 12:00am Addthis Washington, D.C. - On Monday, the United States District Court for the District of Columbia upheld the Department of Energy's decision to remove the ENERGY STAR® label from certain inefficient LG refrigerator-freezer models. As part of its expanded energy efficient enforcement efforts, DOE had taken steps over the past few months to remove the label from these products, which independent testing had shown were consuming significantly more energy than allowed by the ENERGY STAR® program. "The Court has affirmed our efforts to protect consumers and the

32

Microsoft Word - LG response to DOE letter to clothes washer waivers  

Broader source: Energy.gov (indexed) [DOE]

LG ELECTRONICS LG ELECTRONICS 1776 K Street NW Washington, DC 20006 By email: GC_comments@hq.doe.gov December 7, 2010 Scott Blake Harris, Esq. General Counsel United States Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 Re: Alternative test procedure for large-capacity clothes washer models Dear Mr. Harris, Thank you for seeking the views of interested parties concerning implementation of an alternative test procedure for large-capacity clothes washer models, i.e., those in excess of 3.8 cu ft. You appropriately state that the situation you have described presents a set of "unique circumstances." LG Electronics' suggestions herein are crafted in light of these unique circumstances. As discussed herein, LG Electronics believes that there is a relatively simple and

33

DOE Defends Decision to Revoke Energy Star Designation for Certain LG Refrigerators  

Broader source: Energy.gov [DOE]

On December 23, 2009, the Government filed itsbriefin opposition to LG Electronics' motion for a preliminary injunction in the U.S. District Court for the District of Columbia.

34

If*|lg1JEDIlls ,,ft-o-aS.2  

E-Print Network [OSTI]

»-H a3UW ·3USi «c« «"22"5"35» If*|lg1JEDIlls pV) 232 *2*& yuo = OW O5oc ,,ft-o-aS.2 F.O-a-- o :§>£ £1 2 (genetic code) Eukaryotes Sexual populations Animals, plants, fungi (cell differentiation) Colonies (non

35

Final Report on IMLS Funded Grant #LG02020026-02: December 2006  

E-Print Network [OSTI]

? What do you like least about using a computer? On an average school day, how much time do you spend using a computer? How much time do you spend on a computer on a day when you are not in school? FinalFinal Report on IMLS Funded Grant #LG02020026-02: APPENDICES December 2006 Allison Druin, PI Ann

Golbeck, Jennifer

36

Numerical simulation of high- and low-frequency Lg-wave propagation  

Science Journals Connector (OSTI)

......with a central frequency of 1Hz was convolved...computed impulse response, and each trace...of computer storage, the separation...problem of computer storage is worse at high frequencies, only very low...is Lg-wave energy that propagates......

Richard L. Gibson; Jr; Michel Campillo

1994-07-01T23:59:59.000Z

37

LG MODELS AS SYMPLECTIC LEFSCHETZ FIBRATIONS ON ADJOINT ORBITS ELIZABETH GASPARIM, LINO GRAMA, AND LUIZ A. B. SAN MARTIN  

E-Print Network [OSTI]

with the structure of a Symplectic Lefschetz Fibrations (SLF). These are particularly manageable examples of LG models because for an SLF the superpoten- tial has only of nondegenerate critical points. 1.1. Our first

Gasparim, Elizabeth

38

MA5Q6 Graduate Algebra Assignment 7  

E-Print Network [OSTI]

such that Lg(u v) = (gu) (gv) for all (u, v) U ? V. (b) Prove Lgh = Lg Lh for all g, h G. Deduce that W

Krammer, Daan

39

Purification of fire derived markers for lg scale isotope analysis C) using high performance liquid chromatography (HPLC)  

E-Print Network [OSTI]

Purification of fire derived markers for lg scale isotope analysis (d13 C, D14 C) using high successfully analyzed the 14 C content of individual benzene polycarboxy- lic acids with a sample size as small the expansion of isotopic BC studies to samples that have either been too small or strongly affected by non

Gilli, Adrian

40

Application of sPC-SAFT-JC and sPC-SAFT-GV to Phase Equilibria Predictions of Alkane/Alcohol, Alcohol/Alcohol, and Water/Alcohol Binary Systems  

Science Journals Connector (OSTI)

Application of sPC-SAFT-JC and sPC-SAFT-GV to Phase Equilibria Predictions of Alkane/Alcohol, Alcohol/Alcohol, and Water/Alcohol Binary Systems ... This paper reports on the ability of sPC-SAFT extended with the polar terms of Gross and Vrabec (GV) and Jog and Chapman (JC) to predict the phase equilibria of alkane/alcohol, alcohol/alcohol, and water/alcohol binary systems. ... For these selected binary systems, the GV and JC polar terms deliver similar results when incorporated into sPC-SAFT. ...

Adriaan J. de Villiers; Cara E. Schwarz; Krasimir G. Chobanov; Andries J. Burger

2014-03-12T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Interaction entre un peptide de B-lactoglobuline bovine (B-lg f1-8) et les protines du lactorsum: Le cas de la-lactalbumine.  

E-Print Network [OSTI]

??Des observations prliminaires ont montr que lauto-assemblage dun peptide issu de lhydrolyse trypsique de la ?-lactoglobuline (?-lg f1-8) modifiait la composition de mlanges de protines (more)

Ratt, Gabriel

2013-01-01T23:59:59.000Z

42

Attenuation Tomography of Northern California and the Yellow Sea / Korean Peninsula from Coda-source Normalized and Direct Lg Amplitudes  

SciTech Connect (OSTI)

Inversions for regional attenuation (1/Q) of Lg are performed in two different regions. The path attenuation component of the Lg spectrum is isolated using the coda-source normalization method, which corrects the Lg spectral amplitude for the source using the stable, coda-derived source spectra. Tomographic images of Northern California agree well with one-dimensional (1-D) Lg Q estimated from five different methods. We note there is some tendency for tomographic smoothing to increase Q relative to targeted 1-D methods. For example in the San Francisco Bay Area, which contains high attenuation relative to the rest of it's region, Q is over-estimated by {approx}30. Coda-source normalized attenuation tomography is also carried out for the Yellow Sea/Korean Peninsula (YSKP) where output parameters (site, source, and path terms) are compared with those from the amplitude tomography method of Phillips et al. (2005) as well as a new method that ties the source term to the MDAC formulation (Walter and Taylor, 2001). The source terms show similar scatter between coda-source corrected and MDAC source perturbation methods, whereas the amplitude method has the greatest correlation with estimated true source magnitude. The coda-source better represents the source spectra compared to the estimated magnitude and could be the cause of the scatter. The similarity in the source terms between the coda-source and MDAC-linked methods shows that the latter method may approximate the effect of the former, and therefore could be useful in regions without coda-derived sources. The site terms from the MDAC-linked method correlate slightly with global Vs30 measurements. While the coda-source and amplitude ratio methods do not correlate with Vs30 measurements, they do correlate with one another, which provides confidence that the two methods are consistent. The path Q{sup -1} values are very similar between the coda-source and amplitude ratio methods except for small differences in the Da-xin-anling Mountains, in the northern YSKP. However there is one large difference between the MDAC-linked method and the others in the region near stations TJN and INCN, which point to site-effect as the cause for the difference.

Ford, S R; Dreger, D S; Phillips, W S; Walter, W R; Mayeda, K; Malagnini, L

2008-07-16T23:59:59.000Z

43

The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc., OAS-RA-13-10  

Broader source: Energy.gov (indexed) [DOE]

Management of the Award of a $150 Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc. OAS-RA-13-10 February 2013 Department of Energy Washington, DC 20585 February 8, 2013 MEMORANDUM FOR THE UNDER SECRETARY OF ENERGY FROM: Gregory H. Friedman Inspector General SUBJECT: INFORMATION: Special Report on "The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc." BACKGROUND The Department of Energy's Vehicle Technologies Program was established to develop and deploy efficient and environmentally friendly highway transportation technologies to reduce the Nation's dependence on foreign oil and provide greater energy security. The Vehicle Technologies Program received $2.4 billion under the American Recovery and Reinvestment Act

44

ISSN 0362-1197, Human Physiology, 2007, Vol. 33, No. 1, pp. 122124. Pleiades Publishing, Inc., 2007. Original Russian Text J.G. Byeon, A.Ya. Kaplan, S.F. Timashev, G.V. Vstovskii, B.W. Park, 2007, published in Fiziologiya Cheloveka, 2007, Vol. 33, No. 1  

E-Print Network [OSTI]

., 2007. Original Russian Text © J.G. Byeon, A.Ya. Kaplan, S.F. Timashev, G.V. Vstovskii, B.W. Park, 2007 was performed for EEG records obtained from 45 10- to 14-year-old boys with schizophrenia spectrum disorders of 39 healthy 11- to 13-year-old boys. Monopolar EEG recordings 1­2 min in duration were carried out

Kaplan, Alexander

45

Li-Ion Battery Cell Manufacturing  

Broader source: Energy.gov (indexed) [DOE]

Corp. LG Chem Chemicals Electronics Comm.& Services *LG Chem *LG Hausys *LG Household & Health Care *LG Life Sciences *LG MMA *LG Electronics *LG Display *LG Innotek *Hiplaza...

46

The effect of 3-D structure on Lg propagation patterns  

Science Journals Connector (OSTI)

......source at the Soviet nuclear test site near Semipalitinsk...northwestern quadrant represent energy propagating toward western...there to be significant energy transfer corresponding...effects in the problem of nuclear discrimination where energy at the explosive source......

M. G. Bostock; B. L. N. Kennett

1990-05-01T23:59:59.000Z

47

Attenuation of multiphase surface waves in the Basin and Range province, part I: Lg and Lg coda  

Science Journals Connector (OSTI)

......from underground nuclear explosions, Bull...measures of elastic energy in estimating source...Wennerberg L., 1987. Energy flux model of seimsic...determination of yield of nuclear explosions, Geophys...from underground nuclear explosions, Bull...measures of elastic energy in estimating source......

J. Xie; B. J. Mitchell

1990-07-01T23:59:59.000Z

48

The Transmission of Federal Reserve Tapering News to Emerging Financial Markets  

E-Print Network [OSTI]

India Indonesia Pakistan Ukraine Czech R. Latvia LithuaniaIndia, Indonesia, Pakistan, Ukraine, Czech Republic, Latvia,India, Indonesia, Pakistan, Ukraine, Czech Republic, Latvia,

Aizenman, Joshua; Binici, Mahir; Hutchison, Michael M

2014-01-01T23:59:59.000Z

49

Regional mb: Ms, Lg/Pg amplitude ratios and Lg spectral ratios as criteria for distinguishing between earthquakes and explosions: a theoretical study  

Science Journals Connector (OSTI)

......among small-magnitude events on Nevada Test Site, Geophys. J. R. astr. Soc...separation of explosions in the Nevada Test Site (NTS) and nearby earthquakes...use data for explosions at the Nevada Test Site (NTS) and therefore the crustal......

R. C. Lilwall

1988-04-01T23:59:59.000Z

50

U.S. District Court Upholds DOE's Action Against LG to Enforce...  

Broader source: Energy.gov (indexed) [DOE]

and the ENERGY STAR program," said Department of Energy General Counsel Scott Blake Harris. "Enhanced energy efficiency is a national priority, and DOE will continue to take...

51

An improved UK local magnitude scale from analysis of shear and Lg-wave amplitudes  

Science Journals Connector (OSTI)

......the Comprehensive Test-Ban Treaty Organization...due to path and site effects associated...in studies of Nevada and Semipalatinsk...Yield estimates of Nevada test site explosions obtained...the Shagan River test site, Geophys. J......

David C. Booth

2007-05-01T23:59:59.000Z

52

On CYLG correspondence for (0,2) toric models  

E-Print Network [OSTI]

Mar 23, 2012 ... mirror symmetry, J. High Energy Phys. 7 (2007) 013, 80 pp. [14] E. Witten, Phases of N = 2 theories in two dimensions, Nuclear Phys.

Lev A. Borisov

2012-04-11T23:59:59.000Z

53

Hydrobiologia 503: 163170, 2003. M.B. Jones, A. Ingolfsson, E. Olafsson, G.V. Helgason, K. Gunnarsson &  

E-Print Network [OSTI]

, isolume Abstract Diel vertical migration (DVM) by zooplankton is a universal feature in all the World in light intensity around dusk and dawn (Ringelberg, 1995, 1999). Over the last two decades, international of the net re- moval of carbon and nitrogen from the ocean surface. By feeding near the surface at night

Hays, Graeme

54

Analysis of historical seismogramsroot mean square Lg magnitudes, yields and depths of explosions at the Semipalatinsk Test Range  

Science Journals Connector (OSTI)

......Geology of NRDC Seismic Station Sites in Eastern Kazakhstan, USSR US...1986b. Yield estimates of Nevada test site explosions obtained from seismic...I9Xhb. Yield estimates o l Nevada test site explosions obtained from seismic......

Hans Israelsson

1994-06-01T23:59:59.000Z

55

A transportable mb(Lg) scale for central Europe and implications for low-magnitude Ms-mb discrimination  

Science Journals Connector (OSTI)

......compiled Ms mb observations of Nevada Test Site (NTS) explosions. We begin...near-regional Ms scales for the Nevada Test Site, Bull. seism. Soc. Am...explosions at east Kazakh and Nevada test sites, Bull. seism. Soc. Am......

Howard J. Patton; Jrg Schlittenhardt

2005-10-01T23:59:59.000Z

56

Folk narratives, archaeology, and descendant communities: a case study of the Albert J. Phillips Memorial Cemetery (41gv125), Galveston County, Texas.  

E-Print Network [OSTI]

??The excavation of historic cemeteries often incorporates a variety of sources not available to prehistorians, including written documents, headstones, and oral history. One important source (more)

Powell, Leah Carson

2012-01-01T23:59:59.000Z

57

Effects of implantation of Synovex (progesterone-estradiol) and castration in Holstein and Brown Swiss bull calves for beef production  

E-Print Network [OSTI]

~ caLG care+". ~iaa Be~a~ . ". a ~mLL~;~ii Uhoy' SaLCQ GLoaLakma phmp5ace A~~ZQ==' Za& ~~ ee e~W chic. "~ ~ eaa eaaeecbsd a@8 Rent FG~ eel @4PgelN4'aoL sc&mmcaLll' aa ecgisLhLc4 Haal@sssmaca. II@ -':~~ w4~ and 4ia@e- ~ eel 44~XRy -- whee eiii4...~~~~~ QF XL~%M'~JISM GP GV~i: ~ (K~%'~~HG-8SVRPPEfQ AGO CKS~ZXKl m mmmm . m n'-zz kaae wu. e. ~~ms sm ~ ewm~~ Ey F~QQ de t'A760 ~ L: irk ' 5 ~Qe4 4e Ae skate Oellega et che 'Zemi PAR Snivel, ey 4o ~roast aaaueeac oe m i;~us:. ~re xor...

Vergara, Francisco de Patino

2012-06-07T23:59:59.000Z

58

Convergence and divergence of Fourier series  

E-Print Network [OSTI]

of Theorem 26, in euob gros@ of terse cormsgonaing to Q ~ f cs /~ Ie g substitute C ~ X for g ~ Vc bEIFQ e, series ~ Pt~ &J l~g' ~ ~ es before~ ecgi p~~ 4 ~ m ghenevey 'I gAgf' - &. &~j-c+& ~ 4 gA, k. . -- f, ZA~&g; The serums stiD. oonverges nnifon...myles"aqua~, c~pcpg apop CXQFtQSQ $2VXQ8 M 'eKISR) go eexPop cap. cog. e~~bax s~j go qu~g~ ~~ ~ ssxag go alloy ~c~s, ", pnr ~g~~y s~ ~ jacuzzi ~seps~g a~ oq. ~~ng l @amuse aa~gv ~u m~ ao ~~~ucTsa e &, so. , '3 '3 t &~% ~Q pQO ~EBS 0$ SQ...

Bryant, Jack Douglas

2012-06-07T23:59:59.000Z

59

Virtues of simple hydro-economic optimization: Baja California, Mexico J. Medellin-Azuara a,*, L.G. Mendoza-Espinosa b  

E-Print Network [OSTI]

and conveyance expansions are economically promising. At current costs desalination is currently uneconomicalVirtues of simple hydro-economic optimization: Baja California, Mexico J. Medelli´n-Azuara a,*, L, UK d Department of Agricultural and Resource Economics, University of California, Davis, One Shields

Pasternack, Gregory B.

60

U  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Microsoft Word - Final Nuclear Materials Management and Safeguards...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

62

Microsoft PowerPoint - 8_Martyn_NMMSS_2013_Foreign Obligations...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, The...

63

Microsoft PowerPoint - 10_ROSE_MARTYN_UPDATED_NMMSS_2014_Foreign...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, The...

64

U  

National Nuclear Security Administration (NNSA)

states: Austria, Belgium, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

65

Microsoft PowerPoint - 2A_Wednesday 5-22 830 NMMSS_2013_Presentation...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

66

Microsoft Word - Foreign Obligation Codes.docx  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

67

Microsoft PowerPoint - 6_Mitch Hembree_Monday 5-20 1115 NMMSS...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

68

Microsoft Word - April2005.doc  

National Nuclear Security Administration (NNSA)

states: Austria, Belgium, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

69

"Bond paths and van der Waals interactions in orpiment, As2S3", G.V. Gibbs, A.F. Wallace, R. Zallen, R.T. Downs. N.L.  

E-Print Network [OSTI]

Reflectivity and Lattice Fundamentals in Anatase TiO2", R.J. Gonzalez, R. Zallen, and H. Berger, Phys. Rev. B., Phys. Rev. B 25, 781 (1982). · "Crystal Structures", R. Zallen, chapter one in Handbook

Zallen, Richard

70

JID:PLA AID:20980 /SCO Doctopic: Condensed matter [m5Gv1.5; v 1.58; Prn:8/11/2011; 8:53] P.1 (1-8) Physics Letters A ()  

E-Print Network [OSTI]

) The existence of an annual solar forcing FS; (2) NH is phase locked directly to FS while NL is frequently phase rights reserved. 1. Introduction Centuries ago South American sailors observed that during some years that the maximum SST anomalies in the central tropical Pacific near 170W occurred at the end of the calendar year

Douglass, David H.

71

DOE Defends Decision to Revoke Energy Star Designation for Certain...  

Broader source: Energy.gov (indexed) [DOE]

Decision to Revoke Energy Star Designation for Certain LG Refrigerators DOE Defends Decision to Revoke Energy Star Designation for Certain LG Refrigerators December 23, 2009 -...

72

--No Title--  

Gasoline and Diesel Fuel Update (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

73

Geothermal Technologies Office: Download GETEM, August 2012 Beta  

Broader source: Energy.gov (indexed) [DOE]

Indonesia Irak Iran Ireland Ireland, Northern Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Latvia Lebanon Liberia Liechtenstein Lithuania...

74

Eia.gov BETA - Data - U.S. Energy Information Administration...  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

75

IEC documents | Department of Energy  

Energy Savers [EERE]

Hungary IADB Iceland IEA IFC India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Latvia Lebanon Lithuania Malaysia Mexico Moldova Mongolia...

76

DEVELOPING SAFETY CULTURE IN NUCLEAR ACTIVITIES Practical Suggestions  

Broader source: Energy.gov (indexed) [DOE]

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

77

Status of U.S. Nuclear Outages - U.S. Energy Information Administratio...  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

78

INSAG-15 Key Practical Issues  

Broader source: Energy.gov (indexed) [DOE]

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

79

E-Print Network 3.0 - austria telekanal hakkab Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

80

E-Print Network 3.0 - austria 25th june-7th Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

E-Print Network 3.0 - austria Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

82

United States and Latvian Governments Sign Agreement to Allow...  

Office of Environmental Management (EM)

Raimonds Vejonis signed the agreement, which will provide for repatriation to Russia of SovietRussian-origin nuclear fuel from Latvia's shutdown research reactors at...

83

The power of the family  

E-Print Network [OSTI]

Denmark, Estonia, Spain, Finland, France, Great Britain,ties Croatia Algeria Finland Sweden Latvia Czech RepublicRep. South Africa (Union of) Finland Korea Mexico Bangladesh

Alesina, Alberto; Giuliano, Paola

2010-01-01T23:59:59.000Z

84

E-Print Network 3.0 - aivars aboltins aigars Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

District Riga, Latvia Source: Massachusetts at Amherst, University of - Center for Energy Efficiency and Renewable Energy, Building Energy Efficiency Program Collection:...

85

Brochure front(2-09)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Latvia Lesotho Libyan Arab Jamahiriya Lithuania Madagascar Malawi Mauritius Mexico Nepal The Netherlands New Zealand Nicaragua Nigeria Norway Philippines Poland Portugal...

86

Tax Morale and Conditional Cooperation  

E-Print Network [OSTI]

Latvia, Estonia, Ukraine, Russia, Croatia, Slovakia, Greece,Slovak Republic -0.009 Ukraine Notes: i. The results aree.g. , Russia, Belarus, Ukraine, Lithuania, Estonia or

Frey, Bruno S.; Torgler, Benno

2006-01-01T23:59:59.000Z

87

Nordisk kernesikkerhedsforskning Norrnar kjarnryggisrannsknir  

E-Print Network [OSTI]

such as reprocessed enriched uranium and weapons grade plutonium provided different challenges and there were. Latvian Environment, Geology and Meteorology Centre, Latvia. jberzins at la

88

E85 Retail Business Case: When and Why to Sell E85 (Presentation)  

SciTech Connect (OSTI)

Agenda: {lg_bullet} Convey current state of the retail gasoline market {lg_bullet} Explore E85 as part of the solution {lg_bullet} Test the profitability of E85 as an investment {lg_bullet} Give retailers guidance to assess if E85 would be a good investment for them

Johnson, C.

2007-08-30T23:59:59.000Z

89

On testing functional constraints in structural equation models  

Science Journals Connector (OSTI)

......be shown that the distribution of T2M = \\h(9)'\\ n;l L'g(Ag Wg A'g) ~l Lg\\ \\d)\\ , (8) where Lg = (dh/dfig), converges in distribution to x'2 {r > ^M(^O)} with tii&o) = \\h(9){ n;' L'g rg~0 l Lg) \\(d......

SIK-YUM LEE

1985-04-01T23:59:59.000Z

90

Q.A.BREAK SHARP EDGES USED ON DRAWING NO.  

E-Print Network [OSTI]

(31) (29) 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 7 - SCR, HEX HD, .312-18NC X 1.5 LG. SST 24 - - - 25 5 - SCR, HEX HD, .375-16NC X 2,0 LG. 26 - - - 27 14 - SCR, HEX HD, .250-20NC X 1.5 LG. 28 - - - 29 9 - ROD, CONT. THD, 10-32NF X 3.5 LG. 30 - - - 31 12 - SCR, HEX HD, 10-32NF X .75 LG. 32 - - - 33 6

Llope, William J.

91

Fusion Electricity A roadmap to the realisation of fusion energy  

E-Print Network [OSTI]

Fusion Electricity A roadmap to the realisation of fusion energy #12;28 European countries signed association EURaToM ­ University of latvia LATVIA lithuanian Energy Institute LITHUANIA Ministry of Education and Research ROMANIA Ministry of Education, science, culture and sport SLOVENIA centro de Investigaciones

92

Use of P coda for determination of yield of nuclear explosions  

Science Journals Connector (OSTI)

......explosions in granite at the Nevada Test Site and Algeria: joint determination...receiver effects for Lg waves from Nevada Test Site explosions, Bull. seism. Soc...transverse Lg from explosions at the Nevada Test Site (NTS) provides fairly satisfactory......

I. N. Gupta; R. R. Blandford; R. A. Wagner; J. A. Burnetti; T. W. McElfresh

1985-11-01T23:59:59.000Z

93

Geophys. J. Int. (1997)129,221-234 On the nature of regional seismic phases-11.  

E-Print Network [OSTI]

a graben structure can have a major influence, since they remove Lg energy by generating P conversion and scattering-the principal mechanisms for strong Lg attenuation across a graben. The reduction of the Lg energy 1991) and crustal attenuation factors (e.g.Campillo 1987). * Present address: Hokkaido University

Furumura, Takashi

94

Surface waves on multilayered anelastic media  

Science Journals Connector (OSTI)

...with these portions of Lg, the group-velocity curves representing the attenu- SURFACE TAVES ON MULTILAYERED ANELASTIC &,[EDIA 911 ation lows are relatively steep. Thus, after traversing a long oceanic path, the energy in the Lg 1 and Lg 2 period ranges...

Fred Schwab; Leon Knopoff

95

Update on the European Weather Radar Network Iwan Holleman, Laurent Delobbe, and Anton Zgonc  

E-Print Network [OSTI]

Meteorological Services". The second phase of OPERA, 2004-2006, has involved a significant renewal of the Program Hungary Iceland Ireland Italy Latvia Luxembourg Netherlands Norway Poland Portugal Romania Slovak Republic

Stoffelen, Ad

96

105(scaled land 215%)7-22-05  

National Nuclear Security Administration (NNSA)

Guatemala Honduras Hungary India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Laos Latvia Lebanon C A N A D A U N I T E D S T A T...

97

Argentina: An Important All-of-the-Above Energy Partner | Department...  

Broader source: Energy.gov (indexed) [DOE]

of Latvia Deputy Secretary Poneman Statement on Second Meeting of the U.S. - South Africa Bilateral Energy Dialogue Argentina: An Important All-of-the-Above Energy Partner...

98

Perspectives on the United States Health Care System by International students from the newly independent states of the former Soviet Union and a comparison of former Soviet countries' and the United States Health Care Systems  

E-Print Network [OSTI]

of Institutional Studies and Planning, 2001). The research of this thesis was limited to students of the NIS: Armenia, Azerbaijan, Bclarus, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Moldova, Russia, Tajikistan, Turkmenistan, Ukraine... 22 Q-5 In what country were you born? Q-6 1 Armenia 2 Azerbaijan 3 Belarus 4 Georgia 5 Kazakhstan 6 Kyrgyzstan 7 Latvia 8 Lithuania 9 Moldova 10 Russia 11 Tajikistan 12 Turkmenistan 13 Ukraine 14 Uzbekistan 15 Other (Please Specify...

Leuenberger, Larissa Diane

2013-02-22T23:59:59.000Z

99

IEEE TRANSACTIONS ON CIRCUITS AND SYSTEMS FOR VIDEO TECHNOLOGY, VOL. 22, NO. 1, JANUARY 2012 77 Modeling and Compressing 3-D Facial Expressions  

E-Print Network [OSTI]

Modeling and Compressing 3-D Facial Expressions Using Geometry Videos Jiazhi Xia, Dao Thi Phuong Quynh present a novel geometry video (GV) framework to model and compress 3-D facial expressions. GV bridges the gap of 3-D motion data and 2-D video, and provides a natural way to apply the well-studied video

Hoi, Steven Chu-Hong

100

Microsoft Word - 0025.TEE.doc  

Broader source: Energy.gov (indexed) [DOE]

November 9, 2005 DECISION AND ORDER OFFICE OF HEARINGS AND APPEALS Application for Exception Case Name: LG Electronics, Inc. Date of Filing: September 27, 2005 Case Number: TEE-0025 This Decision and Order considers an Application for Exception filed by LG Electronics, Inc. (LG) seeking exception relief from the provisions of 10 C.F.R. Part 430, Energy Conservation Program for Consumer Products: Energy Conservation Standards for Refrigerators, Refrigerator- Freezers and Freezers (Refrigerator Efficiency Standards). In its exception request, LG asserts that the firm would suffer a gross inequity if required to adhere to the Refrigerator Efficiency Standards, codified at 10 C.F.R. § 430.32. If LG's Application for Exception were granted, LG

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Niederschsisches Ministerium fr Wissenschaft und Kultur  

E-Print Network [OSTI]

/14 Anglistik/Englisch / 2-Fach-Bachelor (LG+FW) (008/101) 14 (28) 53 Englisch / 2-Fach-Bachelor (LGH+LR) (008-Fach-Bachelor (LG+FW) (053/101) 1 (2) 36 Evangelische Religion / 2-Fach-Bachelor (LGH+LR) (053/133) 3-Fach-Bachelor (LG+FW) (067/101) 14 (28) 63 Deutsch / 2-Fach-Bachelor (LGH+LR) (067/133) 6 (12) 59

Steinhoff, Heinz-Jürgen

102

Ex parte memorandum | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

parte memorandum More Documents & Publications TEE-0047 - In the Matter of Samsung Electronics America TEE-0025 - In the Matter of LG Electronics, Inc. TEE-0022 - In the Matter...

103

Media Conference Call Advisory: U.S. Department of Energy's Argonne...  

Broader source: Energy.gov (indexed) [DOE]

Media Conference Call Advisory: U.S. Department of Energy's Argonne National Laboratory, General Motors and LG Chem to discuss advanced battery material Media Conference Call...

104

GAGNON, CHRISTIAN, MILIEN PELLETIER, ALFONSO MUCCI ...  

Science Journals Connector (OSTI)

AND OTHERS 1995. Mercury remobilization from flooded soils in a hydroelectric reservoir of northern Quebec. LG-2: Results of a soil resuspension experiment.

105

What use are Formal Analysis and Design Methods to Telecommunications Services?  

E-Print Network [OSTI]

Calder,M. Feature Interactions in Telecommunications and Software Systems V, K. Kimbler and L.G. Bouma, (eds.) pp 10-31 IOS Press

Calder, M.

106

E-Print Network 3.0 - asymptomatic left ventricular Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

32 Prerequisites: System Modeling, Interest in Physiological Systems Summary: -LG-RA-08 Modeling of Pulsatile Ventricular Assist Devices Simulation of the interaction between the...

107

Buildings Energy Data Book: 5.7 Appliances  

Buildings Energy Data Book [EERE]

6 2008 Room Air Conditioner Manufacturer Market Shares (Percent of Products Produced) Company Market Share (%) LG Electronics (Goldstar) 32% Fedders 12% Electrolux (Frigidaire) 13%...

108

E-Print Network 3.0 - attain blood pressure Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

at Madison Collection: Physics 3 Prerequisites: Control Systems I, System Modeling, MATLABSimulink, Interest in human physiology Summary: -LG-GO-01 Blood Pressure Control...

109

E-Print Network 3.0 - angiotensin-increased blood pressure Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Information Sciences 2 Prerequisites: Control Systems I, System Modeling, MATLABSimulink, Interest in human physiology Summary: -LG-GO-01 Blood Pressure Control...

110

Attitudes toward offshore oil development: A summary of current evidence  

E-Print Network [OSTI]

Press; 1968. [11] Offshore Staff. Deep sea drillingproject completes second leg. Offshore 1969:6772. [12] Weeks LG. Offshore operations around the world. Offshore

Gramling, R; Freudenburg, Wm R

2006-01-01T23:59:59.000Z

111

A High-Performance PHEV Battery Pack  

Broader source: Energy.gov (indexed) [DOE]

124B Employees - 210,000 LG Group at a Glance ABSEP NCCPolyolefin PVCRubber Acrylate LCD Polarizer LCD Glass OLED Materials Color Filter...

112

communications in analysis and geometry  

E-Print Network [OSTI]

& Guofang Wei Laplacian Lg. Indeed, one has (1.2) Lgh = h - 2 Rh + Ric h + h Ric. The two thus coincide

Bigelow, Stephen

113

Nonclassical Carbocations From Controversy to Convention  

E-Print Network [OSTI]

rearrangements - Overman and the Prins-Pinacol #12;R R R LG R RR superacid LGH "carbenium ion" - 6 valence e

Stoltz, Brian M.

114

CONGRESS AVE. CHARLIE COE GOLF  

E-Print Network [OSTI]

COURT ES CT CT LG CHILL WATER #1 TCM PP SHOPS MC PP MC PP OFF O LGH WT PAGE ST MONNETTAVE UNIVERSITY PL

Oklahoma, University of

115

Buildings Energy Data Book: 5.7 Appliances  

Buildings Energy Data Book [EERE]

1 2008 Microwave Oven Manufacturer Market Shares (Percent of Products Produced) Company Market Share (%) LG Electronics (Goldstar) 33% Sharp 15% Samsung 15% Daewoo 7% Matsushita...

116

Buildings Energy Data Book: 5.7 Appliances  

Buildings Energy Data Book [EERE]

8 2008 Clothes Washer Manufacturer Market Shares (Percent of Products Produced) Company Market Share (%) Whirlpool 64% Maytag (1) GE 16% Electrolux (Frigidaire) 6% LG Electronics...

117

UF Access List | Stanford Synchrotron Radiation Lightsource  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

NL Alaverdashvili Mariam 522740 010915-011215 011515-012015 3614 3614 U SASKATCHEWAN Albert Felicie 458988 072515-072915 LG84 LLNL Aleshin Alexander 280950 1128...

118

NETL F 451.1/1-1, Categorical Exclusion Designation Form  

Broader source: Energy.gov (indexed) [DOE]

100113 - 033115 Patcharin Burke Cleveland, Ohio SECA Coal Based Systems - LG Fuel Cell Systems To demonstrate, via analysis and testing, progress towards adequate stack...

119

NETL F 451.1/1-1, Categorical Exclusion Designation Form  

Broader source: Energy.gov (indexed) [DOE]

0113 - 033115 Patcharin Burke Derby, United Kingdom SECA Coal Based Systems - LG Fuel Cell Systems To demonstrate, via analysis and testing, progress towards adequate stack...

120

NETL F 451.1/1-1, Categorical Exclusion Designation Form  

Broader source: Energy.gov (indexed) [DOE]

100113 - 033115 Patcharin Burke Canton, Ohio SECA Coal Based Systems - LG Fuel Cell Systems To demonstrate, via analysis and testing, progress towards adequate stack...

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Alternative Fuels Data Center  

Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

Low Emission Vehicle Electricity Rate Incentive - Louisville Gas & Electric Louisville Gas & Electric (LG&E) offers a pilot Low Emission Vehicle (LEV) time-of-use electricity rate...

122

Energy Blog | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

5, 2011 5, 2011 "Smart Windows" seen at light and dark settings. | Photo Courtesy of SAGE Electrochromics, Inc., by Susan Fleck Photography Making Smart Windows Smarter This new type of glass that could drastically help you control the temperature of your home. "Smart windows" could save 1 quadrillion BTUs of energy each year - more than 1 percent of the nation's annual energy consumption, or more than $10 billion in annual energy costs. April 4, 2011 Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp Deputy Secretary of Energy Meets with President of Latvia Deputy Secretary of Energy Daniel Poneman met with President Zatlers of Latvia. Read more. April 4, 2011 The Florida International University team | courtesy of the FIU team

123

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

124

Cellulose Binding Domains of a Phytophthora Cell Wall Protein Are Novel Pathogen-Associated Molecular Patterns  

Science Journals Connector (OSTI)

...except after heat treatment of the medium (Meindl...and neutralized by dialysis against 100 volumes of water at 4C for 16 h...strain GV3101 by electroporation, and transformed...et al. (1980). Electron Microscopy and Immunogold...

Elodie Gaulin; Nani Dramé; Claude Lafitte; Trudy Torto-Alalibo; Yves Martinez; Carine Ameline-Torregrosa; Moustafa Khatib; Honoré Mazarguil; François Villalba-Mateos; Sophien Kamoun; Christian Mazars; Bernard Dumas; Arnaud Bottin; Marie-Thérèse Esquerré-Tugayé; Martina Rickauer

2006-06-09T23:59:59.000Z

125

Four-Wave Mixing Microscopy with Electronic Contrast of Individual Carbon Nanotubes  

E-Print Network [OSTI]

and J. Jiang, in Carbon Nanotubes, edited by A. Jorio, G.V. Perebeinos, in Carbon Nanotubes, edited by A. Jorio, G.and P. Finnie, in Carbon Nanotubes, edited by A. Jorio, G.

Collins, Philip G

2012-01-01T23:59:59.000Z

126

SAND2011-6496  

Office of Scientific and Technical Information (OSTI)

2.1 Model definition Let G(u) be a real-valued Gaussian random field with zero mean, unit variance, and covari- ance function c(u, v) EG(u) G(v), where EX denotes the...

127

Optimal control approach to termination of re-entry waves in cardiac electrophysiology  

E-Print Network [OSTI]

)Ie(t) - c2 (x)Ie(t) in Q (2) v t = · ¯i v + · ¯i u - Iion(v, w) + Itr(x, t) in Q (3) w t = G(v, w) in Q, (4 electrode. The Iion(v, w) is the current density flowing through the ionic channels and the function g(v, w

Kunisch, Karl

128

Influence of Nutrition during the Juvenile Period on Gene Expression Within the Hypothalamic Arcuate Nucleus and on Age at Puberty in Heifers  

E-Print Network [OSTI]

compared to HF/LG heifers. In contrast, concentrations of insulin (P < 0.05), IGF-1 (P < 0.002) and leptin (P = 0.1) were greater in HC/HG compared to HF/LG. For Experiment 2, 48 heifers were used in 2 replicates (24 heifers/replicate) in a 2 x 2 factorial...

Allen, Carolyn C.

2011-10-21T23:59:59.000Z

129

Selected Trace Elements in the Sacramento River, California: Occurrence and Distribution  

E-Print Network [OSTI]

, thallium, thulium, uranium, vanadium, tungsten, yttrium, ytterbium, zinc, and zirconium--were measured ranged from 900 lg/L at Spring Creek (Iron Mountain acid mine drainage into Keswick Reservoir) to 0.65 lg to the delta in San Francisco Bay plays an important role in understanding the impact of mining, agriculture

130

Impact of Clinical and Pathologic Features on Tumor-Infiltrating Lymphocyte Expansion from Surgically Excised Melanoma Metastases for Adoptive T-cell Therapy  

Science Journals Connector (OSTI)

...Liu 2 Priscilla W. Miller 1 Willem W. Overwijk 1 Nebiyou B. Bekele 2 Merrick I. Ross...6199-206. 24. Lizee G , Radvanyi LG, Overwijk WW Hwu P.Improving antitumor immune...4794-803. 25. Lizee G , Radvanyi LG, Overwijk WW Hwu P.Immunosuppression in melanoma...

Richard W. Joseph; Vijay R. Peddareddigari; Ping Liu; Priscilla W. Miller; Willem W. Overwijk; Nebiyou B. Bekele; Merrick I. Ross; Jeffrey E. Lee; Jeffrey E. Gershenwald; Anthony Lucci; Victor G. Prieto; John D. McMannis; Nicholas Papadopoulos; Kevin Kim; Jade Homsi; Agop Bedikian; Wen-Jen Hwu; Patrick Hwu; Laszlo G. Radvanyi

2011-07-15T23:59:59.000Z

131

Less Yin, More Yang: Confronting the Barriers to Cancer Immunotherapy  

Science Journals Connector (OSTI)

...136-46. 14 Lizee G, Radvanyi LG, Overwijk WW, Hwu P. Immunosuppression in melanoma...Cancer Res 2001;61:6451-8. 44 Overwijk WW, Theoret MR, Finkelstein SE, et...207-14. 62 Lizee G, Radvanyi LG, Overwijk WW, Hwu P. Improving antitumor immune...

Gregory Lize; Mayra A. Cantu; Patrick Hwu

2007-09-15T23:59:59.000Z

132

UNIVERSITY OF STRATHCLYDE DEPARTMENT OF PHYSICS  

E-Print Network [OSTI]

UNIVERSITY OF STRATHCLYDE DEPARTMENT OF PHYSICS 2010/2011 HANDBOOK for 2nd YEAR STUDENTS MPhys Martin Head of Department #12;Department of Physics Student Handbook 2010/2011 StHBYr2/NL/LG 2 August of Physics Student Handbook 2010/2011 StHBYr2/NL/LG 4 August 2010 Our best wishes for your studies during

Mottram, Nigel

133

Reply to comment by T. Molg et al. on ``Recent glacial recession in the Rwenzori Mountains of East Africa due to rising air temperature''  

E-Print Network [OSTI]

Reply to comment by T. Mo¨lg et al. on ``Recent glacial recession in the Rwenzori Mountains of East, A. Majugu, A. Muwanga, and B. Nakileza (2006), Reply to comment by T. Mo¨lg et al. on ``Recent.g., Bradley et al., 2006; Thompson et al., 2006] and atmospheric humidity [e.g. Kaser et al., 2004; Mo

Jones, Peter JS

134

SPECIAL ISSUE: ENVIRONMENTAL NANOMATERIALS Arsenic Removal by Nanoscale Magnetite in Guanajuato, Mexico  

E-Print Network [OSTI]

mining activity. Arsenic concen- trations as high as 33 lg/L in Guanajuato and 266 lg/L in surrounding and as a by-product of industrial activity (Plant et al., 2005). The presence of arsenic in drinking water, skin lesions, and cancer of the bladder, lungs, kidneys, and skin. There is some evidence that elevated

Alvarez, Pedro J.

135

Leucoagaricus gongylophorus Produces Diverse Enzymes for the Degradation of Recalcitrant Plant Polymers in Leaf-Cutter Ant Fungus Gardens  

Science Journals Connector (OSTI)

...Department of Energy Great Lakes Bioenergy Research Center, University...cephalotes X X X X LG_ARG1 Argentina Acromyrmex laticeps X X LG...Costa Rica, Peru, and Argentina (Table 3). Comparison of...and the DOE Great Lakes Bioenergy Research Center (DOE Office...

Frank O. Aylward; Kristin E. Burnum-Johnson; Susannah G. Tringe; Clotilde Teiling; Daniel M. Tremmel; Joseph A. Moeller; Jarrod J. Scott; Kerrie W. Barry; Paul D. Piehowski; Carrie D. Nicora; Stephanie A. Malfatti; Matthew E. Monroe; Samuel O. Purvine; Lynne A. Goodwin; Richard D. Smith; George M. Weinstock; Nicole M. Gerardo; Garret Suen; Mary S. Lipton; Cameron R. Currie

2013-04-12T23:59:59.000Z

136

NEST REPRESENTATIONS OF DIRECTED GRAPH ALGEBRAS  

E-Print Network [OSTI]

NEST REPRESENTATIONS OF DIRECTED GRAPH ALGEBRAS KENNETH R. DAVIDSON AND ELIAS KATSOULIS Abstract. This paper is a comprehensive study of the nest rep- resentations for the free semigroupoid algebra LG that the finite dimensional nest representations sep- arate the points in LG, and a fortiori, in T + (G

Katsoulis, Elias G.

137

Solid Oxide Fuel Cell Hybrid System for Distributed Power Generation  

SciTech Connect (OSTI)

This report summarizes the work performed by Honeywell during the January 2002 to March 2002 reporting period under Cooperative Agreement DE-FC26-01NT40779 for the U. S. Department of Energy, National Energy Technology Laboratory (DOE/NETL) entitled ''Solid Oxide Fuel Cell Hybrid System for Distributed Power Generation''. The main objective of this project is to develop and demonstrate the feasibility of a highly efficient hybrid system integrating a planar Solid Oxide Fuel Cell (SOFC) and a turbogenerator. For this reporting period the following activities have been carried out: {lg_bullet} Conceptual system design trade studies were performed {lg_bullet} System-level performance model was created {lg_bullet} Dynamic control models are being developed {lg_bullet} Mechanical properties of candidate heat exchanger materials were investigated {lg_bullet} SOFC performance mapping as a function of flow rate and pressure was completed

Nguyen Minh

2002-03-31T23:59:59.000Z

138

Subsidy schemes in EU t i M ti ti dcountries: Motivations and  

E-Print Network [OSTI]

FIT - Hungary FIT (feed-in premium) Investment subsidies Latvia FIT (combined with quota obligation support or taxes Bulgaria FIT - Czech FIT (fixed tariff or premium) Investment subsidies Republic Estonia competition for investments in renewables The level of support of FI tariffs and market prices together

139

Job 4459300 Ref.No. Prepd. CHP/GEA  

E-Print Network [OSTI]

Auditing of Buildings and Inspection of Boilers and Air- conditioning Systems Final report Institutional in large buildings 5 2.2 Article 8, Inspection of boilers 6 2.3 Article 9, Inspection of air-conditioning, responsibility for buildings, boilers and air-con systems in Latvia is divided as illustrated below

140

Energy saving policy and emission decreasing  

E-Print Network [OSTI]

,9648,2787,4016,6985,9Electricity consumption E (TWh)3 13,8510,858,1085,7814,32GDP (bill. LVL)2 56765GDP grows (% per year)1Energy saving policy and emission decreasing Latvian experienceLatvian experience Dr. A. Davis, M of fuelNr. Table1. Primary energy consumption in Latvia #12;Introduction Table 2. Formation of pollutants

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

The European tobacco control report 2007  

E-Print Network [OSTI]

Netherlands Republic of Moldova The European tobacco control report 2007 pagepage 9 Latvia, Lithuania, Malta, the Republic of Moldova, Netherlands,Netherlands Norway Poland Portugal Republic of Moldova Romania Russian Federation Serbia Slovakia Slovenia The European tobacco control report 2007 page

World Health Organization

2007-01-01T23:59:59.000Z

142

Dynamical Generation of a Repulsive Vector Contribution to the Quark Pressure  

E-Print Network [OSTI]

Lattice QCD results for the coefficient $c_2$ appearing in the Taylor expansion of the pressure show that this quantity raises with the temperature towards the Stefan-Boltzmann limit. On the other hand, model approximations predict that when a vector repulsion, parametrized by $G_V$, is present this coefficient reaches a maximum just after $T_c$ and then deviates from the lattice predictions. Recently, this discrepancy has been used as a guide to constrain the (presently unknown) value of $G_V$ within the framework of effective models at large-$N_c$ (LN). In the present investigation we show that, due to finite $N_c$ effects, $c_2$ may also develop a maximum even when $G_V=0$ since a vector repulsive term can be dynamically generated by exchange type of radiative corrections. Here we apply the the Optimized Perturbation Theory (OPT) method to the two flavor Polyakov--Nambu--Jona-Lasinio model (at $G_V=0$) and compare the results with those furnished by lattice simulations an by the LN approximation at $G_V=0$...

Restrepo, Tulio E; Pinto, Marcus Benghi; Ferrari, Gabriel N

2014-01-01T23:59:59.000Z

143

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

31 - 5040 of 26,777 results. 31 - 5040 of 26,777 results. Download Audit Report: OAS-L-06-02 Property Transfers at the East Tennessee Technology Park http://energy.gov/ig/downloads/audit-report-oas-l-06-02 Download LG Electronics U.S.A. v. DOE, Stipulation of Voluntary Dismissal LG Electronics U.S.A., Inc. v. U.S. Dept. of Energy, Civil Action Number 1:09-cv-02297-JDB - LG voluntarily dismissed its claims against the DOE and agrees to remove the ENERGY STAR labels from various refrigerator-freezers. http://energy.gov/gc/downloads/lg-electronics-usa-v-doe-stipulation-voluntary-dismissal Download EIS-0409: Final Environmental Impact Statement Kemper County Integrated Gasification Combined-Cycle (IGCC) Project http://energy.gov/nepa/downloads/eis-0409-final-environmental-impact-statement

144

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

691 - 8700 of 28,905 results. 691 - 8700 of 28,905 results. Download TEE-0025- In the Matter of LG Electronics, Inc. This Decision and Order considers an Application for Exception filed by LG Electronics, Inc. (LG) seeking exception relief from the provisions of 10 C.F.R. Part 430, Energy Conservation Program for... http://energy.gov/oha/downloads/tee-0025-matter-lg-electronics-inc Download EIS-0128-SA-01: Record of Decision Los Banos-Gates Transmission Project http://energy.gov/nepa/downloads/eis-0128-sa-01-record-decision Download FIA-12-0051- In the Matter of William Berger On October 9, 2012, the Office of Hearings and Appeals (OHA) issued a decision denying an appeal from a Freedom of Information Act (FOIA) determination issued by the Department of Energy's National... http://energy.gov/oha/downloads/fia-12-0051-matter-william-berger

145

Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain  

Broader source: Energy.gov (indexed) [DOE]

Department of Energy to Take Steps to Remove ENERGY STAR Label on Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models December 7, 2009 - 12:00am Addthis Washington, DC - The Department of Energy announced today that as part of the expanded enforcement efforts under the ENERGY STAR® program, effective January 2, 2010, certain LG French-door refrigerator-freezers are banned from using the ENERGY STAR® label that helps consumers identify energy efficient products that will reduce their energy use and save them money. DOE is proceeding with this action after multiple independent labs have confirmed that when certain LG French-door refrigerator-freezers are tested using existing DOE test procedures, they do not qualify for the ENERGY

146

Product Efficiency Cases | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

November 22, 2005 November 22, 2005 TEE-0024 - In the Matter of Refricenter International This Decision and Order considers an Application for Exception filed by Refricenter International (Refricenter), seeking exception relief from the provisions of 10 C.F.R. Part 430, pertaining to energy conservation standards for central air conditioners and heat pumps (Air Conditioner Standards). Refricenter imports and markets air November 9, 2005 TEE-0025 - In the Matter of LG Electronics, Inc. This Decision and Order considers an Application for Exception filed by LG Electronics, Inc. (LG) seeking exception relief from the provisions of 10 C.F.R. Part 430, Energy Conservation Program for Consumer Products: Energy Conservation Standards for Refrigerators, Refrigerator-Freezers and Freezers (Refrigerator Efficiency Standards). In its exception request, LG

147

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

11 - 1820 of 28,905 results. 11 - 1820 of 28,905 results. Download Technical Standards Newsletter- February 2000 The Standards Forum and Standards Actions, February 2000 http://energy.gov/hss/downloads/technical-standards-newsletter-february-2000 Download EA-1584: Final Environmental Assessment Sand Point Wind Installation Project Sand Point, Alaska http://energy.gov/nepa/downloads/ea-1584-final-environmental-assessment Download LG Electronics v. DOE- Defendants' Brief in Opposition to Plaintiff LG Electronics' Motion for a Preliminary Injunction December 23, 2009 http://energy.gov/gc/downloads/lg-electronics-v-doe-defendants-brief-opposition-plaintiff-lg-electronics-motion Download CX-008818: Categorical Exclusion Determination Utility Corridor Extension CX(s) Applied: B4.7, B4.11, B5.2, B5.5

148

Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain  

Broader source: Energy.gov (indexed) [DOE]

to Take Steps to Remove ENERGY STAR Label on to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models December 7, 2009 - 12:00am Addthis Washington, DC - The Department of Energy announced today that as part of the expanded enforcement efforts under the ENERGY STAR® program, effective January 2, 2010, certain LG French-door refrigerator-freezers are banned from using the ENERGY STAR® label that helps consumers identify energy efficient products that will reduce their energy use and save them money. DOE is proceeding with this action after multiple independent labs have confirmed that when certain LG French-door refrigerator-freezers are tested using existing DOE test procedures, they do not qualify for the ENERGY

149

TYPE OF OPERATION R Research & Development T& Facility Type  

Office of Legacy Management (LM)

------------ I Prime 5 Subcontractor 0 Purchase Order a Other information (i.e., cost + fixed fee, unit p CgNTRACTING PERIOD: L.&G , PX& & cx LFkoL --- ...

150

STUDY OF RARE PROCESSES INDUCED BY 209-GeV MUONS  

E-Print Network [OSTI]

^ for the effect of muon energy loss in each magnet segment.virtual photon and beam muon energy- loss v. f = lg (Pj. )o n of the laboratory muon energy re- N and considering only

Smith, W.H.

2010-01-01T23:59:59.000Z

151

Progress in Metabolic Engineering of Saccharomyces cerevisiae  

Science Journals Connector (OSTI)

...plant biomass requires chemical pretreatment, exposing...5-hydroxymethylfurfural (HMF) are sugar degradation...281). l-G3P. The platform chemicals discussed above, such...5-hydroxymethylfurfural and new chemical evidence for HMF conversion to 2,5-bis-hydroxymethylfuran...

Elke Nevoigt

2008-09-01T23:59:59.000Z

152

Engineered Surfaces to Resist Corrosion and Wear  

E-Print Network [OSTI]

MATS4007 Engineered Surfaces to Resist Corrosion and Wear Course Outline Session 2, 2014 School.................................................................................................4 Part III Corrosion and Control) LG07 Lecturer 28 Jul 1 Introduction to friction and wear JH Introduction to corrosion SC 4 Aug 2

New South Wales, University of

153

ORNL/RASA-86/67  

Office of Legacy Management (LM)

7 (LN003V) ' 2M oo -z.- OAK RIDGE NATIONAL LABORATORY RESULTS OF THE INDEPENDENT RADIOLOGICAL ' l"g ' '-'s - -*VERIFICATION SURVEY AT 61 TRUDY DRIVE, LODI, NEW JERSEY (LN003V)...

154

Unraveling the interlayer-related phonon self-energy renormalization in bilayer graphene  

E-Print Network [OSTI]

In this letter, we present a step towards understanding the bilayer graphene (2LG) interlayer (IL)-related phonon combination modes and overtones as well as their phonon self-energy renormalizations by using both gate-modulated ...

Araujo, Paulo Antonio Trinidade

155

Local?global double algebras for slow H adaptation; the case of l2 disturbances  

Science Journals Connector (OSTI)

......factorization: Gw = L/(g) Goul , where / and Gout are locally inner and locally outer in ,,, i.e. O,(ff ) e H00 is inner and (Gout ),(Gout . Moreover, | | S - S ' L . , S S......

LE YI WANG; GEORGE ZAMES

1991-01-01T23:59:59.000Z

156

E-Print Network 3.0 - azoene fast red Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

profile vs. Reference Dataset Summary: -of-fit chi-squared statistic values for the train, test, large (LgRed), medium (MdRed), and small (SmRed... level. Numbers in the Ref,...

157

E-Print Network 3.0 - anatomists Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

L.V. Mejino Jr., MD, Summary: by NIH grants LM06822 and LM06316. References 1. Rosse C, Shapiro LG, Brinkley JF. The Digital Anatomist Source: Washington at Seattle, University...

158

NETL F 451.1/1-1, Categorical Exclusion Designation Form  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

76 Case Western Reserve University FE LG Fuel Cell Systems Inc. SCCAdvanced Energy Systems Div. FY15-17 (10114 - 93017) Patcharin Burke North Canton, Ohio Long-Term...

159

DOE Headquarters Earth Day 2014 | Department of Energy  

Office of Environmental Management (EM)

DOE Headquarters Earth Day 2014 DOE Headquarters Earth Day 2014 earthday2011lg.png Save the Date - April 22, 2014 April 22, 2014, is the 44th anniversary of the founding of Earth...

160

E-Print Network 3.0 - aqueduct stenosis due Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mexico J. Medellin-Azuara a,*, L.G. Mendoza-Espinosa b Summary: aqueduct or wastewater reuse. If seawater desalination costs decrease due to longer lasting membranes... of this...

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Current Physics Information  

Science Journals Connector (OSTI)

...MARKS, R.H., MAY CONV NAT MICR AS ( 1971 ). ROBERTS, L.G., AFIPS C P 36 : 543 ( 1970 ). ZIMAN, J.M., INFORMATION, COMMUNICATION, KNOWLEDGE, NATURE 224 : 318 ( 1969 ). Current physics information. | A new concept in science...

H. William Koch

1971-11-26T23:59:59.000Z

162

Kheshbn No. 41 - April 1965 - Journal  

E-Print Network [OSTI]

ltl ur': r! $ 't lr$ ,lN'rry ,lgh -'l'N lg tt't! yt't ,yty:gr b'r.l Ff tyr l''t ''lgh DSt't ltyn ,"ty: ll? , llylyl:

Admin, LAYCC

1965-01-01T23:59:59.000Z

163

EV-13  

Office of Legacy Management (LM)

?a71 2.z' 1. lg EV-13 Notification of Xced for So?e Form of Reoedial Action, in Ikyo Ca;op., Los Alanos, New Mexico s. lkycrs, HEI-90 4 EVIXT has dctcrnincd that portions of...

164

CX-011084: Categorical Exclusion Determination | Department of...  

Broader source: Energy.gov (indexed) [DOE]

CX-011084: Categorical Exclusion Determination SECA Coal Based Systems- LG Fuel Cell Systems CX(s) Applied: B3.6 Date: 08272013 Location(s): CX: none Offices(s):...

165

CX-011083: Categorical Exclusion Determination | Department of...  

Broader source: Energy.gov (indexed) [DOE]

CX-011083: Categorical Exclusion Determination SECA Coal Based Systems- LG Fuel Cell Systems CX(s) Applied: B3.6 Date: 08272013 Location(s): Ohio Offices(s): National...

166

CX-011082: Categorical Exclusion Determination | Department of...  

Broader source: Energy.gov (indexed) [DOE]

CX-011082: Categorical Exclusion Determination SECA Coal Based Systems- LG Fuel Cell Systems CX(s) Applied: B3.6 Date: 08272013 Location(s): Ohio Offices(s): National...

167

Interpretation of high-frequency coda at large distances: stochastic modelling and method of inversion  

Science Journals Connector (OSTI)

......structure and attenuation the Lg phase, site effects, and interpretation of...W. , 1986. Yield estimates of Nevada test site explosions obtained from seismic...W., 1986. Yield estimates of Nevada test site explosions obtained from seismic......

J. Xie; O. W. Nuttli

1988-12-01T23:59:59.000Z

168

Announcements  

Science Journals Connector (OSTI)

...Murphy, Earth Sciences Branch, Office of Nuclear Regulatory Research, U. S. Nuclear Regu- latory Commision, Mail Stop 113055, Washington, D...P-coda and LG waves from underground nuclear explosions in Eurasia W. Mitronovas...

169

Program for 56th Annual Meeting, Eastern Section, Seismological Society of America-Oct. 1012 - St. Louis, MO  

Science Journals Connector (OSTI)

...Murphy, Earth Sciences Branch, Office of Nuclear Regulatory Research, U. S. Nuclear Regu- latory Commision, Mail Stop 113055, Washington, D...P-coda and LG waves from underground nuclear explosions in Eurasia W. Mitronovas...

170

Proceedings for 56th Annual Meeting, Eastern Section, Seismological Society of America-Oct. 10-12 - St. Louis, MO  

Science Journals Connector (OSTI)

...Murphy, Earth Sciences Branch, Office of Nuclear Regulatory Research, U. S. Nuclear Regu- latory Commision, Mail Stop 113055, Washington, D...P-coda and LG waves from underground nuclear explosions in Eurasia W. Mitronovas...

171

SSA annual Meeting Announcement - Austin, TX  

Science Journals Connector (OSTI)

...Murphy, Earth Sciences Branch, Office of Nuclear Regulatory Research, U. S. Nuclear Regu- latory Commision, Mail Stop 113055, Washington, D...P-coda and LG waves from underground nuclear explosions in Eurasia W. Mitronovas...

172

Abstracts for Papers Presented at the 56th Annual Meeting ESSSA  

Science Journals Connector (OSTI)

...Murphy, Earth Sciences Branch, Office of Nuclear Regulatory Research, U. S. Nuclear Regu- latory Commision, Mail Stop 113055, Washington, D...P-coda and LG waves from underground nuclear explosions in Eurasia W. Mitronovas...

173

IEEE Transactions on Consumer Electronics, Vol. 52, No. 3, AUGUST 2006 Contributed Paper  

E-Print Network [OSTI]

IEEE Transactions on Consumer Electronics, Vol. 52, No. 3, AUGUST 2006 Contributed Paper Manuscript by University IT Research Center Project and LG Electronics. The authors are with Department of Computer Science

Yeom, Ikjun

174

Personal dose analysis of TLD glow curve data from individual monitoring records  

Science Journals Connector (OSTI)

......Protection Institute, Ghana Atomic Energy Commission, PO Box LG 80...RPI) of the Ghana Atomic Energy Commission is responsible for...intercomparison exercise and quality audit organised by the International Atomic Energy Agency. In the calibration......

D. Adjei; E. O. Darko; C. Schandorf; P. Owusu-Manteaw; E. Akrobortu

2012-12-01T23:59:59.000Z

175

Factors affecting the quality of freeze-dried and compressed spinach  

E-Print Network [OSTI]

. lg56. Colorimetric method for determination of sugar and related substances. Anal. Chem. 28:350, Fairbrother, J. G. 1968. Compressed Dehydrated Foods. Rpt. No. I/68, Australian Military Forces, Food Research Station. Scottsdale, Tasmania. Fl ei...

Wisakowsky, Eugene Edward

2012-06-07T23:59:59.000Z

176

Media Conference Call Advisory: U.S. Department of Energy's Argonne  

Broader source: Energy.gov (indexed) [DOE]

Media Conference Call Advisory: U.S. Department of Energy's Argonne Media Conference Call Advisory: U.S. Department of Energy's Argonne National Laboratory, General Motors and LG Chem to discuss advanced battery material Media Conference Call Advisory: U.S. Department of Energy's Argonne National Laboratory, General Motors and LG Chem to discuss advanced battery material January 4, 2011 - 12:00am Addthis January 5, 2011 - The U.S. Department of Energy's (DOE) Argonne National Laboratory, General Motors and LG Chem plan to make an announcement about advanced lithium-ion battery technology for electrified vehicles. At 2:30 p.m., ET on Thursday, January 6, 2011, DOE Acting Under Secretary Cathy Zoi; Argonne Lab's Director Eric Issacs; GM Ventures President, Jon Lauckner; and LG Chem Power Inc.'s Mohamed Alamgir, will hold a media

177

NREL: Continuum Magazine - Not Too Hot, Not Too Cold  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Working with industry partners including GM, Ford, Chrysler, LG CPI, Johnson Controls, Saft, A123 Systems, NASA, CD-adapco, and EC Power, NREL thermal management research has led...

178

High-Power Electrochemical Storage Devices and Plug-in Hybrid...  

Broader source: Energy.gov (indexed) [DOE]

EV) 3 CPI-LG Chem Mixed Mn-Oxide Cathodes (High Power) 4 JCS (Johnson Controls - Saft) Mixed Metal-Oxide Cathodes (High Power) 5 EnerDel Li-Titanate Anodes (High Power) PHEV...

179

Re-appraisal and extension of the Gratton-Vargas two-dimensional analytical snowplow model of plasma focus evolution in the context of contemporary research  

E-Print Network [OSTI]

Recent resurgence of interest in applications of dense plasma focus and doubts about the conventional view of dense plasma focus as a purely irrotational compressive flow have re-opened questions concerning device optimization. In this context, this paper re-appraises and extends the analytical snowplow model of plasma focus sheath evolution developed by F. Gratton and J.M. Vargas (GV) (Energy Storage, Compression and Switching, Ed. V. Nardi, H. Sahlin, and W. H. Bostick, Eds., vol. 2. New York: Plenum, 1983, p. 353) and shows its relevance to contemporary research. The GV model enables construction of a special orthogonal coordinate system in which the plasma flow problem can be simplified and a model of sheath structure can be formulated. The LPP plasma focus facility, which reports neutron yield better than global scaling law, is shown to be operating closer to an optimum operating point of the GV model as compared with PF-1000.

Auluck, S K H

2013-01-01T23:59:59.000Z

180

Experimental bound on the charge radius of the electron neutrino  

Science Journals Connector (OSTI)

A limit on the electron-neutrino charge radius |r| is derived from a measurement of the weak-neutral-current vector coupling constant gV obtained in electron-neutrino electron elastic scattering. The 90%-confidence interval for gV is -0.177<gV<0.187, which for sin2?W=0.227 implies that the ?e mean-square charge radius is in the range -2.7410-32

R. C. Allen; H. H. Chen; P. J. Doe; R. Hausammann; W. P. Lee; X. -Q. Lu; H. J. Mahler; M. E. Potter; K. C. Wang; T. J. Bowles; R. L. Burman; R. D. Carlini; D. R. F. Cochran; J. S. Frank; E. Piasetzky; V. D. Sandberg; D. A. Krakauer; R. L. Talaga

1991-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

IN THE UNITED STATES DISTRICT COURT FOR THE DISTRICT OF COLUMBIA  

Broader source: Energy.gov (indexed) [DOE]

COLUMBIA COLUMBIA LG ELECTRONICS U.S.A., INC., ) ) Plaintiff, ) ) v. ) Civil Action No. 09-2297 (JDB) ) UNITED STATES DEPARTMENT OF ) ENERGY and STEVEN CHU, PHD, ) in his official capacity as United States ) Secretary of Energy, ) ) Defendants. ) ) DEFENDANTS' BRIEF IN OPPOSITION TO PLAINTIFF LG ELECTRONICS' MOTION FOR A PRELIMINARY INJUNCTION Case 1:09-cv-02297-JDB Document 10 Filed 12/23/09 Page 1 of 52 TABLE OF CONTENTS INTRODUCTION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 BACKGROUND . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 I. The ENERGY STAR Program . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

182

The Quest for Ultimate Broadband High Power Microwaves  

E-Print Network [OSTI]

Paper describes High Power Microwave research of combining GW peak power to achieve MV/m and GV/m radiated fields in 1 to 500 GHz band. To achieve such fields multiple independently triggered broadband GW sources, supplying power to multiple spatially distributed broadband radiators/antennas are used. Single TW array is used as an ultimate microwave weapon in 1 to 5 GHz range while multiple TW arrays provide GV/m radiating field at plasma frequencies in 300 GHz range leading to fusion power.

Podgorski, Andrew S

2014-01-01T23:59:59.000Z

183

Living and Fossil Macrocyprididae  

E-Print Network [OSTI]

Napoli and for the informal group Paleobenthos." The collections on R.V. Hero cruise 69-5 were made by Roger L. Kaesler (NSF GA-12472), on Hero cruise 71-5 by H. Meade Cadot (NSF GV-25157), on Anton Bruun cruises 7, 8, and 9 by Richard I-I. Benson... Napoli and for the informal group Paleobenthos." The collections on R.V. Hero cruise 69-5 were made by Roger L. Kaesler (NSF GA-12472), on Hero cruise 71-5 by H. Meade Cadot (NSF GV-25157), on Anton Bruun cruises 7, 8, and 9 by Richard I-I. Benson...

Maddocks, R. F.

1990-02-27T23:59:59.000Z

184

Comparative tests of isospin-symmetry-breaking corrections to superallowed 0(+) -> 0(+) nuclear beta decay  

E-Print Network [OSTI]

OF SUPERALLOWED BETA TRANSITIONS Superallowed Fermi beta decay between 0+ states depends uniquely on the vector part of the hadronic weak interaction. 0556-2813/2010/82(6)/065501(8) 065501-1 ?2010 The American Physical Society I. S. TOWNER AND J. C. HARDY.../(mec2)5= (8120.2787? 0.0011)? 10?10 GeV?4 s, GV is the vector coupling constant for semileptonic weak interactions, and MF is the Fermi matrix element. The CVC hypothesis asserts that the vector coupling constant GV is a true constant...

Towner, I. S.; Hardy, John C.

2010-01-01T23:59:59.000Z

185

Microsoft Word - TGD Markup 3-25-05 the end.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

G.V. Last, V, E.J. Freeman, K.J. Cantrell, M.J. Fayer, G.W. Gee, W.E. Nichols, B.N. Bjornstad, and D.G. Horton, Vadose Zone Hydrogeology Data Package for the 2004 Composite...

186

Simulations of Magnetic Shields for Spacecraft Simon G. Shepherd  

E-Print Network [OSTI]

Simulations of Magnetic Shields for Spacecraft Simon G. Shepherd Thayer School of Engineering Brian Need GV potentials!! Brehmsstrahlung radiation is potentially lethal #12;Magnetostatic Shields F=qv?B et al. 1997 a = 10 km KE = ?? eV Cst = 5 m I = "transistor radio battery" Note also that: B ~ I : B

Shepherd, Simon

187

UCGE Reports Number 20272  

E-Print Network [OSTI]

2000 (GV2000 Project). To guide policy and practice in complex situations, current research in the area of what are understood to be "best practices" in property valuation and taxation to an integrated, social towards relevant literature in allied fields, which played a critical part in the research design. My

188

Introduction Imaging Models Results 1 Results 2 Model study and comparison for the cardiac electrical  

E-Print Network [OSTI]

dV dt + Iion(V , w) = 0 d w dt = g(V , w) · V = i - e : V trans-membrane potential. · w RN TNNP Bidomain model : statement · Heart electrical activity : in H, C V t + Iion(V , w) = -div (Ge e) w

Pierre, Charles

189

KarlFranzens Universitat Graz Technische Universitat Graz  

E-Print Network [OSTI]

) v t + Iion(v, w) - div i v = Ie for a. a. (x, t) ? [ 0 , T ] ; (1.1) w t + G(v, w) = 0 for a. a. Together with appropriate specifications of the ionic current Iion and the function G within (1

Wagner, Marcus

190

PROCEDURES FOR THE APPOINTMENT AND  

E-Print Network [OSTI]

Page | 1 PROCEDURES FOR THE APPOINTMENT AND RE-APPOINTMENT OF DEANS University Policy No: GV0450 procedures define the method by which the appointment, or review and re-appointment, of deans will be conducted. SCOPE 2.00 These procedures apply to: the appointments of new deans, the review and re

Victoria, University of

191

arXiv:physics/0302084v124Feb2003 Alignment-to-orientation conversion and nuclear quadrupole resonance  

E-Print Network [OSTI]

, California 94720-1460 (Dated: February 24, 2003) The role of alignment-to-orientation conversion (AOC) in nuclear quadrupole resonance (NQR) is discussed. AOC is shown to be the mechanism responsible are drawn between NQR and AOC in atomic physics. PACS numbers: 76.60.Gv, 32.80.Bx Polarization is a generic

Budker, Dmitry

192

Physics of laser-driven plasma-based electron accelerators E. Esarey, C. B. Schroeder, and W. P. Leemans  

E-Print Network [OSTI]

Physics of laser-driven plasma-based electron accelerators E. Esarey, C. B. Schroeder, and W. P Laser-driven plasma-based accelerators, which are capable of supporting fields in excess of 100 GV/m, are reviewed. This includes the laser wakefield accelerator, the plasma beat wave accelerator, the self

Geddes, Cameron Guy Robinson

193

Ultra-High Gradient Dielectric Wakefield Accelerator Experiments  

SciTech Connect (OSTI)

Ultra-high gradient dielectric wakefield accelerators are a potential option for a linear collider afterburner since they are immune to the ion collapse and electron/positron asymmetry problems implicit in a plasma based afterburner. The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. The experiment took advantage of the unique SLAC FFTB electron beam and its ultra-short pulse lengths and high currents (e.g., {sigma}{sub z} = 20 {micro}m at Q = 3 nC). The FFTB electron beam was successfully focused down and sent through short lengths of fused silica capillary tubing (ID = 200 {micro}m/OD = 325 {micro}m). The pulse length of the electron beam was varied to produce a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments being developed for the SLAC SABER and BNL ATF we plan to use the coherent Cerenkov radiation emitted from the capillary tube as a field strength diagnostic and demonstrate GV/m range particle energy gain.

Thompson, M C; Badakov, H; Rosenzweig, J B; Travish, G; Hogan, M; Ischebeck, R; Kirby, N; Siemann, R; Walz, D; Muggli, P; Scott, A; Yoder, R

2006-08-04T23:59:59.000Z

194

Ultra-High Gradient Dielectric Wakefield Accelerator Experiments  

SciTech Connect (OSTI)

Ultra-high gradient dielectric wakefield accelerators are a potential option for a linear collider afterburner since they are immune to the ion collapse and electron/positron asymmetry problems implicit in a plasma based afterburner. The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. The experiment took advantage of the unique SLAC FFTB electron beam and its ultra-short pulse lengths and high currents (e.g., {sigma}z = 20 {mu}m at Q = 3 nC). The FFTB electron beam was successfully focused down and sent through short lengths of fused silica capillary tubing (ID = 200 {mu}m / OD = 325 {mu}m). The pulse length of the electron beam was varied to produce a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments being developed for the SLAC SABER and BNL ATF we plan to use the coherent Cerenkov radiation emitted from the capillary tube as a field strength diagnostic and demonstrate GV/m range particle energy gain.

Thompson, M. C. [Lawrence Livermore National Laboratory, Livermore, California, 90095 (United States); Badakov, H.; Rosenzweig, J. B.; Travis, G. [UCLA Department of Physics and Astronomy, Los Angeles, California, 90095 (United States); Hogan, M.; Ischebeck, R.; Kirby, N.; Siemann, R.; Walz, D. [Stanford Linear Accelerator Center, Stanford, California, 94309 (United States); Muggli, P. [University of Southern California Los Angeles, California, 90089 (United States); Scott, A. [UCSB Department of Physics, Santa Barbara, California, 93106 (United States); Yoder, R. [Manhattan College, Riverdale, New York, 10471 (United States)

2006-11-27T23:59:59.000Z

195

ccsd00000540 Production of Long-Lived Ultracold Li 2 Molecules from a Fermi gas  

E-Print Network [OSTI]

and sign of the scattering length. In bosonic samples, the collapse of Bose-Einstein condensates (BEC a Fermi gas J. Cubizolles 1 , T. Bourdel 1 , S. J. J. M. F. Kokkelmans 1 , G.V. Shlyapnikov 1;2;3 and C-bound Li2 molecules from a degenerate two component Fermi gas by sweeping a magnetic #12;eld across

196

Presence of an Unusual Methanogenic Bacterium in Coal Gasification Waste  

Science Journals Connector (OSTI)

...stoppered bottle and degassing the media at least three times with 80% N2-20% CO2. The media were then reduced with the...using 0.22-p,m- pore-size Millex-GV filter units...autoclave. By equilibrating the media with 0.4 atm (ca. 40...

Francisco A. Tomei; Dwight Rouse; James S. Maki; Ralph Mitchell

1988-12-01T23:59:59.000Z

197

Interactions in Syntrophic Associations of Endospore-Forming, Butyrate-Degrading Bacteria and H2-Consuming Bacteria  

Science Journals Connector (OSTI)

...previously degassed with N2. The media were prepared by mixing all...with 80% N2-20% CO2. The medium was then reduced and dispensed...Millex-GV filter units (pore size, 0.22 ,um; Millipore Corp...sterilized in the autoclave. The medium equilibrated to a pH of 6...

Francisco A. Tomei; James S. Maki; Ralph Mitchell

1985-11-01T23:59:59.000Z

198

Wyoming Water Resources Research Centter Annual Technical Report  

E-Print Network [OSTI]

: Not Applicable Focus Category: Models, Surface Water, None Descriptors: Channel Erosion, Coal Bed Methane, Stable Operators Group Meeting, Casper, WY. #12;Problem and Research Objectives: Coal bed methane (CBM) development. Wilkerson, G.V., J.C. Baxter, J.H. Johnson, and J. Montgomery, Aug 2000. Presentation at the Methane

199

Rainfall-induced carbon dioxide pulses result from sequential resuscitation of phylogenetically clustered microbial groups  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 29 Mukamolova GV Kaprelyants AS Young DI Young M Kell DB ( 1998 ) A bacterial cytokine . Proc Natl Acad Sci USA...

Sarah A. Placella; Eoin L. Brodie; Mary K. Firestone

2012-01-01T23:59:59.000Z

200

The effect of fast and slow motor unit activation on whole-muscle mechanical performance: the size principle may not pose a mechanical paradox  

Science Journals Connector (OSTI)

...thus consuming metabolic energy without significantly...cost, increasing the energy consumed to complete...on initial mechanical efficiency of mouse soleus muscles...distribution within a pool of 300 homonymous motoneurons...GV Lauder. 1994 How swimming fish use slow and fast...

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Proceedings of the 1st Annual Gas Processing Symposium  

E-Print Network [OSTI]

pretreatment units, a gas-fired power plant, a CO2 separation unit and storage tanks. LNG and condensateProceedings of the 1st Annual Gas Processing Symposium H. Alfadala, G.V. Rex Reklaitis and M.M. El. An example of the latter arises if part of the gas output from the separation plant is fed back

Foss, Bjarne A.

202

Gamma-ray lines observed in balloon flights at high rigidity  

Science Journals Connector (OSTI)

Gamma-ray lines at 0.511 MeV and 1.632 MeV have been observed at high rigidity (12.5 GV), and up to 4 g cm?2, during stratospheric balloon flights launched from So Jos dos Campos,...

N. A. Buivan; K. R. Rao; I. M. Martin

203

Publications: 1. N.V. Avramenko, A.L. Mirakyan, M.V. Korobov, E.B. Stukalin, Thermochemistry of  

E-Print Network [OSTI]

, E.B. Stukalin, N.I. Ivanova, N.V. Avramenko, G.V. Andrievsky, DSC study of C60 ­ water system, A.B. Kolomeisky. Coupling of two motor proteins: a new motor can move faster, Phys. Rev. Lett., 94

204

On a theory of search  

Science Journals Connector (OSTI)

......we find that (3-17) can thus be written - [+T f"flf{( a + Af)*} ifc[{(t> - )* + (Ax - A)*}*] d&i c2u. (3-18) i r J -r JO This integral equation along with the boundary conditions g(v) = 0, v =% 2randgr(2r) = k......

J. E. PALOHEIMO

1971-04-01T23:59:59.000Z

205

Proceedings of DETC'03 ASME 2003 Design Engineering Technical Conferences and  

E-Print Network [OSTI]

C cost CH powertrain hybridization cost per unit Cp cost of unit production D diesel fuel price D "normal" level of diesel fuel price fe fuel economy ge vector of enterprise inequality constraints gv volatility of diesel fuel price t monthly period R v tolerance variable for system responses y v tolerance

Papalambros, Panos

206

To appear in International Journal of Hydrogen Energy 1 Sustainable Convergence of Electricity and Transport Sectors in the  

E-Print Network [OSTI]

grid investments such as new power generation installations. Keywords: Hydrogen economy, fuel cell sector based on fuel cell vehicles (FCVs). A comprehensive robust optimization planning model AFV Alternative-Fuel Vehicle. FCV Fuel Cell Vehicle. GV Gasoline Vehicle. HHV Higher Heating Value

Cañizares, Claudio A.

207

Management and monitoring of public buildings through ICT based systems: control rules for energy saving of lighting , J. Virgone2  

E-Print Network [OSTI]

for energy saving of lighting and HVAC Authors C. Aghemo1 , J. Virgone2 , G.V. Fracastoro1 , A. Pellegrino1 strategies to reduce energy consumptions for lighting and air conditioning, are presented. Keywords: energy *, L. Blaso1 , J. Savoyat2 and Kevyn Johannes2 Affiliation 1 Politecnico di Torino, Energy Department

Paris-Sud XI, Université de

208

Physiochemical disparity of mismatched HLA class I alloantigens and risk of acute graft-versus-host disease  

E-Print Network [OSTI]

Leukocyte Infusion (DLI), relapse or second HSCT within 100 days after 94 HSCT and at 100 days after HSCT. Death without ? grade II aGvHD within 100 days after HSCT was 95 treated as a competing risk. Secondary outcomes in the HSCT analysis were incidence...

Kosmoliaptsis, V.; Jris, M. M.; Mallon, D. H.; Lankester, A. C.; von dem Borne, P. A.; Kuball, J.; Bierings, M.; Cornelissen, J. J.; GroenendijkSijnke, M. E.; van der Holt, B.; Bradley, J. A.; Oudshoorn, M.; van Rood, Jon J.; Taylor, C. J.; Claas, F. H. J.

2015-01-26T23:59:59.000Z

209

Myxoma Virus Is a Novel Oncolytic Virus with Significant Antitumor Activity against Experimental Human Gliomas  

Science Journals Connector (OSTI)

...myxoma virus [review]. Viral Immunol 2002;15:229-46. 28 Fenner F, Ross J. Myxomatosis. In: Thompson GV, King CM, editors...presence of interferon. Virology 1963;19:294-301. 41 Fenner F, Ratcliffe FN. Myxomatosis. Cambridge (UK): Cambridge...

Xueqing Lun; Wenqing Yang; Tommy Alain; Zhong-Qiao Shi; Huong Muzik; John W. Barrett; Grant McFadden; John Bell; Mark G. Hamilton; Donna L. Senger; Peter A. Forsyth

2005-11-01T23:59:59.000Z

210

Characterization of light gluten and light steep water from a corn wet milling plant  

Science Journals Connector (OSTI)

The primary commodity of corn wet milling is starch, but two coproducts (corn gluten feed, CGF and corn gluten meal, CGM) also are produced. CGM and CGF are marketed as animal foodstuffs and are important economically; however, variation in composition reduces quality. There are few data on the effect of composition of the parent process streams, light steep water (LSW) and light gluten (LG), respectively, on composition of CGF and CGM. The objective was to characterize LG and LSW. Samples of LG and LSW were collected: (1) hourly for one day, (2) every 3 h for 3 days, and (3) daily for 3 weeks. Dry matter, N and ash were determined. Variation in composition of LG and LSW was greatest during longer periods of time (days and weeks) rather than shorter (hourly or every 3 h). There was significant variation in DM (solids) content, which directly affected the concentration of other components. Variation in N (protein) of LG and LSW accounted for much of the variation in CGF and CG. Processes that modify processing and reduce variation could increase the quality of CGF and CGM.

K.D Rausch; C.I Thompson; R.L Belyea; M.E Tumbleson

2003-01-01T23:59:59.000Z

211

Albany, OR * Anchorage, AK * Morgantown, WV * Pittsburgh, PA * Sugar Land, TX  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Model Development-LG Fuel Model Development-LG Fuel Cell Systems Background In this congressionally directed project, LG Fuel Cell Systems Inc. (LGFCS), formerly known as Rolls-Royce Fuel Cell Systems (US) Inc., is developing a solid oxide fuel cell (SOFC) multi-physics code (MPC) for performance calculations of their fuel cell structure to support product design and development. The MPC is based in the computational fluid dynamics software package STAR-CCM+ (from CD-adapco) which has been enhanced with new models that allow for coupled simulations of fluid flow, porous flow, heat transfer, chemical, electrochemical and current flow processes in SOFCs. Simulations of single cell, five-cell, substrate and bundle models have been successfully validated against experimental data obtained by LGFCS. The MPC is being

212

Special Report: OAS-RA-13-10 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

3-10 3-10 Special Report: OAS-RA-13-10 February 8, 2013 The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc The Department of Energy's Vehicle Technologies Program was established to develop and deploy efficient and environmentally friendly highway transportation technologies to reduce the Nation's dependence on foreign oil and provide greater energy security. The Vehicle Technologies Program received $2.4 billion under the American Recovery and Reinvestment Act of 2009 (Recovery Act) for these purposes. In February 2010, LG Chem Michigan Inc. (LG Chem Michigan), formerly Compact Power, Inc., was awarded more than $150 million in Recovery Act funding to help construct a $304 million battery cell manufacturing plant in Holland, Michigan. On October

213

Measurement of pH. Definition, Standards, and Procedures  

E-Print Network [OSTI]

of the Nernst equation to the HCl cell Pt | H2 | HCl(m) | AgCl | Ag Cell Ia gives EIa = E [(2RT/F)ln 10] lg[(mHCl/m)(?HCl)] (3) where EIa has been corrected to 1 atmosphere partial pressure of hydrogen gas (101.325 kPa) and ?HCl is the mean ionic activity... In NMIs, measurements of Cells I and Ia are often done simultaneously in a thermostat bath. Subtracting eq. 3 from eq. 2 gives ?E = EI EIa = ?[(RT/F)ln 10]{lg[(mH?H/m)(mCl?Cl/m)] ? lg[(mHCl/m)2? 2HCl]}, (4) which is independent of the standard...

Wilson, George S.; Buck, R. P.; Rondinini, S.; Covington, A. K.; Baucke, F. G. K.; Brett, C. M. A.; Camõ es, M. F.; Milton, M. J. T.; Mussini, T.; Naumann, R.; Pratt, K. W.; Spitzer, P.

2002-01-01T23:59:59.000Z

214

Universitt Hannover Studierendenstatistik WS 2001/2002 Seite 1 von 9 Studiengang Abschlu-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

LG 50 30 3 36 2 21 43 4 36 60 285 140 2 LR 1 8 2 5 17 33 17 2 LGH 5 1 2 8 4 2 LGHR HR 13 7 5 2 5 1 1. 3 3 3 3 LG 45 21 2 21 15 2 9 17 23 155 76 1 LR 1 3 2 4 10 6 1 LGH 1 1 0 0 LGHR HR 6 2 2 2 1 1 14 8 2 427 23 (Erdkunde) LG 8 12 2 8 3 7 1 10 2 3 7 63 32 1 LR 2 5 2 5 8 22 10 LGH 1 1 0 LGHR HR 5 5 4 1 1 16

Vollmer, Heribert

215

Hollow screw like drill in plasma using an intense Laguerre Gaussian laser  

E-Print Network [OSTI]

With the development of ultra intense laser technology, MeV ions from the laser foil interaction have been obtained by different mechanisms, such as target normal sheath acceleration, radiation pressure acceleration, collisionless shock acceleration, breakout afterburner, and a combination of different mechanisms. These energetic ion beams can be applied in fast ignition for inertial confinement fusion, medical therapy, and proton imaging. However, these ions are mainly accelerated in the laser propagation direction, and the ion acceleration in an azimuthal orientation is scarcely mentioned. Here, a doughnut Laguerre Gaussian LG laser is used for the first time to study the laser plasma interaction in the relativistic intensity regime in three dimensional particle in cell simulations. Studies have shown that a novel rotation of the plasma is produced from the hollow screw like drill of a LG mode laser. The angular momentum of the protons in the longitudinal direction produced by the LG laser is remarkably enh...

Wang, Wenpeng; Zhang, Xiaomei; Zhang, Lingang; Shi, Yin; Xu, Zhizhan

2014-01-01T23:59:59.000Z

216

Gas Storage Technology Consortium  

SciTech Connect (OSTI)

Gas storage is a critical element in the natural gas industry. Producers, transmission and distribution companies, marketers, and end users all benefit directly from the load balancing function of storage. The unbundling process has fundamentally changed the way storage is used and valued. As an unbundled service, the value of storage is being recovered at rates that reflect its value. Moreover, the marketplace has differentiated between various types of storage services and has increasingly rewarded flexibility, safety, and reliability. The size of the natural gas market has increased and is projected to continue to increase towards 30 trillion cubic feet (TCF) over the next 10 to 15 years. Much of this increase is projected to come from electric generation, particularly peaking units. Gas storage, particularly the flexible services that are most suited to electric loads, is crucial in meeting the needs of these new markets. To address the gas storage needs of the natural gas industry, an industry-driven consortium was created - the Gas Storage Technology Consortium (GSTC). The objective of the GSTC is to provide a means to accomplish industry-driven research and development designed to enhance the operational flexibility and deliverability of the nation's gas storage system, and provide a cost-effective, safe, and reliable supply of natural gas to meet domestic demand. This report addresses the activities for the quarterly period of January1, 2007 through March 31, 2007. Key activities during this time period included: {lg_bullet} Drafting and distributing the 2007 RFP; {lg_bullet} Identifying and securing a meeting site for the GSTC 2007 Spring Proposal Meeting; {lg_bullet} Scheduling and participating in two (2) project mentoring conference calls; {lg_bullet} Conducting elections for four Executive Council seats; {lg_bullet} Collecting and compiling the 2005 GSTC Final Project Reports; and {lg_bullet} Outreach and communications.

Joel L. Morrison; Sharon L. Elder

2007-03-31T23:59:59.000Z

217

192 No. 95 Zhang Inferring a Species Tree from Gene Trees under the  

E-Print Network [OSTI]

of s and s is defined to be the smallest node s S such that s , s s, which is denoted by lca(s , s ). For any node g G, we define M(g) as M(g) = g, g L(G) lca(M(a(g)), M(b(g))), g L(G). This correspondence M will be called the lca mapping from G to S. Under the lca mapping M from G to S, if a species branch e

Zhang, Louxin

218

DOE Review  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Review 2007 Review 2007 AWA Facility Update, High Gradient Wakefield Generation, and Future Upgrades Manoel Conde, Sergey Antipov, Felipe Franchini, Wei Gai, Feng Gao, Chunguang Jing, Richard Konecny, Wanming Liu, Jidong Long, John Power, Haitao Wang, Zikri Yusof Argonne Wakefield Accelerator Group High Energy Physics Division April 25 - 27, 2007 2 Outline Description of AWA Facililty. Wakefield structures built and tested. Measurements and simulations. List of next experiments to be performed. Plans for Facility upgrades. 3 AWA Drive Beamline Drive Gun Linac & Steering Coils Quads Wakefield Structure Experimental Chambers 4.5 m GV GV YAG1 YAG2 Spectrometer YAG5 Dump/ Faraday Cup Slits YAG4 YAG3 ICT1 ICT2 BPM Single bunch operation - Q=1-100 nC - Energy=15 MeV - High Current = 10 kAmp

219

The effects of cold water injection and two-phase flow on skin factor and permeability estimates from pressure falloff analysis  

E-Print Network [OSTI]

and underburden. Governin E uations Oil phase: K K 8 (cnf) (vP -P gvD + O =+t )8, (I) 0 Water phase: K K 8 v ~ (cnf rw w(vP -P gvD) + O = ? t (y8 S ) (2) w Energy: v K vT - v v 8 P H + v 8 P H + Oh = w w w w f f a The following relations are also...-phase high viscosity runs (Table 7). Series 3 has I-day injection period and 0. 8 days falloff. Each series contains four different runs. Run I is an isothermal run, and Runs 2, 3 and 4 have 175, 100 and 50 F injection temperatures, respectively. Table 9...

Linge, Frode

2012-06-07T23:59:59.000Z

220

Silicon buried gratings for dielectric laser electron accelerators  

SciTech Connect (OSTI)

This paper describes design and simulations of dielectric laser electron accelerators that achieve Gigavolt-per-meter (GV/m) accelerating gradients and wide electron channels (>1??m). The accelerator design is based on a silicon buried grating structure that enables flexible phase synchronization, large electron channel fields, and low standing-wave ratio in the material. This design increases the accelerating gradients to more than double those of reported quartz grating accelerators, thereby reducing the input laser fluence by 60% for the same accelerating gradient. With a 100 fs pulsed laser, our silicon buried gratings can achieve a maximum gradient of 1.1 GV/m, indicating that these accelerators have potential for numerous electron-accelerator applications.

Chang, Chia-Ming, E-mail: cachang@alumni.stanford.edu [Bell Labs, Alcatel-Lucent, 791 Holmdel Road, Holmdel, New Jersey 07733 (United States); Solgaard, Olav [E. L. Ginzton Lab., Stanford University, Stanford, California 94305 (United States)

2014-05-05T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

USAID Europe and Eurasia Climate Program | Open Energy Information  

Open Energy Info (EERE)

and Eurasia Climate Program and Eurasia Climate Program Jump to: navigation, search Name USAID Europe and Eurasia Climate Program Agency/Company /Organization U.S. Agency for International Development Sector Energy, Land Focus Area Energy Efficiency, Renewable Energy Topics Policies/deployment programs, Background analysis Website http://www.usaid.gov/our_work/ Country Armenia, Republic of Macedonia, Russia, Ukraine, Poland, Kazakhstan, Hungary, Turkey, Uzbekistan, Turkmenistan, Lithuania, Estonia, Latvia, Azerbaijan, Tajikistan Western Asia, Southern Europe, Eastern Europe, Eastern Europe, Eastern Europe, Central Asia, Eastern Europe, Western Asia, Central Asia, Central Asia, Northern Europe, Northern Europe, Northern Europe, Western Asia, Central Asia References USAID Regional Climate Programs[1]

222

User:GregZiebold/Program Maps | Open Energy Information  

Open Energy Info (EERE)

Maps Maps < User:GregZiebold Jump to: navigation, search Place Coordinates A Low Carbon Economic Strategy for Scotland United Kingdom A Strategy to Engage the Private Sector in Climate Change Adaptation in Bangladesh Bangladesh A Synthesis of Agricultural Policies in Bangladesh Bangladesh ANL Wind Power Forecasting and Electricity Markets ASEAN-GIZ Regional Environmentally Sustainable Cities Programme - RESCP Brunei Cambodia Indonesia Laos Malaysia Myanmar Philippines Singapore Thailand Vietnam ASEAN-IEA Activities Indonesia Malaysia Singapore Thailand Philippines Vietnam Brunei Myanmar Cambodia Laos Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) Belgium Bulgaria Czech Republic Denmark Germany Estonia Ireland Greece Spain France Italy Cyprus Latvia Lithuania

223

Industry turns its attention south  

SciTech Connect (OSTI)

The paper discusses the outlook for the gas and oil industries in the Former Soviet Union and Eastern Europe. Significant foreign investment continues to elude Russia`s oil and gas industry, so the Caspian nations of Kazakhstan and Azerbaijan are picking up the slack, welcoming the flow of foreign capital to their energy projects. Separate evaluations are given for Russia, Azerbaijan, Kazakhstan, Turkmenistan, Ukraine, Armenia, Belarus, Georgia, Lithuania, Latvia, Estonia, Moldova, Tajikstan, Uzbekistan, Albania, Bulgaria, Croatia, Czech Republic, Hungary, Poland, Romania, Slovakia, Slovenia, and Serbia.

Marhefka, D. [Russian Petroleum Investor, Moscow (Russian Federation)

1997-08-01T23:59:59.000Z

224

Presidentialism, Parliamentarism, and Democracy Reconsidered  

E-Print Network [OSTI]

through regular elections and guarantee civil liberties, thereby reducing political violence (Kitschelt 1986). Within a similar line of studies, scholars note that resources are essential to sustain and mobilize violent activities (Dalton, Sickle... Violence Albania 1998 999 1.41 Latvia 1996 1200 1.81 Argentina* 1995 1079 1.68 Lithuania 1997 1009 1.82 Armenia 1997 2000 1.85 Macedonia 1998 995 1.67 Australia 1995 2048 1.63 Moldova 1996 984 2.13 Bangladesh 1996 1525 1.13 New Zealand 1998 1201 1.60 Brazil...

Yeh, Yao-Yuan

2014-06-26T23:59:59.000Z

225

The Cost of Improving Gas Supply Security in the Baltic States  

E-Print Network [OSTI]

to replace a failed compressor station on a transmission pipeline; 12 most disruptions caused by pipeline failures could be repaired in a week or less. A failure of the Latvian underground storage could potentially disrupt supply to Estonia and Latvia... at In?ukalns. Suppliers must store at least 10 days worth of household consumption beginning 1st September 2008, rising by 10 days each year until a 60 day level is reached (REPUBLIC OF LITHUANIA, 2008). The capacity of the pipeline connection between...

Noel, Pierre; Findlater, Sachi; Chyong, Chi Kong

2012-01-23T23:59:59.000Z

226

Photonic laser-driven accelerator for GALAXIE  

SciTech Connect (OSTI)

We report on the design and development of an all-dielectric laser-driven accelerator to be used in the GALAXIE (GV-per-meter Acce Lerator And X-ray-source Integrated Experiment) project's compact free-electron laser. The approach of our working design is to construct eigenmodes, borrowing from the field of photonics, which yield the appropriate, highly demanding dynamics in a high-field, short wavelength accelerator. Topics discussed include transverse focusing, power coupling, bunching, and fabrication.

Naranjo, B.; Ho, M.; Hoang, P.; Putterman, S.; Valloni, A.; Rosenzweig, J. B. [UCLA Dept. of Physics and Astronomy Los Angeles, CA 90095-1547 (United States)

2012-12-21T23:59:59.000Z

227

Tunable Radiation Source by Coupling Laser-Plasma-Generated Electrons to a Periodic Structure  

SciTech Connect (OSTI)

Near-infrared radiation around 1000 nm generated from the interaction of a high-density MeV electron beam, obtained by impinging an intense ultrashort laser pulse on a solid target, with a metal grating is observed experimentally. Theoretical modeling and particle-in-cell simulation suggest that the radiation is caused by the Smith-Purcell mechanism. The results here indicate that tunable terahertz radiation with tens GV/m field strength can be achieved by using appropriate grating parameters.

Jin, Z. [Photon Pioneers Center, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Chen, Z. L.; Kon, A.; Nakatsutsumi, M. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Zhuo, H. B. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); School of Science, National University of Defense Technology, Changsha 410073 (China); Wang, H. B.; Zhang, B. H.; Gu, Y. Q.; Wu, Y. C.; Zhu, B.; Wang, L. [National Key Laboratory of Laser Fusion, CAEP, Mianyang 621900 (China); Yu, M. Y. [Institute for Fusion Theory and Simulation, Zhejiang University, Hangzhou 310027 (China); Institute for Theoretical Physics I, Ruhr University, Bochum D-44780 (Germany); Sheng, Z. M. [Key Laboratory for Laser Plasmas (Ministry of Education) and Department of Physics, Shanghai Jiao Tong University, Shanghai 200240 (China); Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, CAS, Beijing 100080 (China); Kodama, R. [Photon Pioneers Center, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Institute of Laser Engineering, Osaka University, 2-6 Yamada-oka, Suita, Osaka, 565-0871 (Japan)

2011-12-23T23:59:59.000Z

228

Widespread Head-to-Head Hydrocarbon Biosynthesis in Bacteria and Role of OleA  

Science Journals Connector (OSTI)

...isolated from the Amazon River Delta off the coast of Brazil (69), contains recognizable ole genes. It produced...supported by grant LG-B13 from the Initiative for Renewable Energy and the Environment (to L.P.W.) and a Watson...

David J. Sukovich; Jennifer L. Seffernick; Jack E. Richman; Jeffrey A. Gralnick; Lawrence P. Wackett

2010-04-23T23:59:59.000Z

229

,fv\\/Li."YL-14UD TANK OPENING FEBRUARY 2nd, 1976 -No.I.  

E-Print Network [OSTI]

remaining\\dthout them; hence the entire column now has stringer5. Black dust in the vicinity of the coupling; the wrecked one was replaced.- TheNEC ionizer was taken out of the pump permanently as. it has not been lJustlngdev:LG~SW~r~/mqdeandgltt.cd, below the'n}magnet itself and the top

Chen, Ying

230

Adrenal and ovarian function in nutritionally-restricted or Acacia berlandieri-fed Angora goats  

E-Print Network [OSTI]

and adrenal function. Diets consisted of: 1) 3.6% BW of a pelleted (HC, n=9); 2) 2% BW of the some diet (LC, n=9); 3) diet 2 with ad-lib guajillo (HG, n=10); or 4) 1% BW of the diet with ad-lib guajillo (LG, n=10). Intake of guajillo was measured daily...

Livingston, Kimberly Nicole

1999-01-01T23:59:59.000Z

231

The effect of intramuscular and subcutaneous fat on the microbiological and sensory characteristics of pork loin chops  

E-Print Network [OSTI]

i c = H~iignccits, 8 ac= 8ggll~, M/A= 80cgg~-halite~~, Cor y n= Cor y nef orm ha c t er i a, Cy t=Cyj itphgga, B. th= 8. DiigraiiLaphgaiua, L. het= heterof ermenta tiv e Lg~hmgil~, L. hom=homofermentative LanhahgclLLits, S. liq=8. c...

Boxer, Mara Kaye

2012-06-07T23:59:59.000Z

232

Notes: A note on collections of graphs with non-surjective lambda labelings  

Science Journals Connector (OSTI)

The @l-number of a graph G, denoted @l(G), is the smallest integer k such that there exists a function from V(G) into {0,1,2,...,k} under which adjacent vertices receive integers which differ by at least 2 and vertices at distance two receive integers ... Keywords: ?-Labeling, ?-Number, 05C, L(2,1)-Labeling, Surjective

John P. Georges; David W. Mauro

2005-02-01T23:59:59.000Z

233

Nidogens are therapeutic targets for the prevention of tetanus  

Science Journals Connector (OSTI)

...Cologne and the Koln Fortune Programm (R.N.). L.G. is the Graham Watts Senior Research Fellow, supported by the Brain Research Trust. The data presented in this manuscript are found in the main paper and the supplementary data and materials...

Kinga Bercsenyi; Nathalie Schmieg; J. Barney Bryson; Martin Wallace; Paola Caccin; Matthew Golding; Giuseppe Zanotti; Linda Greensmith; Roswitha Nischt; Giampietro Schiavo

2014-11-28T23:59:59.000Z

234

BRAF Inhibition Increases Tumor Infiltration by T cells and Enhances the Antitumor Activity of Adoptive Immunotherapy in Mice  

Science Journals Connector (OSTI)

...1 3 Laszlo G. Radvanyi 1 Willem W. Overwijk 1 Gregory Lizee 1 Patrick Hwu 1 Corresponding...Xu, M. Zhang, H.S. Li, W.W. Overwijk, P. Hwu Acquisition of data (provided...Davies, L.G. Radvanyi, W.W. Overwijk, G. Lizee, P. Hwu Administrative...

Chengwen Liu; Weiyi Peng; Chunyu Xu; Yanyan Lou; Minying Zhang; Jennifer A. Wargo; Jie Qing Chen; Haiyan S. Li; Stephanie S. Watowich; Yan Yang; Dennie Tompers Frederick; Zachary A. Cooper; Rina M. Mbofung; Mayra Whittington; Keith T. Flaherty; Scott E. Woodman; Michael A. Davies; Laszlo G. Radvanyi; Willem W. Overwijk; Gregory Lize; Patrick Hwu

2013-01-15T23:59:59.000Z

235

Isolation and effects of citrus limonoids on cytochrome p450 inhibition, apoptotic induction and cytotoxicity on human cancer cells.  

E-Print Network [OSTI]

(deacetylnomilinic acid 17beta-D glucopyranoside), have shown superoxide scavenging at millimolar levels. Micromolar amounts of LG and OG induced rapid necrosis of SH-SY5Y cells. Cytotoxicity was correlated (P = 0.046) to a concentration and timedependent increase...

Poulose, Shibu M.

2007-04-25T23:59:59.000Z

236

Characterization of Human Anti-High Molecular Weight-Melanoma-associated Antigen Single-Chain Fv Fragments Isolated from a Phage Display Antibody Library  

Science Journals Connector (OSTI)

...from a Phage Display Antibody Library 1 1 This work was supported...isolated by panning synthetic scFv library 1 on purified HMW-MAA. Colony...nl aliquot of the phage library to a suspension of LG-2 cells...harvested from the periplas- mic space (periplasmic preparation...

Smruti A. Desai; Xinhui Wang; Elvyra J. Noronha; Toshiro Kageshita; and Soldano Ferrone

1998-06-01T23:59:59.000Z

237

An explanation for enhanced perceptions of attractiveness after alcohol consumption  

E-Print Network [OSTI]

An explanation for enhanced perceptions of attractiveness after alcohol consumption L.G. Halseya alcohol consumption increases ratings of attractiveness to faces. This may help to explain increased attraction may be the result of alcohol consumption decreasing ability to detect bilateral asymmetry

Little, Tony

238

Seabed Mlinerals and the Law of the Sea  

Science Journals Connector (OSTI)

...MINERAL SUPPLI 221 ( 1976 ). WEEKS, L.G., GEOL CONTINENTAL...present and future production. Weeks (4) esti-mated the subsea...for such metal-rich nodules liks in the northeastern equatorial...Ieasing (1979). 4. L. G. Weeks, in Geology of Continental...

V. E. McKelvey

1980-07-25T23:59:59.000Z

239

Vehicle Technologies Office Merit Review 2013: A High-Performance PHEV Battery Pack  

Broader source: Energy.gov [DOE]

Presentation given by LG Chem at 2013 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting about a high-performance battery pack the company is researching for plug-in electric vehicles.

240

A New Boson with a Mass of 125 GeV Observed with the CMS Experiment at the Large Hadron Collider  

Science Journals Connector (OSTI)

...Demiragli A. Demiyanov L. Demortier D. Denegri G. Denis M. Deniz D. D'Enterria L.G. Denton P. Depasse A. Dermenev V. Dero G...Science and Technology and the World Class University program of NRF, Republic of Korea; the Lithuanian Academy of Sciences; the...

The CMS Collaboration

2012-12-21T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Prerequisites: Control Systems I+II, System Modeling, Engine Class (Introduction to Modeling and Control of  

E-Print Network [OSTI]

Thesis IDSC-LG-FZ-05 Gas Diesel Engine Modeling and Control The gas diesel engine is a natural gas enginePrerequisites: Control Systems I+II, System Modeling, Engine Class (Introduction to Modeling and Control of Internal Combustion Engine Systems, IC Engines, ...), Optimization Course, Matlab

Lygeros, John

242

Atmos. Chem. Phys., 14, 86798699, 2014 www.atmos-chem-phys.net/14/8679/2014/  

E-Print Network [OSTI]

in winter and agricultural waste burning dominating in autumn. Excessive Fe (Ex-Fe), defined (OC), element carbon (EC), trace elements to biomass burning tracers, anhydro- sugar levoglucosan (LG of 119 �g m-3. Mineral soil concentra- tions increased in spring, whereas biomass burning species

Pierce, Jeffrey

243

Asymmetric electrical properties of fork a-Si:H thin-film transistor and its application to flat panel displays  

E-Print Network [OSTI]

of Electrical Engineering and Computer Science, The University of Michigan, Ann Arbor, Michigan 48109, USA 2 LG-effect hydrogen- ated amorphous silicon a-Si:H solar cells to enhance out- put power.6 In an a-Si:H TFT, one pair

Kanicki, Jerzy

244

Origin of Martian Channels: Clathrates and Water  

Science Journals Connector (OSTI)

...ineffective to control behavior in auditory-LG...pre-empt control of behavior whether in conflict...interfere with ongoing behavior, and then reducing...model 2620). Phase locking of peripheral...de-pressurization of CO2 hydrate, which could exist...quartzose temper sands in prehistoric pottery...

S. J. Peale; G. Schubert; R. E. Lingenfelter

1975-01-24T23:59:59.000Z

245

Author's personal copy Broadband flow-induced sound control using plasma actuators  

E-Print Network [OSTI]

ionization the plasma actuators generate weakly ionized atmospheric plasma that consists of charged particlesAuthor's personal copy Broadband flow-induced sound control using plasma actuators Xun Huang a Editor: L.G. Tham Available online 9 February 2010 a b s t r a c t Plasma actuators were used

Huang, Xun

246

Biogenesis of the Saccharomyces cerevisiae Pheromone a-Factor, from Yeast Mating to Human Disease  

Science Journals Connector (OSTI)

...269). This comes at some cost, as cells must express unique...roles they play in cell fusion, nuclear fusion, and/or nuclear migration...1017-1026. 73. Davies, BS , LG Fong, SH Yang, C Coffinier...Lamina-independent lamins in the nuclear interior serve important functions...

Susan Michaelis; Jemima Barrowman

2012-09-01T23:59:59.000Z

247

Open and Association MCTAs Access and Allocation Scheme by Staggering Algorithm  

E-Print Network [OSTI]

.15.3 Eui-Seok Hwang1 , You-Chang Ko2 , Choong-Ho Cho3 , Hyong-Woo Lee4 , and Sumit Roy1 1 Univ. of Washington Dept. of Electrical Engineering {eui, roy}@ee.washington.edu 2 LG Electronics Inc. Mobile Handset

Roy, Sumit

248

Tests for tissue residues of hormone-like substances fed for improvement of weight gains and market quality of poultry  

E-Print Network [OSTI]

(~as~ lg~&g J. "n~"~ lgh2). Infect af khiaarccil~ o ~ e ' . "ra~~ en . m'. at 4g cnd ~citron of Wturc geo~ Carcce . ". . zLt ~Ai s The fcedin? of dicnestrol Qccoteta h~ t e lity of cat~o raasters (Tc&lo 3). 2his irprav~t of ~mt ~~" i. =s ~parent...

Lane, Richard P

2012-06-07T23:59:59.000Z

249

Pharmacodynamic interaction between RP 59500 and gram-positive bacteria infecting fibrin clots.  

Science Journals Connector (OSTI)

...was lower than the MIC of the antibiotic for this pathogen. In the present experiments, concentrations in plasma did not ex- ceed 100 pLg/ml and the saturable protein binding at a concentration of 250 ,g/ml that we have observed did not influence penetration...

A Turcotte; M G Bergeron

1992-10-01T23:59:59.000Z

250

Colostral immunoglobulins and their absorption by newborn beef calves  

E-Print Network [OSTI]

produced more (P<.001) colostrum of lower (P<.02) density than compared to A cows. Total Ig (P<.003), IgG (P<.008) and IgA (P<.006) cmntrabons were affected by interactions of Sire x Dam and Total lg (P<.02) and 0 (P<.008) were affected by Sex x Sire x Dam...

Vann, Rhonda Carol

2012-06-07T23:59:59.000Z

251

RVERSIBILIT ET IRRVERSIBILIT EN RSONANCE NUCLAIRE THORIE DE LA RELAXATION NUCLAIRE DANS LES LIQUIDES  

E-Print Network [OSTI]

d6duire de 1'6quation de Schrodinger les equations « irréversibles par rapport au temps » qui qui satisfont a la relation (m'l V.L4 Vim) = 8(Em, - Em) fA(m) + (m'lg(A) 1m) (6) (ou A est un op6

Paris-Sud XI, Université de

252

DISPLAY WEEK 2012 REVIEW ISSUE Official Monthly Publication of the Society for Information Display www.informationdisplay.org  

E-Print Network [OSTI]

companies at Display Week 2012: Tactus Technology for best prototype in the new Innovation Zone and Dimenco, Fraunhofer COMEDD, LG Display, Ocular, and Samsung as Best-in-Show winners from the exhibit floor. By Jenny to innovate. By Alfred Poor 17 Part I: A Brief History of Key Areas in Display Technology In Part I of our 50

Heikenfeld, Jason

253

The impact of meteorological conditions and variation in chemical composition of aerosols on regional cloud formation  

E-Print Network [OSTI]

Snyder, J.J. Schauer, R.E. Peltier, R.J. Weber, S.M. Murphy,Hecobian, O. Vargas, R.E. Peltier, A.T.C. Hanks, L.G. Huey,A.M. Middlebrook, R.E. Peltier, A. Sullivan, D.S. Thomson,

Creamean, Jessie Marie

2012-01-01T23:59:59.000Z

254

Control of the chinch bug, Blissus leucopterous (say) on corn and grain sorghum  

E-Print Network [OSTI]

) ~ Painter et ~a. (19$$) azui SnellinS, azzi ~ (ling'p), ore mn~ ztuymoekeC bg other meieOLes an@ strains oF oem. 'tests moro ccn8uctcS Surinam lg6$-3. 966 to evaluate the toxicity cf s~2. imscotici@cs to thc chinch bug. both in the laboratory exxon...

Todd, Larry Leland

2012-06-07T23:59:59.000Z

255

Reflection and transmission of surface waves in laterally varying media  

Science Journals Connector (OSTI)

......regional phases Pg and Lg at the Nevada Test Site, J. geophys. Res., 1981...velocity heterogeneity under the Nevada Test Site on short-period P wave amplitudes...Key 1967). In studies of the Nevada Test Site, Barker, Der & Mrazek (1981......

M. G. Bostock

1992-05-01T23:59:59.000Z

256

10. (214129/8 ..).  

E-Print Network [OSTI]

) (Decision Theory) µ : De Finetti, B., Jeffreys, H., Savage L.G., De Groot, M. and Lindley, D.V. µ µ.H. (1974). Theory of Probability. Vols 1 and 2. Wiley. 5. DeGroot M. (1970). Optimal Statistical Decisions. Theory and Decision, 13 139-199. 7. Fishburn, P.C. (1986). The Axioms of Subjective Probability. Stat

Kokolakis, George E.

257

Yeast metallothionein and applications in biotechnology.  

Science Journals Connector (OSTI)

...inducible upon growth of cells in phosphate-depleted media (53). Similarly, the GALl gene...precious metals such as gold, silver, uranium, and platinum is highly desirable. Two...Gene amplification, driLg resistance and cancer. C'anicer Res. 44:1735-1742...

T R Butt; D J Ecker

1987-09-01T23:59:59.000Z

258

Elsevier Editorial System(tm) for Pervasive and Mobile Computing Manuscript Draft  

E-Print Network [OSTI]

, Israel cLG Semicon Hall 2106, KAIST, 373-1, Guseong-dong, Yuseong-gu, Daejeon, 305-701, Republic of Korea- forms a precise segmentation and labeling of swimming sessions. This allows a comprehensive break introduce a grammar into the SMM framework. Using the trained model on test swimming sessions of different

Shamir, Ron

259

Genetic exchange and the origin of adaptations: prokaryotes to primates  

Science Journals Connector (OSTI)

...1093/hmg/ddh126 . Evans, P.D , Gilbert, S.L, Mekel-Bobrov, N, Vallender...salivarius subsp. salivarius UCC118. Microbiology. 148, 973-984. Garrigan, D , Mobasher...R , Young, L.G, Blume, L.M, Gilbert, L.E2006Multilocus analyses of admixture...

2008-01-01T23:59:59.000Z

260

Deduced polypeptides encoded by the Bacillus subtilis sacU locus share homology with two-component sensor-regulator systems.  

Science Journals Connector (OSTI)

...sensor-transducer couple, which functions to relay information about specific environmental...sensor-transducer couple, which functions to relay information about specific environmental...L L AJ I R AV Q E S K E L|G A|L T HFA K|P F I E I V K|K-Y KKAV DLIGA SYFILK...

F Kunst; M Debarbouille; T Msadek; M Young; C Mauel; D Karamata; A Klier; G Rapoport; R Dedonder

1988-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Hwang & Hannaford 1/5/97 Teleoperation Performance with a Kinematically Redundant Slave Robot  

E-Print Network [OSTI]

expressing different trade-offs between kinetic energy, joint usage, and joint limit avoiding. To validate. The trade-off between kinetic energy and joint limit index was clearly shown in the autonomous test to acknowledge the support of LG Production Engineering Research Center, Seoul, Korea, the US National Science

262

application note an 18-1146-70 AA, 2000-08 p1  

E-Print Network [OSTI]

(Kuo, C-H., et al., 1999); and human immunodeficiency virus 1 (HIV-1) TAT protein via activation of the TAT- responsive DNA element (upTar) of the major late promoter Fig. 1. General purification and on transcription through an RNA element by transactivating HIV-1 through TAR RNA (Chepenik, L.G., et al., 1998

Lebendiker, Mario

263

Construction of the Diploid, Tetraploid and Integrated Diploid-tetraploid Genetic Linkage Maps in Roses Using Simple Sequence Repeat (SSR) Markers  

E-Print Network [OSTI]

type (Blfo) were mapped on the Chr LG3 which matched with the ICM (Integrated consensus map) published by Spillers et al., (2010). Moreover, 5 out of the 69 SSR markers (RhJ404, H9_B01, RW11E5, RW8B8 and RhE3) were mapped to two or more loci each...

Tsai, Ching-Jung

2014-01-03T23:59:59.000Z

264

Journal of Sustainable Energy & Environment 3 (2012) 35-47 Copyright @ 2012 By Journal of Sustainable Energy and Environment 35  

E-Print Network [OSTI]

in an attempt to reduce greenhouse gas emissions and to improve the energy security of the country. Biodiesel of Sustainable Energy and Environment 35 Effects of Biodiesel Fuels Use on Vehicle Emissions L.G. Anderson petroleum diesel fuel to biodiesel blended fuels on relative vehicle emissions for LD and HD vehicles

265

ANIMAL DEMOGRAPHY UNIT, DEPARTMENT OF ZOOLOGY, UNIVERSITY OF CAPE TOWN  

E-Print Network [OSTI]

, Underhill LG (assistant eds) 2009. An atlas of wader populations in Africa and western Eurasia. Wageningen of climate change on the population ecology of Blue Cranes. Functional Ecology 23: 1014­1021. Angel A recreational disturbance in the Namib Desert increases breeding density and overall success. Ostrich 80: 71

de Villiers, Marienne

266

Bcl10 and Malt1 control lysophosphatidic acid-induced NF-{kappa}B activation and cytokine production  

Science Journals Connector (OSTI)

...determined by an ELISA DuoSet (R & D Systems, Minneapolis, MN) as recommended...23 : 561 574 . 12 Matsumoto R Wang D Blonska M Li H Kobayashi M Pappu B Chen Y Wang D Lin X ( 2005 ) Immunity...337 347 . 14 Fredriksson R Lagerstrom MC Lundin LG Schioth HB ( 2003...

Stefanie Klemm; Stephanie Zimmermann; Christian Peschel; Tak W. Mak; Jrgen Ruland

2007-01-01T23:59:59.000Z

267

An empirical approach to derive MODIS ocean color patterns under severe sun glint  

E-Print Network [OSTI]

An empirical approach to derive MODIS ocean color patterns under severe sun glint Chuanmin Hu1 is limited, MODIS ocean color data can be used instead. However, frequent and extensive sun glint prevents such an application when glint reflectance, Lg, is >0.01 sr-1 . Here, an empirical approach is developed to remove sun

Meyers, Steven D.

268

National Aeronautics and Space Administration Sun  

E-Print Network [OSTI]

National Aeronautics and Space Administration Sun #12;National Aeronautics and Space Administration Sun LG-2001-08-527-HQ Our SUN has inspired mythology in almost all cultures, including ancient Egyptians, Aztecs, Native Americans, and Chinese. We now know that the Sun is a huge, bright sphere

Christian, Eric

269

TREKiSM Issue 37  

E-Print Network [OSTI]

This is gold. Kirk is perfect, Spock Is bon san d p 0 s tag (~, 0 f course. GET WELL W1Sr-I[S to Lilld(] C. Brown, who's now back clt work folJowj'lg surgcl'y, fucing a...

1984-01-01T23:59:59.000Z

270

Preliminary Results from the UCLA/SLAC Ultra-High Gradient CerenkovWakefield Accelerator Experiment  

SciTech Connect (OSTI)

The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. This experiment takes advantage of the unique SLAC FFTB electron beam and its demonstrated ultra-short pulse lengths and high currents (e.g., {sigma}{sub z} = 20 {micro}m at Q = 3 nC). The FFTB electron beam has been successfully focused down and sent through varying lengths of fused silica capillary tubing with two different sizes: ID = 200 {micro}m/OD = 325 {micro}m and ID = 100 {micro}m/OD = 325 {micro}m. The pulse length of the electron beam was varied in the range 20 {micro}m < {sigma}{sub z} < 100 {micro}m which produced a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments we plan to collect and measure coherent Cerenkov radiation emitted from the capillary tube to gain more information about the strength of the accelerating fields.

Thompson, M.C.; Badakov, H.; Rosenzweig, J.B.; Travish, G.; /UCLA; Hogan, M.; Ischebeck, R.; Kirby, N.; Siemann, R.; Walz, D.; /SLAC; Muggli, P.; /Southern California U.; Scott, A.; /UC, Santa Barbara; Yoder, R.; /Manhattan Coll., Riverdale

2008-02-06T23:59:59.000Z

271

Utility Advanced Turbine Systems Program (ATS) Technical Readiness Testing and Pre-Commercial Demonstration  

SciTech Connect (OSTI)

The objective of the ATS program is to develop ultra-high efficiency, environmentally superior and cost competitive gas turbine systems for base load application in utility, independent power producer and industrial markets. Specific performance targets have been set using natural gas as the primary fuel: {lg_bullet} System efficiency that will exceed 60%(lower heating value basis) on natural gas for large scale utility turbine systems; for industrial applications, systems that will result in a 15% improvement in heat rate compared to currently available gas turbine systems. {lg_bullet} An environmentally superior system that will not require the use of post combustion emissions controls under full load operating conditions. {lg_bullet} Busbar energy costs that are 10% less than current state-of-the-art turbine systems, while meeting the same environmental requirements. {lg_bullet} Fuel-flexible designs that will operate on natural gas but are capable of being adapted to operate on coal-derived or biomass fuels. {lg_bullet} Reliability-Availability-Maintainability (RAM) that is equivalent to the current turbine systems. {lg_bullet} Water consumption minimized to levels consistent with cost and efficiency goals. {lg_bullet} Commercial systems that will enter the market in the year 2000. In Phase I of the ATS program, Siemens Westinghouse found that efficiency significantly increases when the traditional combined-cycle power plant is reconfigured with closed-loop steam cooling of the hot gas path. Phase II activities involved the development of a 318MW natural gas fired turbine conceptual design with the flexibility to burn coal-derived and biomass fuels. Phases I and II of the ATS program have been completed. Phase III, the current phase, completes the research and development activities and develops hardware specifications from the Phase II conceptual design. This report summarizes Phase III Extension activities for a three-month period. Additional details may be found in monthly technical progress reports covering the period stated on the cover of this report. Background information regarding the work to be completed in Phase III may be found in the revised proposal submitted in response to A Request for Extension of DE-FC21-95MC32267, dated May 29, 1998 and the Continuing Applications of DE-FC21-95MC32267, dated March 31, 1999 and November 19, 1999.

Siemens Westinghouse

2001-06-30T23:59:59.000Z

272

Colorado Environmental Coalition v. Office of Legacy Management, Civil  

Broader source: Energy.gov (indexed) [DOE]

Colorado Environmental Coalition v. Office of Legacy Management, Colorado Environmental Coalition v. Office of Legacy Management, Civil Action No. 08-cv-01624 (February 27, 2012) Colorado Environmental Coalition v. Office of Legacy Management, Civil Action No. 08-cv-01624 (February 27, 2012) U.S. District Court's Order of February 27, 2012, in Colorado Environmental Coalition v. Office of Legacy Management, Civil Action No. 08-cv-01624 (D. Colo.). U.S. District Court's Order of February 27, 2012, in Colorado Environmental Coalition v. Office of Legacy Management, Civil Action No. 08-cv-01624 (D. Colo.). More Documents & Publications Colorado Environmental Coalition v. Office of Legacy Management, Civil Action No. 08-cv-01624 (October 18, 2011) LG Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff LG

273

Conservation Standards Enforcement | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

March 2, 2010 March 2, 2010 Hudson-Reed: Data Request (2010-CW-1403) DOE requested test data from Hudson-Reed Limited for Hudson Reed's showerhead ("shower tower") model "AS333". March 2, 2010 Delta Faucet: Data Request (2010-SW-1603) DOE requested test data from Delta Faucet Corporation for Delta Faucet's showerhead model "In2ition 75582". January 7, 2010 Haier America: Consent Decree (2010) DOE entered into a Consent Decree with Haier America Trading, L.L.C., after DOE testing in the Energy Star Verification Testing Pilot Program showed Haier's freezer model HUF138EA, not only failed to satisfy the ENERGY STAR specification, but also failed to meet the applicable federal energy conservation standards. December 23, 2009 LG Electronics v. DOE - Defendants' Brief in Opposition to Plaintiff LG

274

City of Russell, Massachusetts (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Russell Russell Place Massachusetts Utility Id 16438 Utility Location Yes Ownership M NERC Location NPCC NERC NPCC Yes ISO NE Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png GENERAL SERVICE SCHEDULE G Industrial GENERAL SERVICE SCHEDULE G- FARM DISCOUNT Industrial LARGE GENERAL SERVICE SCHEDULE LG Industrial LARGE GENERAL SERVICE SCHEDULE LG- FARM DISCOUNT Industrial RESIDENTIAL SERVICE SCHEDULE R1 Residential RESIDENTIAL SERVICE SCHEDULE R1- FARM DISCOUNT Residential SMALL GENERAL SERVICE SCHEDULE SG Industrial SMALL GENERAL SERVICE SCHEDULE SG- FARM DISCOUNT Industrial

275

City of Sabetha, Kansas (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Sabetha, Kansas (Utility Company) Sabetha, Kansas (Utility Company) Jump to: navigation, search Name City of Sabetha Place Kansas Utility Id 16518 Utility Location Yes Ownership M NERC Location SPP Operates Generating Plant Yes Activity Generation Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Commercial Commercial Commercial-Rural Commercial Large power Industrial Large power-Rural Industrial Residential Residential Residential-Rural Residential Total Electricity Lg Power Industrial Total Electricity Lg Power-Rural Industrial Total Electricity Residential Residential Average Rates Residential: $0.1190/kWh

276

U.S. Department of Energy Categorical Exclusion Determination Form  

Broader source: Energy.gov (indexed) [DOE]

Operation of Extrel MAX300LG Mass Spectrometer and VICI Metronics Dynacalibrator Calibration Gas Generator at 999-1W Operation of Extrel MAX300LG Mass Spectrometer and VICI Metronics Dynacalibrator Calibration Gas Generator at 999-1W Savannah River Site Aiken/Aiken/South Carolina The mass spectrometer will be used to measure the composition of gases from laboratory experiments at 999-1W. The VICI Metronics Dynacalibrator will be used to generate low concentration calibration gases; initially, mercury in nitrogen or argon calibration gases will be generated. Other calibration gases may be generated in the future B3.6 - Small-scale research and development, laboratory operations, and pilot projects Andrew R. Grainger Digitally signed by Andrew R. Grainger DN: cn=Andrew R. Grainger, o=DOE-SR, ou=EQMD, email=drew.grainger@srs.gov, c=US Date: 2011.11.30 18:44:23 -05'00'

277

Heat pulse propagation in chaotic 3-dimensional magnetic fields  

E-Print Network [OSTI]

Heat pulse propagation in $3$-D chaotic magnetic fields is studied by solving the parallel heat transport equation using a Lagrangian-Green's function (LG) method. The LG method provides an efficient and accurate technique that circumvents limitations of finite elements and finite difference methods. The main two problems addressed are: (i) The dependence of the radial transport on the magnetic field stochasticity (controlled by the amplitude of the perturbation, $\\epsilon$); and (ii) The role of reversed shear configurations on pulse propagation. In all the cases considered there are no magnetic flux surfaces. However, radial transport is observed to depend strongly on $\\epsilon$ due to the presence of high-order magnetic islands and Cantori that act as quasi-transport barriers that preclude the radial penetration of heat pulses within physically relevant time scale. The dependence of the magnetic field connection length, $\\ell_B$, on $\\epsilon$ is studied in detail. The decay rate of the temperature maximum...

del-Castillo-Negrete, D

2014-01-01T23:59:59.000Z

278

BoseEinstein condensation transition studies for atoms confined in LaguerreGaussian laser modes  

Science Journals Connector (OSTI)

Multiply-connected traps for cold, neutral atoms fix vortex cores of quantum gases. LaguerreGaussian laser modes are ideal for such traps due to their phase stability. We report theoretical calculations of the BoseEinstein condensation transition properties and thermal characteristics of neutral atoms trapped in multiply connected geometries formed by LaguerreGaussian (LGpl) beams. Specifically, we consider atoms confined to the anti-node of a LG01 laser mode detuned to the red of an atomic resonance frequency, and those confined in the node of a blue-detuned LG11 beam. We compare the results of using the full potential to those approximating the potential minimum with a simple harmonic oscillator potential. We find that deviations between calculations of the full potential and the simple harmonic oscillator can be up to 3%8% for trap parameters consistent with typical experiments.

T.G. Akin; Sharon Kennedy; Ben Dribus; Jeremy L. Marzuola; Lise Johnson; Jason Alexander; E.R.I. Abraham

2012-01-01T23:59:59.000Z

279

The Picard group of the loop space of the Riemann sphere  

E-Print Network [OSTI]

The loop space of the Riemann sphere consisting of all C^k or Sobolev W^{k,p} maps from the circle S^1 to the sphere is an infinite dimensional complex manifold. We compute the Picard group of holomorphic line bundles on this loop space as an infinite dimensional complex Lie group with Lie algebra the first Dolbeault group. The group of Mobius transformations G and its loop group LG act on this loop space. We prove that an element of the Picard group is LG-fixed if it is G-fixed; thus completely answer the question by Millson and Zombro about G-equivariant projective embedding of the loop space of the Riemann sphere.

Ning Zhang

2006-02-28T23:59:59.000Z

280

Universitt Hannover Studierendenstatistik SoSem 2000 Seite 1 von 9 Studiengang Abschlu-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

137 3 LR 1 10 1 13 11 1 10 47 24 2 LGH 8 5 2 2 17 9 2 LGHR HR 5 1 5 1 12 6 LBS 7 4 6 3 1 2 2 7 32 13 191 98 144 37 8 35 5 27 7 86 791 772 61 LG 22 14 2 10 20 14 1 27 110 54 1 LR 1 1 3 2 5 12 7 1 LGH 1 1) LG 13 1 10 10 3 3 2 3 1 12 58 29 1 LR 1 8 1 10 3 6 12 41 19 LGH 1 1 0 LGHR HR 4 3 1 8 4 LSo 4 2 6 1

Vollmer, Heribert

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

A new Lyapunov design method for nonlinear process control  

E-Print Network [OSTI]

corresponding to the approximate solution V~(x) of PDE (2. 4). Moreover, let: Bi l = (x e R" ix g xp h = 0) dV~(x) dt and Ci l = min Vi l(x) zen(+) Then, the set: Si l(x) = (x e 8" ~Vi l(x) & Ct l) is wholly contained in the stability region of system (2... law (3. 8) the closed loop system is given by: p up ? LgV(x)[LfV(x) + a V(x)j [L9V(x) j'+ p' y = h(x) (4. 1) Since V(x) is given by (2. 7) without having linear terms in x (Remark 2), it is easily deduced that V(xp) = LgV(xp) = LfV(xp) = 0...

Dubljevic, Stevan

2012-06-07T23:59:59.000Z

282

High efficiency SHG of orbital angular momentum light in an external cavity  

E-Print Network [OSTI]

Traditional methods for generating orbital angular momentum (OAM) light include holographic diffraction gratings, vortex phase plate and spatial light modulator. In this article, we report a new method for high efficient OAM light generation. By pumping an external cavity contains a quasi phase matching nonlinear crystal with a fundamental OAM carrying light and properly aligning the cavity, mode matching between the pump light and the cavitys higher order Laguerre-Gaussian (LG) mode is achieved, conversion efficiency up to 10.3 percentage have been obtained. We have demonstrated that the cavity can stably operate at its higher order LG mode just as Gaussian mode for the first time. The SHG light possesses a doubled OAM value with respect to the pump light. The parameters that affect the beam quality and conversion efficiency are discussed in detail. Our work opens a brand new field in laser optics, and makes the first step toward high efficiency OAM light processing.

Zhi-Yuan Zhou; Yan Li; Dong-Sheng Ding; Yun-Kun Jiang; Wei Zhang; Shuai Shi; Bao-Sen Shi; Guang-Can Guo

2014-05-12T23:59:59.000Z

283

Alternative Fuels Data Center  

Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

Kentucky Incentives and Laws Kentucky Incentives and Laws The following is a list of expired, repealed, and archived incentives, laws, regulations, funding opportunities, or other initiatives related to alternative fuels and vehicles, advanced technologies, or air quality. Low Emission Vehicle Electricity Rate Incentive - Louisville Gas & Electric Expired: 08/01/2013 Louisville Gas & Electric (LG&E) offers a pilot Low Emission Vehicle (LEV) time-of-use electricity rate for residential customers who own an electric vehicle, plug-in hybrid electric vehicle, or natural gas vehicle fueled through a home fueling appliance. The rate is limited to 100 residential customers. For more information, see the LG&E LEV Pilot website. Biodiesel Education and Acquisition Grants Expired: 04/30/2013

284

Community work in vocational agriculture in Texas  

E-Print Network [OSTI]

'a of a gaostionnairo for the yaryose of scouring data for tho s~; to the Direotors of Vocational igrleultare of the State of Texas for their assistanoe and for their yerad, ssion to use data secured froa the vooational agrionltare teachers... ozganising infoxsation scoured froa oonversations hoke with experienoed vocational agrioulture teachers' {o) by organising infor??a- tion gathered froa his own experienoe and s~ of oossuni+ wozk; and. {4) lg inforaation assured. froa auseers...

Vickery, Clarence Percell

2012-06-07T23:59:59.000Z

285

The application of the fusion method of thermit welding to small diameter tubing: An analysis of mold design and powder quantity.  

E-Print Network [OSTI]

of an exothermic reaction between iron oxide and aluminum, in the form of a finely powdered mixture. Produced in this reaction are steel, aluminum oxide, and a specific quantity of heat. In the early lgDD' s, the thermit process was used extensively... Pl ~ Glynn, who investigated another basic aspect of this problem. The science of aluminothermics involves the reduc- tion of a metallic oxide in the presence of aluminum. This reduction occurs in the form of an ebullient exothermic reaction...

Eller, Frank Charles

1972-01-01T23:59:59.000Z

286

13 Red-Black Trees Chapter 12 showed that a binary search tree of height h can support any of the basic  

E-Print Network [OSTI]

13 Red-Black Trees Chapter 12 showed that a binary search tree of height h can support any height is large, however, the set operations may run no faster than with a linked list. Red-black trees-set operations take O.lg n/ time in the worst case. 13.1 Properties of red-black trees A red-black tree

287

Optimization of a Solvent Extraction Desalination Plant  

E-Print Network [OSTI]

OPTIHIZATION OF A SOLEENT EXTRACTION DESALINATION PLANT A Thesis by PHILLIP LEN BEIGHLE Submitted to the Graduate College of Texas ABEAM University in partial fulfillment of the requirements for the degree of NASTER OF SCIENCE May lg6...$ Najor Subject: Chemical Erugincering OPTIMI7&TION OF A SOLVENT EXTRACTION DESALINATION PLANT A Thesis By PHILLIP LEN BEIGHLE Approved as to style and content by: (Chairman of Committee) (Head of Department) (Member) (Member) (Member) (Member...

Beighle, Phillip Lew

2012-06-07T23:59:59.000Z

288

Component of variance estimation based on synthesis  

E-Print Network [OSTI]

Component of Variance Estimation based on. Synthesis. (August lg (2) Jocelyn Anthea Tommerup, B. Sc. , B. Econ. , University of Queenslsnd Directed. by: Dr. H. 0. Hartley Analysis of variance, widely used in the study of statistical variation.... Essentially the problem is to find these coefficients so that, estimstes of the components may be computed. Hartley [1967] hss proposed a method which gives these coef'ficients directly for sry design, balanced of' unbalanced. It is the objective...

Tommerup, Jocelyn Anthea

2012-06-07T23:59:59.000Z

289

The effects of dietary phenylalanine supplementation on ochratoxicosis in normal and partially nephrectomized rats  

E-Print Network [OSTI]

THE EFFECTS OF DIETARY PHENYLALANINE SUPPLEMENTATION ON OCHRATOXICOSIS IN NORMAL AND PARTIALLY NEPHRECTOMIZED RATS A Thesis By RUGER WILLIAM PARKER Submitted to the Graduate College of Texas AKM University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE December lg83 Magor SubJect: Epidemiology THE EFFECTS OF DIETARY PHENYLALANINE SUPPLEMENTATION ON OCHRATOXICOSIS IN NORMAL AND PARTIALLY NEPHRECTOMIZEU RATS A Thesis by ROGER WILLIAM PARKER Approved...

Parker, Roger William

2012-06-07T23:59:59.000Z

290

A comparison of various calculational methods for constant volatility ratio, constant reflux multicomponent distillation  

E-Print Network [OSTI]

for Figures 17, 18, nd 19. . . 83 XIV. Tabulation of Empirical Correlation (Equation 48). 85 ZIQUR S Page l. Operating Data for the Depropanization of a Light Naphtha. 26 2. Composition of Vapor Rising from Plates in a Column Containi. ng an Infinite... for lg constant- doublet separation systems in which the molal liquid and vapor flows remain constant within each section of the column. An empirical correlation (Equation 48) relating the error of the "apcroximate" method to process variables...

Hurst, James William

1952-01-01T23:59:59.000Z

291

CAMERON MARTIN THEOREM Theorem Let B = (Bt)t 1 be standard 1-dimensional BM and let W = B + f where f C[0, 1] with f(0) = 0.  

E-Print Network [OSTI]

of Brownian bridge are the same as that of Brownian motion. For example Brownian bridge paths are H¨older continuous of any order less than 1/2 but nowhere H¨older of order greater than 1/2; the bridge crosses zero on L2 [0, 1] and hence it can be represented in the form L[g] = R g h for some h L2 [0, 1]. Writing H

Krishnapur, Manjunath

292

One Bit of Advice Harry Buhrman 1 , Richard Chang 2? , and Lance Fortnow 3  

E-Print Network [OSTI]

One Bit of Advice Harry Buhrman 1 , Richard Chang 2? , and Lance Fortnow 3 1 CWI & University function. Then, we de#12;ne L=f = fx j hx; f(jxj)i 2 Lg. For a complexity class C and a class of functions F , C=F = fL=f j L 2 C; f 2 Fg. Thus, NP/poly denotes the class of languages recognized by NP

Fortnow, Lance

293

Occasional Papers in Sociology and Anthropology - Volume 5  

E-Print Network [OSTI]

) Magarat, (ix) Maithil, (x) Nepal, (xi) Tambu Sall/lg, end (xii) Tamuan. King Prithvi Narayan Shah of Gorkha conquered the cny states of Kathmandu Valley, and absorbed all the p~tly states in his process of 'unification.' This led to the emergence ol a... Community Resource Management in the Barha Magarat Suresh Dhakal 52 THE RAJBANSHIS OF RAJGADH Community Adaptation in the Environment of Eastern Terai Hari P Bhattarai 78 KURMA, KOLL AND KURl AS COMMUNITY CONCEPTS Patrilineage Deities, and Inside...

Central Department of Sociology and Anthropology, Tribhuvan University, Kathmandu, Nepal

1996-01-01T23:59:59.000Z

294

The effectiveness of some commercial acaricides for control of certain mites of the Tetranychus telarius complex attacking cotton  

E-Print Network [OSTI]

, : L LLni" LL1 n. . . 8'-et . bio oils, bu is only sl ii l Cl . 801 ioloi ln g 'I' LffixLic kQ'drociirbans ~ s aretk icxL is hi~"L lg toxic CQ LLLS '. . 815 ~ . 'k. . QkL8;. ical narc of ~mi'8 is . '-(g?tert butqlghenoxy) isogro g1, 2-ckiloroet~l su...

Fernandez, Alberto Thomas

1959-01-01T23:59:59.000Z

295

CSP'960H/CSP-960S Installation Guide  

E-Print Network [OSTI]

CSP'960H/CSP-960S Installation Guide 4-634-979-01 TM Read First! 1^00 - 3lG - 755; #12;CSP-960H/CSP CSP-960H only) J Sony CDU926S CD-R Drive Unit User's Guide Use this manual as a guide to help you. If all the items are not found, please contact your Sony dealer before proceeding. G CSP-960H/960S CD

Kleinfeld, David

296

Literature Review of Displacement Ventilation  

E-Print Network [OSTI]

) and Nielsen et al. (1988) showed the impact of supply diffusers whereby increasing the entrainment of room air can decrease the temperature gradient in the occupied zone. #0;? Two important parameters to evaluate the performance of displacement ventilation... of Ventilated Rooms, Oslo, Norway. Nielsen, P.V., Hoff, L., Pedersen, L.G. 1988. Displacement Ventilation by Different Types of Diffusers. Proceedings of the 9 th AIVC Conference, Warwick. Niu, J. 1994. Modeling of Cooled-Ceiling Air-Conditioning Systems Ph...

Cho, S.; Im, P.; Haberl, J. S.

297

Grundstudium Bachelor Modu-ID SWS Dozent BemerkungenBetreuer Gruppen Vorlesungen  

E-Print Network [OSTI]

INF-71-59-V-6 2V+1? Sonntag Sonntag 3D Computer Vision INF-73-51-V-6 2V+1? Stricker Seminar INF-73-72-S-7 2S Stricker, Bleser Projekt: Collaborative Intelligence INF-71-82-L-7 4P Dengel Folz Projekt: Computer Vision: Object and People Tracking INF-73-82-L-7 4P Stricker, Bleser Bleser LG Software

Pinnau, René

298

Structural geology of the northern termination of the Crawford Thrust, western Wyoming  

E-Print Network [OSTI]

descriptions and measured sections ot which provide excellent control on identifying units and determining the thicknesses. The Jurassic Twin Creek Limestone has been discussed by lmlay (1967), the Jurassic Preuss, Stump, and Jurass c-Cretaceous Ganne... Formation Sandstone and the Twin Creek Limestone. The upper Jurassic and Cretaceous sediments are markedly d1fferent. from the sediments beneath them. The Preuss and Stump Formations of the Upper Jurassic are marine shales and sandstones which Jordan (lg...

Evans, James Paul

2012-06-07T23:59:59.000Z

299

The theorem of Fellman and Jakobsson: A new proof and dual theory  

Science Journals Connector (OSTI)

The Fellman and Jakobsson theorem of 1976 deals with transformations @f of the rank-frequency function g and with their Lorenz curves L(@f^@?g) and L(g). It states (briefly) that L(@f^@?g) is monotonous (in terms of the Lorenz dominance order) with @f(x)x. ... Keywords: Dual, Fellman, Jakobsson, Lorenz curve, Lorenz dominance order, Rank-frequency function, Taxes, Transformation

L. Egghe

2009-12-01T23:59:59.000Z

300

The production of monoclonal antibodies to Babesia microti  

E-Print Network [OSTI]

under oil immersion using an epifluorescent microscope (American Optical, St. Louis, Mo. ). The supernatants were evaluated by comparing with the positive (distinct fluorescence of' the intraerythrocytic parasite) and negative (a faint haze...M and lgG conjugates. The conjugates were prepared from lyophilized antisera (Miles Scientific, Naperville, Ill. ). Lyophilized antisera were reconstituted and diluted to contain 17-20 mg protein/ml. One ml of the antibody solution was added to a...

Ruwe, Kathryn Lyn

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

O3MSAF/KNMI/ATBD/003 2 April 2014  

E-Print Network [OSTI]

Netherlands Meteorological Institute (KNMI) #12;#12;Page 3 of 37 O3MSAF/KNMI/ATBD/003 Document status sheetREFERENCE: ISSUE: DATE: PAGES: O3MSAF/KNMI/ATBD/003 1.4 2 April 2014 37 ALGORITHM THEORETICAL-2 / MetOp-A O3M-90 Surface LER from GOME-2 / MetOp-B L.G. Tilstra Royal Netherlands Meteorological

Tilstra, Gijsbert

302

O3MSAF/KNMI/ATBD/003 13 November 2014  

E-Print Network [OSTI]

Netherlands Meteorological Institute (KNMI) #12;#12;Page 3 of 37 O3MSAF/KNMI/ATBD/003 Document status sheetREFERENCE: ISSUE: DATE: PAGES: O3MSAF/KNMI/ATBD/003 1.6 13 November 2014 37 ALGORITHM THEORETICAL / MetOp-A O3M-90 Surface LER from GOME-2 / MetOp-B L.G. Tilstra Royal Netherlands Meteorological

Tilstra, Gijsbert

303

Evaluation of four grasses for seeding on South Texas rangeland  

E-Print Network [OSTI]

annulatus Forsk cv. "Pretoria 90"), Gordo bluestem (Dicanthium aristatum (Poir. ) C. E. Hubb. cv. "Gordo"), King Ranch bluestem (Bothriochloa ishchaemum L. var. songaricus Rupr. ), Kleberg bluestem (Bothriochloa annulatus Forsk. ), Medio bluestem... (Dicanthium aristatum (Poir. ) C. E. Hubb. cv. "Medio" ), Higgins buffelgrass (Cenchrus ciliaris L. cv. "Higgins"), Wintergreen h dihgas kehlais~steet h k. ca. "ah t g e), d E 1 1 g (~Ett 1 lg h d. ) N NErmeloN). Selection cri teria included initial...

Polk, David Beck

2012-06-07T23:59:59.000Z

304

Communist China's foreign trade and its implication for Japan  

E-Print Network [OSTI]

COMMUNIST CHINA'S FOREIGN TRADE AND ITS IMPLICATION FOR JAPAN A Thesis by LEH-AN HSIEH Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE August lg72... Major Subject: Economics COMMUNIST CHINA'S FOREIGI'J TRADE AND ITS IMPLICATION FOR JAPAN A Thesis LEH-AN HSIEH Approved as to style and content by: Head of Department Member / Member Member (Member) ABSTRACT Communist China's Foreign Trade...

Hsieh, Leh-An

2012-06-07T23:59:59.000Z

305

TESTING OF TMR SAND MANTIS FINAL REPORT  

SciTech Connect (OSTI)

Screening tests of Sand Mantis candidate materials selected for erosion resistance have been completed. The results of this testing identified that over a relatively short period of operation (<1 hour), measurable erosion will occur in each of the candidate zoom tube materials given equal operating exposure. Additionally, this testing has shown that erosion of the rubber discharge hose directly downstream of the vehicle could be expected to limit the service life of the discharge hose. On the basis of these test results, SRNL recommends the following; {lg_bullet} redesign of critical system components (e.g., zoom tube, discharge hose) should be conducted to improve system characteristics relative to erosion and capitalize on the results of this testing, {lg_bullet} continued efforts to deploy the Sand Mantis should include testing to better define and optimize operating parameters, and gain an understanding of system dynamics, {lg_bullet} discontinue wear testing with the selected materials pending redesign of critical system components (1st recommendation) and inclusion of other candidate materials. The final selection of additional candidate materials should be made following design changes, but might include a Stellite alloy or zirconia.

Krementz, D; William Daugherty, W

2007-06-12T23:59:59.000Z

306

Improved selection in totally monotone arrays  

SciTech Connect (OSTI)

This paper's main result is an O(({radical}{bar m}lgm)(n lg n) + mlg n)-time algorithm for computing the kth smallest entry in each row of an m {times} n totally monotone array. (A two-dimensional A = a(i,j) is totally monotone if for all i{sub 1} < i{sub 2} and j{sub 1} < j{sup 2}, < a(i{sub 1},j{sub 2}) implies a(i{sub 2},j{sub 1})). For large values of k (in particular, for k=(n/2)), this algorithm is significantly faster than the O(k(m+n))-time algorithm for the same problem due to Kravets and Park. An immediate consequence of this result is an O(n{sup 3/2} lg{sup 2}n)-time algorithm for computing the kth nearest neighbor of each vertex of a convex n-gon. In addition to the main result, we also give an O(n lg m)-time algorithm for computing an approximate median in each row of an m {times} n totally monotone array; this approximate median is an entry whose rank in its row lies between (n/4) and (3n/4) {minus} 1. 20 refs., 3 figs.

Mansour, Y. (Harvard Univ., Cambridge, MA (United States). Aiken Computation Lab.); Park, J.K. (Sandia National Labs., Albuquerque, NM (United States)); Schieber, B. (International Business Machines Corp., Yorktown Heights, NY (United States). Thomas J. Watson Research Center); Sen, S. (AT and T Bell Labs., Murray Hill, NJ (United States))

1991-01-01T23:59:59.000Z

307

Tidal stirring and the origin of dwarf spheroidals in the Local Group  

E-Print Network [OSTI]

N-Body/SPH simulations are used to study the evolution of dwarf irregular galaxies (dIrrs) entering the dark matter halo of the Milky Way or M31 on plunging orbits. We propose a new dynamical mechanism driving the evolution of gas rich, rotationally supported dIrrs, mostly found at the outskirts of the Local Group (LG), into gas free, pressure supported dwarf spheroidals (dSphs) or dwarf ellipticals (dEs), observed to cluster around the two giant spirals. The initial model galaxies are exponential disks embedded in massive dark matter halos and reproduce nearby dIrrs. Repeated tidal shocks at the pericenter of their orbit partially strip their halo and disk and trigger dynamical instabilities that dramatically reshape their stellar component. After only 2-3 orbits low surface brightness (LSB) dIrrs are transformed into dSphs, while high surface brightness (HSB) dIrrs evolve into dEs. This evolutionary mechanism naturally leads to the morphology-density relation observed for LG dwarfs. Dwarfs surrounded by very dense dark matter halos, like the archetypical dIrr GR8, are turned into Draco or Ursa Minor, the faintest and most dark matter dominated among LG dSphs. If disks include a gaseous component, this is both tidally stripped and consumed in periodic bursts of star formation. The resulting star formation histories are in good qualitative agreement with those derived using HST color-magnitude diagrams for local dSphs.

Lucio Mayer; Fabio Governato; Monica Colpi; Ben Moore; Tom Quinn; James Wadsley; Joachim Stadel; George Lake

2000-11-02T23:59:59.000Z

308

High power couplers for Project X  

SciTech Connect (OSTI)

Project X, a multi-megawatt proton source under development at Fermi National Accelerator Laboratory. The key element of the project is a superconducting (SC) 3GV continuous wave (CW) proton linac. The linac includes 5 types of SC accelerating cavities of two frequencies.(325 and 650MHz) The cavities consume up to 30 kW average RF power and need proper main couplers. Requirements and approach to the coupler design are discussed in the report. New cost effective schemes are described. Results of electrodynamics and thermal simulations are presented.

Kazakov, S.; Champion, M.S.; Yakovlev, V.P.; Kramp, M.; Pronitchev, O.; Orlov, Y.; /Fermilab

2011-03-01T23:59:59.000Z

309

An evaluation of Cerium-144 as an indigestible marker  

E-Print Network [OSTI]

OF TABLES AND FIGURE Table 144 Retention of Ce With Different Feedstuff s. Page 18 IV. Level of Adsorption and Tenacity of Binding of 144Ce 144 Distribution of Ce by Particle Size After a Marked Fraction of Alfalfa Hay (fine) Was Incubated...: CUNULATIVE FECAL EXCRETION OF Ce FOLLOWING SINGLE DOSE 100 g a e w SO 40 m 0 gv Oy yV V OV 5 8 0 0 0 v~ 20 60 Hours Foi1ow1nS Administration Q Sheep number 1 Sheep number 2 Q Sheep number 3 100 (Castle, 1956) did not reveal significant...

Huston, James Edward

2012-06-07T23:59:59.000Z

310

The Vibration?Rotation Emission Spectrum of Gaseous HZnCl  

Science Journals Connector (OSTI)

The Vibration?Rotation Emission Spectrum of Gaseous HZnCl ... A least-squares fit was performed separately for each of the five observed bands and the lines were fitted using the simple energy level expression15 where G(v1, v2, v3) is the vibrational energy of the (v1, v2, v3) state relative to the zero point energy (ZPE), G(0, 0, 0). ... (16)?Wilson, E. B.; Decius, J. C., Jr.; Cross, P. C. Molecular Vibrations; McGraw-Hill:? New York, 1955. ...

Shanshan Yu; Alireza Shayesteh; Dejian Fu; Peter F. Bernath

2005-04-14T23:59:59.000Z

311

United States and Latvian Governments Sign Agreement to Allow  

Broader source: Energy.gov (indexed) [DOE]

Latvian Governments Sign Agreement to Allow Latvian Governments Sign Agreement to Allow Nonproliferation and Threat Reduction Cooperation United States and Latvian Governments Sign Agreement to Allow Nonproliferation and Threat Reduction Cooperation April 25, 2005 - 12:25pm Addthis WASHINGTON, D.C. - As part of the Bush administration's ongoing efforts to secure vulnerable nuclear materials worldwide, the Department of Energy (DOE) and the Latvian Ministry of Environment signed an agreement today that will allow collaboration in nonproliferation and threat reduction areas. Secretary of Energy Samuel W. Bodman and Latvian Minister of Environment Raimonds Vejonis signed the agreement, which will provide for repatriation to Russia of Soviet/Russian-origin nuclear fuel from Latvia's shutdown research reactors at Salaspils; security enhancement of the reactor site

312

Total Crude Oil and Products Imports from All Countries  

Gasoline and Diesel Fuel Update (EIA)

Country: All Countries Persian Gulf OPEC Algeria Angola Ecuador Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Albania Argentina Aruba Australia Austria Azerbaijan Bahamas Bahrain Barbados Belarus Belgium Belize Benin Bolivia Brazil Brunei Bulgaria Burma Cameroon Canada Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Dominican Republic Egypt El Salvador Equatorial Guinea Estonia Finland France Gabon Georgia, Republic of Germany Ghana Gibralter Greece Guatemala Guinea Hong Kong Hungary India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Kazakhstan Korea, South Kyrgyzstan Latvia Liberia Lithuania Malaysia Malta Mauritania Mexico Midway Islands Morocco Namibia Netherlands Netherlands Antilles New Zealand Nicaragua Niue Norway Oman Pakistan Panama Papua New Guinea Peru Philippines Poland Portugal Puerto Rico Romania Russia Senegal Singapore Slovakia South Africa Spain Spratly Islands Swaziland Sweden Switzerland Syria Taiwan Thailand Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Ukraine United Kingdom Uruguay Uzbekistan Vietnam Virgin Islands (U.S.) Yemen

313

NEWTON, Ask a Scientist at Argonne National Labs  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Internal Battery Resistance Change During Use Internal Battery Resistance Change During Use Name: Mikus Status: student Grade: 9-12 Country: Latvia Date: Spring 2012 Question: Does the internal resistance of a battery change if the battery is being discharged? Replies: Yes. Batteries play a lot of messy games with their internal resistance. The resistance can depend on temperature, percent-of-charge-remaining, recent history of current drain, and battery aging. Each kind of battery (lithium, alkaline, lead-acid, Ni-Cd, NiMH) has a different set of behaviors. I have seen a lithium battery, when suddenly asked to push a large load, allow its output voltage to drop a lot at first, because its internal resistance was high, because the battery was cold. Then the large current flowing through that internal resistance warmed up the battery, and the voltage delivered actually increased with time, for a little while.

314

Ecofys-Country Fact Sheets | Open Energy Information  

Open Energy Info (EERE)

Ecofys-Country Fact Sheets Ecofys-Country Fact Sheets Jump to: navigation, search Tool Summary Name: Ecofys Country Fact Sheets Agency/Company /Organization: Ecofys Sector: Energy, Land Topics: Background analysis, Baseline projection, GHG inventory, Policies/deployment programs Website: www.ecofys.com/files/files/ecofys_2011_country_factsheets_update.pdf Country: Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Colombia, Croatia, Cyprus, Czech Republic, Denmark, Estonia, European Union, Finland, France, Germany, Greece, Hungary, Iceland, India, Indonesia, Iran, Ireland, Italy, Japan, Kazakhstan, South Korea, Latvia, Liechtenstein, Lithuania, Luxembourg, Malaysia, Malta, Mexico, Monaco, Netherlands, New Zealand, Nigeria, Norway, Pakistan, Papua New Guinea, Peru, Poland, Portugal, Romania, Russia, Saudi Arabia, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Thailand, Turkey, Ukraine, United Kingdom, United States, Venezuela

315

Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) | Open  

Open Energy Info (EERE)

Plan for Forest Law Enforcement Governance and Trade (FLEGT) Plan for Forest Law Enforcement Governance and Trade (FLEGT) Jump to: navigation, search Name Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) Agency/Company /Organization European Union Sector Land Focus Area Forestry Topics Policies/deployment programs Resource Type Lessons learned/best practices Website http://eur-lex.europa.eu/smart Country Belgium, Bulgaria, Czech Republic, Denmark, Germany, Estonia, Ireland, Greece, Spain, France, Italy, Cyprus, Latvia, Lithuania, Luxembourg, Hungary, Malta, Netherlands, Austria, Poland, Portugal, Romania, Slovenia, Slovakia, Slovenia, Finland, Sweden, United Kingdom Western Europe, Eastern Europe, Eastern Europe, Northern Europe, Western Europe, Northern Europe, Northern Europe, Southern Europe, Southern Europe, Western Europe, Southern Europe, Western Asia, Northern Europe, Northern Europe, Western Europe, Eastern Europe, Southern Europe, Western Europe, Western Europe, Eastern Europe, Southern Europe, Eastern Europe, Southern Europe, Eastern Europe, Southern Europe, Northern Europe, Northern Europe, Northern Europe

316

International Energy Outlook 2006  

Gasoline and Diesel Fuel Update (EIA)

Regional Definitions Regional Definitions The six basic country groupings used in this report (Figure J1) are defined as follows: *OECD (18 percent of the 2006 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2006 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2006 world population)-Albania, Armenia, Azer- baijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Romania, Russia, Serbia and Montenegro, Slovenia,

317

Greenhouse Gas Emission Trends and Projections in Europe 2009 | Open Energy  

Open Energy Info (EERE)

Greenhouse Gas Emission Trends and Projections in Europe 2009 Greenhouse Gas Emission Trends and Projections in Europe 2009 Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Greenhouse Gas Emission Trends and Projections in Europe 2009 Agency/Company /Organization: European Environment Agency Topics: Baseline projection, GHG inventory, Background analysis Resource Type: Maps Website: www.eea.europa.eu/publications/eea_report_2009_9 Country: Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Italy, Latvia, Lithuania, Luxembourg, Malta, Netherlands, Poland, Portugal, Ireland, Romania, Slovakia, Slovenia, Spain, Sweden, United Kingdom UN Region: "Western & Eastern Europe" is not in the list of possible values (Eastern Africa, Middle Africa, Northern Africa, Southern Africa, Western Africa, Caribbean, Central America, South America, Northern America, Central Asia, Eastern Asia, Southern Asia, South-Eastern Asia, Western Asia, Eastern Europe, Northern Europe, Southern Europe, Western Europe, Australia and New Zealand, Melanesia, Micronesia, Polynesia, Latin America and the Caribbean) for this property.

318

Ecofys-Country Fact Sheets | Open Energy Information  

Open Energy Info (EERE)

Ecofys-Country Fact Sheets Ecofys-Country Fact Sheets (Redirected from Ecofys Country Fact Sheets) Jump to: navigation, search Tool Summary Name: Ecofys Country Fact Sheets Agency/Company /Organization: Ecofys Sector: Energy, Land Topics: Background analysis, Baseline projection, GHG inventory, Policies/deployment programs Website: www.ecofys.com/files/files/ecofys_2011_country_factsheets_update.pdf Country: Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Colombia, Croatia, Cyprus, Czech Republic, Denmark, Estonia, European Union, Finland, France, Germany, Greece, Hungary, Iceland, India, Indonesia, Iran, Ireland, Italy, Japan, Kazakhstan, South Korea, Latvia, Liechtenstein, Lithuania, Luxembourg, Malaysia, Malta, Mexico, Monaco, Netherlands, New Zealand, Nigeria, Norway, Pakistan, Papua New Guinea, Peru, Poland, Portugal, Romania, Russia, Saudi Arabia, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Thailand, Turkey, Ukraine, United Kingdom, United States, Venezuela

319

Appendix K: Regional Definitions  

Gasoline and Diesel Fuel Update (EIA)

K K Regional Definitions The six basic country groupings used in this report (Figure K1) are defined as follows: *OECD (18 percent of the 2008 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2008 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2008 world population)-Albania, Armenia, Azerbaijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Montenegro, Romania, Russia, Serbia, Slovenia,

320

International Energy Outlook 1999 - Notes and Sources  

Gasoline and Diesel Fuel Update (EIA)

sources.gif (4045 bytes) sources.gif (4045 bytes) [1] Turkey and Belarus are Annex I nations that have not ratified the Framework Convention on Climate Change and did not commit to quantifiable emissions targets under the Kyoto Protocol. [2] The Annex I countries under the Framework Convention on Climate Change are Australia, Austria, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Lithuania, Luxembourg, the Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, the Ukraine, the United Kingdom, and the United States. Turkey and Belarus are also considered Annex I countries, but neither has agreed to any limits on greenhouse gas emissions.

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

International Energy Outlook 2007  

Gasoline and Diesel Fuel Update (EIA)

K K Regional Definitions The six basic country groupings used in this report (Figure K1) are defined as follows: *OECD (18 percent of the 2007 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2007 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2007 world population)-Albania, Armenia, Azerbaijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Montenegro, Romania, Russia, Serbia, Slovenia,

322

Liquid metal MHD experimental activities for LLCB TBM development  

Science Journals Connector (OSTI)

Abstract In Indian Lead Lithium cooled Ceramic Breeder (LLCB) blanket concept, LeadLithium (PbLi) liquid metal is used to extract heat from its own bulk volume and also from the neighboring solid breeder zones. The moderate flow velocity of PbLi inside the module can be significantly modified due to MHD effects, which arise because of the presence of strong toroidal magnetic field. Recently, two MHD experiments have been jointly carried out at Institute of Physics, University of Latvia (IPUL) with hot PbLi (?350?C) as the working fluid under a strong transverse magnetic field of up to ?4.0T. The uncoated test sections are made of SS316L material and consist of LLCB TBM relevant flow geometries, such as rectangular and circular flow cross-sections, 90? bends, rectangular to circular flow transition region. The details of the liquid metal MHD experimental set up and experimental results are discussed in this paper.

Rajendraprasad Bhattacharyay; Anita Patel; Rajendrakumar Ellappan; Pravat K. Swain; Polepalle Satyamurthy; Sushil Kumar; Sergei Ivanov; Andrew Shishko; Erik Platacis; Anatoli Ziks

2013-01-01T23:59:59.000Z

323

A Parkinsonian Syndrome in Methcathinone Users and the Role of Manganese  

Science Journals Connector (OSTI)

...antibodies, CD4 lymphocyte counts, and liver function. In addition, serum ceruloplasmin and copper levels were measured. MRI was performed with a General Electric 1.0T Signa Horizon LX high-speed system with head coil and a standardized magnetic resonance examination protocol; sagittal, axial, and coronal T1... In this case series of 23 adults in Latvia who were injection users of methcathinone (a drug manufactured by users from readily available pharmaceutical agents such as pseudoephedrine), patients had an extrapyramidal syndrome, elevated serum manganese levels, and MRI abnormalities in the basal ganglia. These findings suggest that methcathinone use can result in neurologic toxic effects from manganese contained in the methcathinone solution.

Stepens A.; Logina I.; Liguts V.

2008-03-06T23:59:59.000Z

324

Electricity consumption and economic growth in transition countries: A revisit using bootstrap panel Granger causality analysis  

Science Journals Connector (OSTI)

Abstract The purpose of this paper is to revisit the Granger causal relationship between electricity consumption and economic growth for 15 transition economies for the period 19752010 using a bootstrap panel causality approach that allows for both cross-sectional dependency and for heterogeneity across countries. Applying this approach, we found a unidirectional causality running from electricity consumption to economic growth only in Belarus and Bulgaria; from economic growth to electricity consumption in the Czech Republic, Latvia, Lithuania and the Russian Federation; bidirectional causality only in Ukraine while no Granger causality in any direction in Albania, Macedonia, Moldova, Poland, Romania, Serbia, Slovak Republic and Slovenia. These results show that there is a limited support for the electricity-led growth hypothesis. Nevertheless these different findings provide important implications for energy strategies and policies for transition countries.

Yemane Wolde-Rufael

2014-01-01T23:59:59.000Z

325

Commercial Viability of Strategic Choice on Green Energy Business: Hydro Power versus Wind Power (Latvian case)  

Science Journals Connector (OSTI)

Development of green energy, especially such types as hydropower and wind power, presents great opportunities for companies growth. The aim of the paper is to investigate commercial viability of green energy business to make an investment choice for Latvian privately owned small sized hydropower producer and seller LLCGreen Energy Solutions (GES). Firstly the paper investigated theoretical and practical application of such concept of commercial viability of a strategy as a SFA: suitability, feasibility and acceptability. Then the latest trends of Green Energy Business in EU and in Latvia have been explored and strategic suitability has been defined. Secondly, to confirm or disprove investments in a hydropower station or wind turbine, Equivalent annual annuities of each alternative investment project have been calculated and financial feasibility has been discussed. Finally, recommendations for stakeholders regarding further growth of company GES and acceptability of given strategic choice have been reviewed in detail.

Andrejs ?irjevskis; Jekaterina Novikova

2012-01-01T23:59:59.000Z

326

Dual fuel study for the Liepaja Thermal Power Plant. Final report. Export trade information  

SciTech Connect (OSTI)

This study, conducted by Burns and Roe Company, was funded by the U.S. Trade and Development Agency. The report presents the results of engineering studies performed for Latvenergo-the National Electric Utility of Latvia. The work performed is a supplement to a previous study, completed in January, 1994, that defined the basic plant design and site selection for the 300 MW coal-fired plant. The current study expands on the previous work in two main areas; the technical and economic feasibility of integrating natural gas firing technologies into the plant design, and aspects of additional plant site not previously considered. The report is divided into the following sections: (1) Introduction; (2) Technical and Economic Aspects of Plant Design For Dual Capability; (3) Assessment of Natural Gas Supplies; (4) Evaluation of Candidate Sites. Appendices A-C follows.

NONE

1996-04-01T23:59:59.000Z

327

UNFCCC-Global Map-Annex 1 | Open Energy Information  

Open Energy Info (EERE)

UNFCCC-Global Map-Annex 1 UNFCCC-Global Map-Annex 1 Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Global Map-Annex 1 Agency/Company /Organization: United Nations Framework Convention on Climate Change, United Nations Environment Programme Sector: Climate Topics: Baseline projection, Co-benefits assessment, GHG inventory Resource Type: Maps, Software/modeling tools User Interface: Website Website: maps.unfccc.int/di/map/ Country: Australia, Austria, Belarus, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Monaco, Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, Turkey, Ukraine, United Kingdom, United States

328

International Energy Outlook 2000 - Notes & Sources  

Gasoline and Diesel Fuel Update (EIA)

To International Forecasting Home Page To International Forecasting Home Page To Annual Energy Outlook 2000 bullet1.gif (843 bytes) To Forecasting Home Page bullet1.gif (843 bytes) EIA Homepage [1] Turkey and Belarus are Annex I nations that have not ratified the Framework Convention on Climate Change and did not commit to quantifiable emissions targets under the Kyoto Protocol. [2] The Annex I countries under the Framework Convention on Climate Change are Australia, Austria, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Lithuania, Luxembourg, the Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, the Ukraine, the United Kingdom, and the United States. Turkey and Belarus are also considered Annex I countries, but neither has agreed to any limits on greenhouse gas emissions.

329

Gas Storage Technology Consortium  

SciTech Connect (OSTI)

Gas storage is a critical element in the natural gas industry. Producers, transmission and distribution companies, marketers, and end users all benefit directly from the load balancing function of storage. The unbundling process has fundamentally changed the way storage is used and valued. As an unbundled service, the value of storage is being recovered at rates that reflect its value. Moreover, the marketplace has differentiated between various types of storage services, and has increasingly rewarded flexibility, safety, and reliability. The size of the natural gas market has increased and is projected to continue to increase towards 30 trillion cubic feet (TCF) over the next 10 to 15 years. Much of this increase is projected to come from electric generation, particularly peaking units. Gas storage, particularly the flexible services that are most suited to electric loads, is critical in meeting the needs of these new markets. In order to address the gas storage needs of the natural gas industry, an industry-driven consortium was created-the Gas Storage Technology Consortium (GSTC). The objective of the GSTC is to provide a means to accomplish industry-driven research and development designed to enhance operational flexibility and deliverability of the Nation's gas storage system, and provide a cost effective, safe, and reliable supply of natural gas to meet domestic demand. This report addresses the activities for the quarterly period of July 1, 2006 to September 30, 2006. Key activities during this time period include: {lg_bullet} Subaward contracts for all 2006 GSTC projects completed; {lg_bullet} Implement a formal project mentoring process by a mentor team; {lg_bullet} Upcoming Technology Transfer meetings: {sm_bullet} Finalize agenda for the American Gas Association Fall Underground Storage Committee/GSTC Technology Transfer Meeting in San Francisco, CA. on October 4, 2006; {sm_bullet} Identify projects and finalize agenda for the Fall GSTC Technology Transfer Meeting, Pittsburgh, PA on November 8, 2006; {lg_bullet} Draft and compile an electronic newsletter, the GSTC Insider; and {lg_bullet} New members update.

Joel L. Morrison; Sharon L. Elder

2006-09-30T23:59:59.000Z

330

Re-evaluation of the 1995 Hanford Large Scale Drum Fire Test Results  

SciTech Connect (OSTI)

A large-scale drum performance test was conducted at the Hanford Site in June 1995, in which over one hundred (100) 55-gal drums in each of two storage configurations were subjected to severe fuel pool fires. The two storage configurations in the test were pallet storage and rack storage. The description and results of the large-scale drum test at the Hanford Site were reported in WHC-SD-WM-TRP-246, ''Solid Waste Drum Array Fire Performance,'' Rev. 0, 1995. This was one of the main references used to develop the analytical methodology to predict drum failures in WHC-SD-SQA-ANAL-501, 'Fire Protection Guide for Waste Drum Storage Array,'' September 1996. Three drum failure modes were observed from the test reported in WHC-SD-WM-TRP-246. They consisted of seal failure, lid warping, and catastrophic lid ejection. There was no discernible failure criterion that distinguished one failure mode from another. Hence, all three failure modes were treated equally for the purpose of determining the number of failed drums. General observations from the results of the test are as follows: {lg_bullet} Trash expulsion was negligible. {lg_bullet} Flame impingement was identified as the main cause for failure. {lg_bullet} The range of drum temperatures at failure was 600 C to 800 C. This is above the yield strength temperature for steel, approximately 540 C (1,000 F). {lg_bullet} The critical heat flux required for failure is above 45 kW/m{sup 2}. {lg_bullet} Fire propagation from one drum to the next was not observed. The statistical evaluation of the test results using, for example, the student's t-distribution, will demonstrate that the failure criteria for TRU waste drums currently employed at nuclear facilities are very conservative relative to the large-scale test results. Hence, the safety analysis utilizing the general criteria described in the five bullets above will lead to a technically robust and defensible product that bounds the potential consequences from postulated fires in TRU waste facilities, the means of storage in which are the Type A, 55-gal drums.

Yang, J M

2007-05-02T23:59:59.000Z

331

Western Greenbrier Co-Production Demonstration Project Draft Environmental Impact Statement  

Broader source: Energy.gov (indexed) [DOE]

Figure S-1. Figure S-1. General Location Map U.S. Department of Energy National Energy Technology Lab Western Greenbrier Co-Production Demonstration Project DEIS November 2006 WV 20 S 12 S 63 WV 39 Proposed Co- Production Facility Anjean and Joe Knob Coal Refuse Piles U S 6 0 U S 6 0 US 219 WV 20 WV 39 AN1 AN2 AN3 DN1 DN2 GV W V 2 0 U S 6 0 C R 1 Figure 1-1. General Location Map U.S. Department of Energy National Energy Technology Lab Western Greenbrier Co-Production Demonstration Project DEIS November 2006 WV 20 S 12 S 63 WV 39 Proposed Co- Production Facility Anjean and Joe Knob Coal Refuse Piles U S 6 0 U S 6 0 US 219 WV 20 WV 39 AN1 AN2 AN3 DN1 DN2 GV W V 2 0 U S 6 0 C R 1 S 63 Rainelle Anjean Quinwood Charmco Lewisburg Savannah Quarry Greystone Quarry Boxley Quarry Anjean and Joe Knob Coal Refuse Piles Green Valley Coal Refuse Pile

332

SPECTRA OF COSMIC-RAY PROTONS AND HELIUM PRODUCED IN SUPERNOVA REMNANTS  

SciTech Connect (OSTI)

Data obtained in the Advanced Thin Ionization Calorimeter (ATIC-2), Cosmic Ray Energetics and Mass (CREAM), and Payload for Antimatter Matter Exploration and Light-nuclei Astrophysics (PAMELA) experiments suggest that the elemental interstellar spectra of cosmic rays below the knee at a few times 10{sup 6} GeV are not simple power laws, but that they experience hardening at a magnetic rigidity of about 240 GV. Another essential feature is the difference between proton and helium energy spectra, such that the He/p ratio increases by more than 50% in the energy range from 10{sup 2} to 10{sup 4} GV. We consider the concavity of the particle spectrum resulting from the nonlinear nature of diffusive shock acceleration in supernova remnants (SNRs) as a possible reason for the observed spectrum hardening. The increase of the helium-to-proton ratio with energy can be interpreted as a consequence of cosmic-ray acceleration by forward and reverse shocks in SNRs. The contribution of particles accelerated by reverse shocks makes the concavity of the produced overall cosmic-ray spectrum more pronounced. The spectra of protons and helium nuclei accelerated in SNRs and released into the interstellar medium are calculated. The derived steady-state interstellar spectra are in reasonably good agreement with observations.

Ptuskin, Vladimir; Zirakashvili, Vladimir [Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radio Wave Propagation of the Russian Academy of Science (IZMIRAN), Troitsk, Moscow Region 142190 (Russian Federation)] [Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radio Wave Propagation of the Russian Academy of Science (IZMIRAN), Troitsk, Moscow Region 142190 (Russian Federation); Seo, Eun-Suk [Department of Physics and Institute of Physical Science and Technology, University of Maryland, College Park, MD 20742 (United States)] [Department of Physics and Institute of Physical Science and Technology, University of Maryland, College Park, MD 20742 (United States)

2013-01-20T23:59:59.000Z

333

Search of Axions from a Nuclear Power Reactor with a High-Purity Germanium Detector  

E-Print Network [OSTI]

A search of axions produced in nuclear transitions was performed at the Kuo-Sheng Nuclear Power Station with a high-purity germanium detector of mass 1.06 kg at a distance of 28 m from the 2.9 GW reactor core. The expected experimental signatures were mono-energetic lines produced by their Primakoff or Compton conversions at the detector. Based on 459.0/96.3 days of Reactor ON/OFF data, no evidence of axion emissions were observed and constraints on the couplings $\\gagg$ and $\\gaee$ versus axion mass $m_a$ within the framework of invisible axion models were placed. The KSVZ and DFSZ models can be excluded for 10^4 eV < m_a < 10^6 ~eV. Model-independent constraints on \\gagg \\gv1 < 7.7 X 10^{-9} GeV^{-2} for m_{a} < 10^5 eV and \\gaee \\gv1 < 1.3 X 10^{-10} for m_{a} < 10^6 eV at 90% confidence level were derived. This experimental approach provides a unique probe for axion mass at the keV--MeV range not accessible to the other techniques.

H. M. Chang; TEXONO Collaboration

2006-09-01T23:59:59.000Z

334

The GALAXIE all-optical FEL project  

SciTech Connect (OSTI)

We describe a comprehensive project, funded under the DARPA AXiS program, to develop an all-optical table-top X-ray FEL based on dielectric acceleration and electromagnetic undulators, yielding a compact source of coherent X-rays for medical and related applications. The compactness of this source demands that high field (>GV/m) acceleration and undulation-inducing fields be employed, thus giving rise to the project's acronym: GV/m AcceLerator And X-ray Integrated Experiment (GALAXIE). There are numerous physics and technical hurdles to surmount in this ambitious scenario, and the integrated solutions include: a biharmonic photonic TW structure, 200 micron wavelength electromagnetic undulators, 5 {mu}m laser development, ultra-high brightness magnetized/asymmetric emittance electron beam generation, and SASE FEL operation. We describe the overall design philosophy of the project, the innovative approaches to addressing the challenges presented by the design, and the significant progress towards realization of these approaches in the nine months since project initialization.

Rosenzweig, J. B.; Arab, E.; Andonian, G.; Cahill, A.; Fitzmorris, K.; Fukusawa, A.; Hoang, P.; Jovanovic, I.; Marcus, G.; Marinelli, A.; Murokh, A.; Musumeci, P.; Naranjo, B.; O'Shea, B.; O'Shea, F.; Ovodenko, A.; Pogorelsky, I.; Putterman, S.; Roberts, K.; Shumail, M. [Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); Dept. of Mechanical and Nuclear Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); and others

2012-12-21T23:59:59.000Z

335

Theoretical study of thorium monoxide for the electron electric dipole moment search, II: Electronic properties of $H^3\\Delta_1$ in ThO  

E-Print Network [OSTI]

Recently an improved limits on the electron electric dipole moment, \\eEDM, and dimensionless constant, $k_{T,P}$, characterizing the strength of the T,P-odd pseudoscalar$-$scalar electron$-$nucleus neutral current interaction in the $H^3\\Delta_1$ state of ThO molecule were obtained by ACME collaboration [Science 343, 269 (2014)]. The interpretation of the experiment in terms of fundamental quantities \\eEDM\\ and $k_{T,P}$ is based on the results of theoretical study of appropriate ThO characteristics, the effective electric field acting on electron, \\Eeff, and a parameter of the T,P-odd pseudoscalar$-$scalar interaction, $W_{T,P}$, given in [J.Chem.Phys.\\ 139, 221103 (2013)] by St.Petersburg group. To reduce the uncertainties of the given limits we report improved calculations of the molecular state$-$specific quantities \\Eeff, 81.5~GV/cm, and $W_{T,P}$, 112~kHz, with the uncertainty within 7\\% of the magnitudes. Thus, the values recommended to use for the upper limits of the quantities are 75.8~GV/cm and 104~...

Skripnikov, L V

2014-01-01T23:59:59.000Z

336

OpenEI - efficiency  

Open Energy Info (EERE)

Appliance Data - Appliance Data - Central Air Conditioners - 2010 http://en.openei.org/datasets/node/132 View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers.  Data includes cooling capacity, cooling performance, heating capacity, and heating performance.   Spreadsheet was created by combining the tables in pdf files that are included in the zip file.

License
Type of License: 

337

Grain shape variation and sedimentary processes of the Neogene-Quaternary sediments in Baffin Bay and Labrador Sea  

E-Print Network [OSTI]

, and the Labrador and Baffin Islands of Canada to the west (Fig. 1). Most of the two basins have water depths between 2000 to 3000 meters. The two basins are separated by the Davis Strait Sill which is only 700 meters at its deepest point (Srivastava et al... + . lo 9 s lg Te r I i a r y ? L a l e Cretaceous Early Crolacoous? Jurassic Tr assic Permian ? Devonian EIIIIII S i 1 u r i a n ? C s m 0 r i a rl l T Precambrian Paleocene basalls L. S:Lancaster Sound N. S: Nares Slrail 0 160 320 460 640...

Shan, Yongtang

2012-06-07T23:59:59.000Z

338

Retention of neptunium in uranyl alteration phases formed during spent fuel corrosion  

SciTech Connect (OSTI)

Uranyl oxide hydrate phases are known to form during contact of oxide spent nuclear fuel with water under oxidizing conditions; however, less is known about the fate of fission and neutron capture products during this alteration. We describe, the first time, evidence that neptunium can become incorporated into the uranyl secondary phase, dehydrated schoepite (UO{sub 3}{lg_bullet}0.8H{sub 2}O). Based on the long-term durability of natural schoepite, the retention of neptunium in this alteration phase may be significant during spent fuel corrosion in an unsaturated geologic repository.

Buck, E.C.; Finch, R.J.; Finn, P.A.; Bates, J.K.

1997-10-01T23:59:59.000Z

339

An evaluation of livestock market news services in Texas  

E-Print Network [OSTI]

AN EVALUATION QF LIVESTOCK NAliET HENS SERVICES IN TEXAS A Thesis Nilbert H. Na1ther f4 0 V Q f7l e Ql 0 Approved as to style and content bym Ch of Committee) (H a of Departnent or Student visor June lg+ KN EVlJZATION GF LIVESTOCK... ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ 3, i cs oc: aol ' tin'cu . , " -c+' ons i. . To. "a", 1949-1953 , . . . . . . . 63 1. :h. So;reer, at f, "r ri;ixt, liv. , ". tock t)arkot news reporter, chocks with commission nan on price received for pen ot' sheep...

Walther, Wilbert Henry

2012-06-07T23:59:59.000Z

340

Fattening Lambs on Corn, Milo, Hegari, Wheat, and Oats, with Cottonseed Cake and Alfalfa  

E-Print Network [OSTI]

. **In cooperation with U. S. Department of Agriculture. ??On leave. $In cooperation with Texas Extension Service. Four feeding trials were conducted to compare lamb-fatten- ng rations using different common grains with alfalfa hay .s the roughage.... - - Year of Trial 1 1927-28 1 1928-19 1928-29 I 1929-30 1929-in - ,,. - -- -- lg.1; 1 Milo 49.4 Leligth of feeding 'period (days) Grain fed with cottonseed cake and alfalfa --I Average initial weight of lambs, Ibs. Increased daily gain due...

Mackey, A. K. (Arthur Kapp); Jones, J. M. (John McKinley)

1932-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Model of calcareous deposit formation on cathodically protected steel in seawater: improvements and extensions  

E-Print Network [OSTI]

( ? ) g dm3 mol . dme conuersion factor ( ) g. cms (20) 16 Concentration of Major iona in Seawater of Various Salinitles . 1. 6 20- CII ' 15 oO j. :zto f o L o 0 . 0--- X -??)???&X e3-- X X X ? X- 10 20 30 40 Salinity('lg O s. 'o . 12 ~g... e of + 0 0. 6 o~ ox MCI ? tt ? Nt+ /~a- / ? + ? h/g+ ) ? o ? Ca2+ f ? x ? HXB. Fi8trre 6: Concentration of Major Iona in Seawater of Various Salinities and) At ? ? 49. 641 Ag = 67. 460 As ? 21. 028 Bt = ? 0. 077314 B2 = 0. 046580 Bs...

Blackburne, Patricia Nicole

2012-06-07T23:59:59.000Z

342

An evaluation of the respiratory hazards found in silk screen printing, Texas Department of Criminal Justice, Beto I unit  

E-Print Network [OSTI]

2097 June 2, 1995 Revised: August 4, 1995 Mr. J. Torey Nalbone Texas Department of criminal Justice P, O. Box 99 Huntsville, TX 77342-0099 952360 lg't 1F l0 /r, N ~%7 Agg 1596 'l', . -. AX937I cg on ~;rp '~e~epgq7. s&" A. T. Armstrong... 0. 01 0, 007 0. 12 0. 12 0. 06 0. 02 0. 02 ppm ppm ppm ppm PPal ppm ppnl ' pp , ppm CT - Charcoal tube 44 ArmStrong porensic Laboratory, Report 95IH1610 Page 2 Inc. Lab Client Number Number Sample Air T e Volume Test Ae...

Robertson, Christina Elisabeth

1995-01-01T23:59:59.000Z

343

Universitt Hannover Studierendenstatistik WS 2000/01 Studiengang Abschlu-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

LR 1 8 1 10 11 10 41 21 2 LGH 8 3 2 2 15 8 2 LGHR HR 8 4 5 1 18 8 LBS Bf. 16 4 4 5 3 1 2 3 38 15 LSo 106 35 13 27 5 27 78 834 810 73 BSc. 7 7 7 2 LG 28 18 15 2 9 18 14 20 124 60 1 LR 1 3 2 5 11 6 LGH 1 1 17 LGH 1 1 0 LGHR HR 5 4 3 1 13 7 1 LSo 9 3 2 14 3 Promotion 1 15 16 16 Geologie Diplom 1 1 1 24 1 13

Vollmer, Heribert

344

In situ tomography of femtosecond optical beams with a holographic knife-edge  

E-Print Network [OSTI]

using a grating similar to that shown in Fig. 3(a) with 160 m?? ? and 2? ?? . The discontinuity at x was scanned, and the knife-edge data was recorded by a photodiode. The waist of the Gaussian beam was found to be roughly ~2 mm, which... a distance of 100f ? cm away from the SLM, PD = photodiode power meter head, PM = power meter. The upper left inset is an example- hologram to create a 2,2 o LG beam followed by an angular knife-edge. This setup is similar in design...

Strohaber, James; Kaya, G; N, Kay; Hart, Nathan; Kolomenskii, Alexander; Paulus, Gerhard; Schuessler, Hans

2011-07-18T23:59:59.000Z

345

Masses of Kr-77 and Kr-75  

E-Print Network [OSTI]

PHYSICAL REVIEW C VOLUME 35, NUMBER 4 Masses of Kr and Kr APRIL 1987 D. M. Moltz Nuclear Science Division, Lawrence Berkeley Laboratory, University of California, Berkeley, California 94720 A. C. Betker, J. P. Sullivan, R. H. Burch, C. A... determinations of neutron deficient nu- clei between the 1f7/2 and lg9/2 shells are hampered by low production cross sections and complex decay schemes. The direct mass measurements' of the rubidium isotopes have provided a substantial base for other...

Moltz, D. M.; Betker, A. C.; Sullivan, J. P.; Burch, R. H.; Gagliardi, Carl A.; Tribble, Robert E.; Toth, K. S.; Avignone, F. T.

1987-01-01T23:59:59.000Z

346

Determination of the ratio of specific heats for gases through the use of electrosonics  

E-Print Network [OSTI]

jfier+ + ~ e' e a e e a ?e e e e Velooity of Sound for Pure Propane ? ~ Variation of ~ ~ with Preeeure for Pure (at)T Propane' a a m m E a a w ~ a Ratio of Syeeifio Heate for Pure Propane- Oosparieon of V Data for Different Oaeee gl g6 ~Tab o... data ior Cho ratio of sposifio heatsi V& are re? e 0 ported for gaseous propane at 100 F~ and lg0 pg snd for pressures up to @0 pounds por square inch absolutes Tho ratio of speoifis heats is determsinsd for gaseous propane fran Che vsleoity...

Cretsinger, James Hubert

2012-06-07T23:59:59.000Z

347

A management information system model for convenience stores  

E-Print Network [OSTI]

Najor Subject: Agricultural Economics A MANAGEMENT INFORMATION SYSTEM MODEL FOR CONVENIENCE STORES A Thesfs by ERIC ARNE MOEDE Approved as to style and content by: Chairman of o ittee Dr. Willfam J. stine Head of Department Dr. Clfve R. Harston... Member Dr. Samuel M. Gillespie Mem er Dr, John I. Reynolds Member Dr. Thomas L. Sporleder December 1978 ABSTPJ CT A Management Information System I'1odel For Convenience Stores (December lg78 l Eric Arne I'loede, B. B. A. , Texas ARM University...

Moede, Eric Arne

1978-01-01T23:59:59.000Z

348

MnII (TCNE)3/2(I3)1/2 - A 3-D Network-structured Organic-based Magnet and Comparison to a 2-D Analog  

SciTech Connect (OSTI)

Mn{sup II}(TCNE){sub 3/2}(I{sub 3}){sub 1/2} and Mn{sup II}(TCNE)[C{sub 4}(CN){sub 8}]{sub 1/2} [tetracyanoethylene (TCNE)] are organic-based magnets with 3D and 2D extended network structures with vastly different magnetic behavior. They have similar ferrimagnetic coupled layers of Mn{sup II}(TCNE){sup {lg_bullet}-} with different interlayer couplings, which lead, respectively, to net ferrimagnetic (T{sub c} = 171 K) and antiferromagnetic (T{sub c} = 68 K) order.

Stone, K.; Stephens, P; McConnell, A; Shurdha, E; Pokhodnya, K; Miller, J

2010-01-01T23:59:59.000Z

349

The effects of certain chemical additives and seedbed profiles on the strength of soil crust  

E-Print Network [OSTI]

energence as affected by the flat type furrow - 27 14. Seedlings which energed in a flat furrow in which the soil surfactant had bean applied 29 15. Seedlings which energed in a flat furrow in which the soil fracturing agent hsd been applied ~~- o ~~~ i... ?29 16, Seedling energence in a flat furrow in which the soil surfactant and no siuulated rainfall was applied i - -~ 30 17. Seedling energence as affected by the 'Y' type furrow 31 vi lg. Seedling energence in a "8" type furrow in which the soil...

Cochran, Billy Juan

2012-06-07T23:59:59.000Z

350

The effect of the 1954 tax code on the accounting for depreciation  

E-Print Network [OSTI]

. : 6'. ~ de?dc ; ? excess of actual earnin?-, s. . , 'nen viewed 1 t& . c 1 j' t the bus1ness !1&ul places more c, . ! &h"!. ? sis on deprec&; t. ' o'. . The 3. arp, er the depreciation write- '. ". ". . '. . ". "':;-. -:itute of Accountants, Best...'ent themselves arel (l j "h-t provist one for accelorat, ed depreciation shall the taxrmyer adoptt (2) 'hell the taxpayer discard th, . old assets snd replace them with new asset. s, be 0;Lv. 3r of th&. ec(Nxomio &mphaci ' lg, ac'. 'd o. 'I Bt write offs...

Faubus, Alfred Overton

2012-06-07T23:59:59.000Z

351

Protein levels and lysine supplementation of sorghum grain-soybean meal rations for growing-finishing swine  

E-Print Network [OSTI]

leanness and cost of gain. One hundred and ninety-two pigs were group-fed (8 pigs per pen) and 108 were fed in individual pens. Six protein regimes; 19-16, 16-16, 16-13, 13-13, 13 + 0. 2X L-lysins-13 + O. lg L-lysine and free-choice grain and sup... desirable. Feed cost per unit gain was significantly cheaper for the free-choice treatment than the other five regimes; however, the rate of gain of the free-choice group was significantly lower than the 19-16, 16-16, 16-13 and 13+ lysine groups. In a...

Escobosa, Adrian

2012-06-07T23:59:59.000Z

352

Nuclear magnetic resonances in weak fields  

E-Print Network [OSTI]

first choax@ation of nuclear resonances in weak f le). de was sade by k 0, S~ in fiel4u of 6 and lg gauss using a sanple siue of. 1 liter, The nagnetic fields were produced in a solenoi4 pou?x?d by a bazdz of lead storage batteriesx an4 the resonances..., Tbe poser was pxovided for the static nagnetic field by a bank of 20 lead storage cells connected in ssriesi The current was a+usted to the desired value with a variable xesistanoe which was connected in sex'ies with the solenoid. Qm source of field...

Mitchell, Richard Warren

2012-06-07T23:59:59.000Z

353

Examples involving shrinking conditions of fixed point theorems  

E-Print Network [OSTI]

, 'NCE December i&70 Major SubDect: M, ther. atics 0 S E z EXP~LES INVOLVI'. &G SHPINEIIlG COEDITIOIJS OP 1 IZED POIl'I I TEEOREi'!S a z lg o o Pi Vl W Sl 5 0 A Thesis by DOUGLAS ANJHZW SJIAPP Approved as to style and content, oy... fash? on. However, shall focus our . i. nterest on the inability of one condition to oe deri ved from another. 'dhen this ' s the case, an example will show the point o " impasse. ACKI1GWLZDG~PJ&TH I wish to thank the following people...

Sharp, Douglas Andrew

2012-06-07T23:59:59.000Z

354

An exposure assessment survey of the Mont Belvieu polyethylene plant  

E-Print Network [OSTI]

exposure health risks based on quantitative and qualitative data; ~ Provide a quality tool for standardizing the measurement of workplace exposure health risk; and ~ Provide a means for an immediate and out-of-cycle exposure assessment following... with indicator substances in corres ondin RAC Worker Group HCW Kl K3 K5 Ll Lg L9 Number of RACs with Rankin of I Number of RACs Number of RACs with Rankin of 2 with Rankin of 3 The results from the exposure assessment of individual job tasks, based...

Tucker, Thomas Franklin

2012-06-07T23:59:59.000Z

355

The use of elastomeric pads as bearings for steel beams  

E-Print Network [OSTI]

SCIEWCE August lg6S Ma)or Subjects Civil Eugiueeriag THE HSE OP BIASTMEEXC PASS AS EEARIHCS FOR STEE7 SEAMS A Thesis Hardy E. Fairbanks Approved as to style and content by; Chairnan of Coeeittee Head of Separtme t August 1960 TABLE OP CONTENTS... on Richmond Avenue in Houston, Texas Figure 5 Current Practice Concerning the Use of Elasto- meric Beazing Pads Pigure 6 Economic Comparison of Conventional and Elasto- 8 meric Bearings Figure 7 Figure 8 Figure 9 Teat Set-Up for Phase I Experimental...

Fairbanks, Hardy Ewald

2012-06-07T23:59:59.000Z

356

Data:479bdbf6-c343-445a-b54d-893f27908180 | Open Energy Information  

Open Energy Info (EERE)

bdbf6-c343-445a-b54d-893f27908180 bdbf6-c343-445a-b54d-893f27908180 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: South Carolina Pub Serv Auth Effective date: 2012/12/01 End date if known: Rate name: GV-12 (Seasonal General Service) Sector: Commercial Description: Applicability: This Schedule is applicable to all commercial customers of the Authority meeting the eligibility requirements of the Authority's Medium General Service Rate Schedule, or its successor. Service hereunder applies to all service of the same voltage and character supplied to the Customer's premises through a single delivery point. Energy and power taken under this Schedule may not be resold or shared with others.

357

Data:5d6fa5d7-b4c0-4b93-b400-eea4e517fc36 | Open Energy Information  

Open Energy Info (EERE)

d7-b4c0-4b93-b400-eea4e517fc36 d7-b4c0-4b93-b400-eea4e517fc36 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Public Service Co of NH Effective date: 2012/01/01 End date if known: Rate name: Rate GV, Commercial and Industrial INDUSTRIAL Sector: Commercial Description: Source or reference: http://www.psnh.com/RatesTariffs/Business/Small-Business-Rates.aspx Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

358

bns_for_NLC.dvi  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2, 10/02/99 2, 10/02/99 KEK -aaa-bbb SLAC - www-xxx BNS Profiles and Sensitivity of Beam Orbit of the NLC Linac February 10, 1999 G.V. Stupakov Stanford Linear Accelerator Center Stanford, CA, USA Abstract: Using the computer program LIAR we simulate different BNS regimes in the main NLC linac. The energy overhead for each regime is determined, and both the orbit sensitivity for a small quadrupole offset, and ATL-type ground motion are calculated. A single bunch emittance growth caused by initial offset, slope and tilt of the bunch is also simulated.. BNS Pro les and Sensitivity of Beam Orbit in the NLC Linac G. V. Stupakov, SLAC 0.1 BNS Pro les Using simulation code LIAR 1 , we calculated the emittance growth of a single bunch in the NLC linac due to short-range wake eld a= = 0:18 for the lattice

359

Microsoft Word - Voronina_OthHyd_PE_NEW.rtf  

National Nuclear Security Administration (NNSA)

Aminov, Y.A. et al. 1 Aminov, Y.A. et al. 1 NUMERICAL SIMULATION OF EXPERIMENTS WITH COMMERCIAL EXPLOSIVES Y.A. Aminov, N.S. Eskov, G.V. Kovalenko, Y.R. Nikitenko, V.I. Volkov, V.P. Voronina Russian Federal Nuclear Center - Zababakhin Institute of Technical Physics (RFNC-VNIITF) Snezhinsk, Russia The presentation discusses numerical modeling of experiments [1] aimed at testing the properties of the commercial explosive PZhV-20U. Calculations were made with MACH code [2] that models complex 2D flows with account for physical and chemical transformations. A unique approach was used to describe experiments aimed to characterize: - detonation velocity versus diameter for cylindrical explosive charges; - the expansion of detonation-propelled copper sheathes; and

360

Precinct of Woodsville | Open Energy Information  

Open Energy Info (EERE)

Precinct of Woodsville Precinct of Woodsville Jump to: navigation, search Name Precinct of Woodsville Place New Hampshire Utility Id 20980 Utility Location Yes Ownership M NERC Location NPCC NERC NPCC Yes Activity Buying Transmission Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Rate D Commercial Rate G (Consolidated Electric Tariff General Service) Commercial Rate G (Consolidated Electric Tariff General Service)(3.0 kW OR greater) Commercial Rate GV Consolidated Electric Tariff Industrial General At Primary Voltage Commercial Average Rates Residential: $0.1650/kWh

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Linear Collider Collaboration Tech Notes  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Notes Notes LCC - 0018, 15/06/99 Rev B, June 2002 Correct Account of RF Deflections in Linac Acceleration June 15, 1999 G.V. Stupakov Stanford Linear Accelerator Center Stanford, California Abstract: During acceleration in the linac structure, the beam not only increases its longitudinal momentum, but also experiences a transverse kick from the accelerating mode which is linear in accelerating gradient. This effect is neglected in such computer codes as LIAR and TRANSPORT. We derived the Hamiltonian equations that describe the effect of RF deflection into the acceleration process and included it into the computational engine of LIAR. By comparing orbits for the NLC main linac, we found that the difference between the two algorithms is about 10\%. The effect will be more pronounced at smaller

362

LBA-ECO Image and Land Cover Transition Data Sets Published  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Image and Land Cover Transition Data Sets Published Image and Land Cover Transition Data Sets Published The ORNL DAAC announces the publication of image and land cover transition data sets for Mato Grosso, Brazil, for the years 2000-2001 and 2003-2004. These data sets were prepared by D.A. Roberts, I. Numata, K.W. Holmes, G.T. Batista, T. Krug, A.L. Monteiro, R.L. Powell, and O.A. Chadwick. LBA-ECO ND-01 Fractional Land Cover Images, Rondonia, Brazil: 1984-2000. This data set provides fractional land cover type images for shade, green vegetation (GV), non-photosynthetic vegetation (NPV), and soil for the regions of JiParana, PortoVelho, Luiza, Ariquemes, and Cacoal in the state of Rondonia, Brazil, for the period 1984 to 2000. The images were derived with a spectral mixture analysis (SMA) of Landsat Thematic Mapper (TM) time

363

Grouting at the Idaho National Laboratory Tank Farm Facility, R. Mark Shaw  

Broader source: Energy.gov (indexed) [DOE]

Grouting at the Grouting at the Idaho National Laboratory Tank Farm Facility R. Mark Shaw, U. S. Department of Energy safety v performance v cleanup v closure M E Environmental Management Environmental Management 2 Topics/Agenda * Tank Farm Overview * Tank and Vault Grouting * Cooling Coil and Transfer Line Grouting safety v performance v cleanup v closure M E Environmental Management Environmental Management 3 INTEC TANK FARM CLOSURE INTEC TANK FARM CLOSURE VES-WM-103 VES-WM-104 VES-WM-105 VES-WM-106 182 183 185 186 187 189 190 188 184 181 180 Tank Farm Facility Octagon Vaults: WM-180, WM-181 Pillar and Panel Vaults: WM-182, WM-183, WM-184, WM-185, WM-186 Square Vaults: WM-187, WM-188, WM-189, WM-190 GV99 0008 safety v performance v cleanup v closure M E Environmental Management

364

NECDC Word Style Guide (U)  

National Nuclear Security Administration (NNSA)

Eulerian Numerical Techniques EGAK and TREK for Simulation of Eulerian Numerical Techniques EGAK and TREK for Simulation of Multidimensional Multimaterial Flows Yanilkin Yu.V., Belyaev S.P., Bondarenko Yu.A., Gavrilova E.S., Goncharov E.A., Gorbenko A.D., Gorodnichev A.V., Gubkov E.V., Guzhova A.R., Degtyarenko L.I., Zharova G.V., Kolobyanin V.Yu., Sofronov V.N., Stadnik A.L., Khovrin N.A., Chernysheva O.N., Chistyakova I.N., Shemyakov V.N. Russian Federal Nuclear Center, Sarov The paper presents overview of main algorithms underlying Lagrangian-Eulerian techniques EGAK and TREK for simulation of 2D and 3D multimaterial flows with large deformations, including the turbulent mixing phase. Some results of computations are presented that give an estimate of the technique accuracy and efficiency. Introduction

365

Jacob P. Fugal, Scott Spuler Earth Observing Laboratory NCAR, Boulder, CO USA  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

airborne digital holographic airborne digital holographic instrument for measuring the spatial distribution and local size distributions of cloud particles: Holographic Detector for Clouds 2 (HOLODEC 2) Jacob P. Fugal, Scott Spuler Earth Observing Laboratory NCAR, Boulder, CO USA & Raymond A. Shaw Physics Department, michigan Tech Houghton, MI USA C-130 Hercules Q HIAPER Gulfstream GV HOLODEC (Holographic Detector for Clouds) is an airborne instrument that measures the size, shape, and relative 3D position of cloud particles using digital in- line holography. Science Questions for HOLODEC 2 * How do local cloud particle size distributions vary inside cloud regions (edge, top, core, base), by cloud age, cloud type? * How are cloud particles spatially distributed on sub-cm scales due to mixing, entrainment, and

366

AMS-02 Results Support the Secondary Origin of Cosmic Ray Positrons  

Science Journals Connector (OSTI)

We show that the recent AMS-02 positron fraction measurement is consistent with a secondary origin for positrons and does not require additional primary sources such as pulsars or dark matter. The measured positron fraction at high energy saturates the previously predicted upper bound for secondary production, obtained by neglecting radiative losses. This coincidence, which will be further tested by upcoming AMS-02 data at higher energy, is a compelling indication for a secondary source. Within the secondary model, the AMS-02 data imply a cosmic ray propagation time in the Galaxy of <106??yr and an average traversed interstellar matter density of ?1??cm-3, comparable to the density of the Milky Way gaseous disk, at a rigidity of 300GV.

Kfir Blum; Boaz Katz; Eli Waxman

2013-11-20T23:59:59.000Z

367

A study of soap stock from cotton seed oil as influenced by variations in the cooking temperature of the cotton seed meats  

E-Print Network [OSTI]

Bel2 Be 23 V, OG 10 ~ 63 Be 15 '/ ~ QU BeO? Se32 8, 35 9 F 00 8 77 10 ~ O'7 Qel4 Be 81 9%06 QeOS Qe38 Bs92 Bs75 9 ~ GV 'I ~ 93 V ~ 50 8. 9. Be 91 8, 90 Bs60 Qe08 7, 46 Veb4 VS 15 F 85 Ge 90 Be45 5sbV Ge30 6 ~ 15 6e40... li?9 c. '0 e 4 14 ~ 1 14sb xl?v llsi 14s '7 10. ~ J ~ J 1" ~ D 10 ~ J B, B lbsl Be 0 14 ~ ~ 10 ~ . - V ~ J I 9 ' 0 '7 ~ 9 1D ~ J 0. 1 7. 3 0 ~ 1 U ~ b 9 ~ 6 5 ~ 9 51. 9 "9 ' 1 "7 ' 9 60 ~ ': ~ 6 L9 ~ 0 60 ~ J P7 ~ e "7...

North, Harvey Steinle

2012-06-07T23:59:59.000Z

368

The Neutron Lifetime  

E-Print Network [OSTI]

The decay of the free neutron into a proton, electron, and antineutrino is the prototype semileptonic weak decay and the simplest example of nuclear beta decay. The nucleon vector and axial vector weak coupling constants G_V and G_A determine the neutron lifetime as well as the strengths of weak interaction processes involving free neutrons and protons that are important in astrophysics, cosmology, solar physics and neutrino detection. In combination with a neutron decay angular correlation measurement, the neutron lifetime can be used to determine the first element of the CKM matrix Vud. Unfortunately the two main experimental methods for measuring the neutron lifetime currently disagree by almost 4 sigma. I will present a brief review of the status of the neutron lifetime and prospects for the future.

Wietfeldt, F E

2014-01-01T23:59:59.000Z

369

The Neutron Lifetime  

E-Print Network [OSTI]

The decay of the free neutron into a proton, electron, and antineutrino is the prototype semileptonic weak decay and the simplest example of nuclear beta decay. The nucleon vector and axial vector weak coupling constants G_V and G_A determine the neutron lifetime as well as the strengths of weak interaction processes involving free neutrons and protons that are important in astrophysics, cosmology, solar physics and neutrino detection. In combination with a neutron decay angular correlation measurement, the neutron lifetime can be used to determine the first element of the CKM matrix Vud. Unfortunately the two main experimental methods for measuring the neutron lifetime currently disagree by almost 4 sigma. I will present a brief review of the status of the neutron lifetime and prospects for the future.

F. E. Wietfeldt

2014-11-13T23:59:59.000Z

370

Preliminary results obtained with an apparatus for studying the effect of carbon dioxide on consumption of oxygen by respiring cotton roots  

E-Print Network [OSTI]

emg@-:; = '. ;, . -;. - -;, -. ;, ::. :;, , :-"::-'::--'. ke. . of. :. o~ esg5i one end/4x'~to~'ee' et'@~ oh'=exp~ ? -4R=:~:-+&~-;-~=4~~~~4-'M ~ ='-%=. 4cnv y--'; ? ? ' '-~$8'. othe';:hef44j't ? &Cc'0 -i4'-':-458!:$lcsfk... ELECTROOE. ~ f ! ~CC4~ V5 4'1'gV' X7CNC'0~ SCAN3;Al ClWCCX'CHK@s ge. . vive':~. ". 5m'~e;4~4' jXe54'f jy'" ~y. 6f'M@ &a@, ' . , ' '; "' '=. , ::. "", '. "' ' f9~ '4B 4+C5ANg@!. @XA~~lid XCtl8~ ?~@8&''SQL485lp' 4@4}4 rl W fr'B, 6185QQC@ %C'5@X' CCb...

Hinesly, Thomas Daniel

2012-06-07T23:59:59.000Z

371

Positron acceleration by plasma wake fields driven by a hollow electron beam  

E-Print Network [OSTI]

A scheme of wake field generation for positron acceleration using hollow or donut shaped electron driver beams is studied. An annular shaped, electron free region forms around a hollow driver beam creating a favorable region (longitudinal field is accelerating and transverse field is focusing and radially linear) for positron acceleration. Accelerating gradients of the order of 10 GV/m are produced by a hollow electron beam driver with FACET like parameters. The peak accelerating field increases linearly with the total charge in the beam driver while the axial size of the favorable region ($\\sim$ one plasma wavelength) remains approximately fixed. The radial size drops with the total charge but remains large enough for the placement of a witness positron beam. We simulate an efficient acceleration of a 23 GeV positron beam to 35.4 GeV with a maximum energy spread of 0.4\\% and very small emittance over a plasma length of 140 cm.

Jain, Neeraj; Palastro, J P

2014-01-01T23:59:59.000Z

372

Optimization-Based Network Analysis with Applications in Clustering and Data Mining  

E-Print Network [OSTI]

of vertices that need to 1 be deleted from G in order to obtain a disconnected or a trivial graph. The density (G) of G is given by (G) = jEj= jV j 2 . A complete graph Kn on n vertices is a graph that contains all possible edges, i.e, (Kn) = 1...; v0)] = P1(v; v0) and G[V2(v; v0)] = P2(v; v0) then C is called a partitionable cycle. If, in addition, jV1(v; v0)j 6= jV2(v; v0)j then the partitionable cycle C is called asymmetric. Mahdavi and Balasundaram [80] have proved that if no subset of 5...

Shahinpour, Shahram

2013-07-22T23:59:59.000Z

373

Langevin Equation and the ac Conductivity of Non-Maxwellian Plasmas  

Science Journals Connector (OSTI)

The use of the Langevin equation {dvdt+gv=(qm)[E0ei?t+(vc)H]} to describe the electrical conductivity of a non-Maxwellian plasma (a weakly ionized gas in which the average electron collision frequency is temperature dependent) may be in error unless it is understood that the dissipative term, g, is complex. In the limiting cases of either high or low pressures the imaginary part of g is negligible. The real and imaginary parts of g are evaluated for these limiting cases, for four different gases; air, helium, Maxwellian gas, and water. The real part of g is shown to be the average collision frequency multiplied by a numerical factor, the size of which depends on the nature of the gas and the pressure limit.

P. Molmud

1959-04-01T23:59:59.000Z

374

Slide 1  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

ARM-funded IOP Measurement Priorities ARM-funded IOP Measurement Priorities * Model Forcing Dataset Sounding network Appropriate for determining continuous forcing dataset * 4D Atmospheric state description Soundings (Array and soundings of opportunity) Radar Refractivity Surface Observations * 4D Cloud and Precipitation characteristics CASA, CIRPAS 9.4 Ghz Phased-Array, McGill scanning 94- GHz, ARM SBIR scanning 35-GHz * Updraft/Downdraft dynamics CASA, 915 MHz wind profilers, cloud radars Walt Petersen, GPM GV, MC3E , 23-24 February 2009, Norman, Oklahoma 6 NASA-Provided Infrastructure Ka-Ku Scanning Transportable Dual-Polarimetric Radar (dual-aperture) * Match DPR frequencies, direct link to PIA and dual-wavelength vs. dual-pol methods * Extension to clouds, light precipitation, and improved sampling of ice, snow, mixed phase

375

Light Curves of Dwarf Plutonian Planets and other Large Kuiper Belt Objects: Their Rotations, Phase Functions and Absolute Magnitudes  

E-Print Network [OSTI]

(Abridged) I report new light curves and determine the rotations and phase functions of several large Kuiper Belt objects, including the dwarf planet Eris (2003 UB313). (120348) 2004 TY364 shows a light curve which if double-peaked has a period of 11.70+-0.01 hours and peak-to-peak amplitude of 0.22+-0.02 magnitudes. (84922) 2003 VS2 has a well defined double-peaked light curve of 7.41+-0.02 hours with a 0.21+-0.02 magnitude range. (126154) 2001 YH140 shows variability of 0.21+-0.04 magnitudes with a possible 13.25+-0.2 hour single-peaked period. The seven new KBOs in the sample which show no discernible variations within the uncertainties on short rotational time scales are 2001 UQ18, (55565) 2002 AW197, (119979) 2002 WC19, (120132) 2003 FY128, (136108) Eris 2003 UB313, (90482) Orcus 2004 DW, and (90568) 2004 GV9. The three medium to large sized Kuiper Belt objects 2004 TY364, Orcus and 2004 GV9 show fairly steep linear phase curves (~0.18 to 0.26 mags per degree) between phase angles of 0.1 and 1.5 degrees. The extremely large dwarf planet Eris (2003 UB313) shows a shallower phase curve (0.09+-0.03 mags per degree) which is more similar to the other known dwarf planet Pluto. It appears the surface properties of the largest dwarf planets in the Kuiper Belt maybe different than the smaller Kuiper Belt objects. This may have to do with the larger objects ability to hold more volatile ices as well as sustain atmospheres. The absolute magnitudes obtained using the measured phase slopes are a few tenths of magnitudes different from those given by the MPC.

Scott S. Sheppard

2007-04-13T23:59:59.000Z

376

Transition from metallic to tunneling-type conductance in metal-metal and normal-metalsuperconductor point contacts  

Science Journals Connector (OSTI)

We have investigated the microshorttotunneling crossover in normal-normal (N-N) and normal-metalsuperconductor (N-S) point-contact junctions at 4.2 K as the junction conductance (G0) is varied. The microshort (or metallic) point contact with the dynamic conductance G (V) having a negative derivative with respect to bias V (i.e., ?G/?V0 when G0?35 mS. We show that this is the region where the contact radius ? is a few times kF-1 (kF is the Fermi wave vector) and the crossover in the sign of ?G/?V occurs due to electron confinement in a length scale comparable to kF-1. The effect of confinement is to make the electrons crossing the constriction evanescent in nature as the junction size is reduced progressively and the energy for lateral confinement becomes comparable to EF. We argue that in this extreme ballistic regime, the classical Sharvin approach breaks down as quantum effects due to electron confinement takes over. This happens much before single-atom contact is reached which signals the onset of vacuum tunneling. As a further test of the electron confinement effects in point contacts, we investigated clean N-S microshorts showing near-ideal Andreev reflection. We find that in N-S junctions, the Andreev reflection (which is a manifestation of superconductivity) gradually vanishes when the contact radius ??0.1? (? is the coherence length) and the energy cost of electron confinement is larger than the superconducting energy gap ?.

H. Srikanth and A. K. Raychaudhuri

1992-12-01T23:59:59.000Z

377

A resonance-fluorescence measurement of the lifetime of the 1.013 MeV level in ?Al using Compton-scattered gamma rays  

E-Print Network [OSTI]

G X@80'ix8iM8 6lVGii ~~i'CtBE". CG E8 &&i!;". pl lee. T'. 0G 6QCPct03" . PUl888 Msz&* Bv, A:lg''i""6 '"9 6 Tc h", &lc"il YL888 QX'66165't5 CO'i. "pOX 8 2 XG'9 K&i3 6 1 ~iG'?Cq p g) 98 ~1~~ 6. '", : 8 L 8 i~ 8 l g z sz", J. 3. C4, "'BET;i~P~ A, Sc...G X@80'ix8iM8 6lVGii ~~i'CtBE". CG E8 &&i!;". pl lee. T'. 0G 6QCPct03" . PUl888 Msz&* Bv, A:lg''i""6 '"9 6 Tc h", &lc"il YL888 QX'66165't5 CO'i. "pOX 8 2 XG'9 K&i3 6 1 ~iG'?Cq p g) 98 ~1~~ 6. '", : 8 L 8 i~ 8 l g z sz", J. 3. C4, "'BET;i~P~ A, Sc...

Peticolas, John Davis

2012-06-07T23:59:59.000Z

378

Modeling regional seismic waves from underground nuclear explosion. Report for 17 March 1987-30 March 88  

SciTech Connect (OSTI)

Two main topics are presented: the effects of ocean continent transition zones on L - g waves; and modeling regional Love waves with 2-D velocity structures. Hybrid regional and teleseismic SH mode sum seismograms are produced after propagation through a regional transition zone or other heterogeneity that exists as part of a longer, mostly plane-layered, path. In particular the effects of ocean continent transition regions of geometry for propagation along a partially oceanic path is at most a factor of four. Extending the oceanic path length changes this factor to at most 6. This is inadequate to explain the observed attenuation of Lg. Thus, additional effects, must be considered to provide a complete explanation of the attenuation of Lg. Long period seismograms recorded at Pasadena of earthquakes occurring along a profile to Imperial Valley are studied in terms of source phenomena versus path effects. Some of the events have known source parameters, determined by teleseismic or near-field studies, and are used as master events in a forward modeling exercise to derive the Green's functions that describe the propagation effects along the profile. Both timing and waveforms of records are matched by synthetics calculated from 2-dimensional velocity models. The best 2-dimensional section begins at Imperial Valley with a thin crust containing the basin structure and thickens towards Pasadena.

Clayton, R.W.; Harkrider, D.G.; Helmberger, D.V.

1988-05-09T23:59:59.000Z

379

Realistic multisite lattice-gas modeling and KMC simulation of catalytic surface reactions: Kinetics and multiscale spatial behavior for CO-oxidation on metal (100) surfaces  

SciTech Connect (OSTI)

A realistic molecular-level description of catalytic reactions on single-crystal metal surfaces can be provided by stochastic multisite lattice-gas (msLG) models. This approach has general applicability, although in this report, we will focus on the example of CO-oxidation on the unreconstructed fcc metal (100) or M(100) surfaces of common catalyst metals M = Pd, Rh, Pt and Ir (i.e., avoiding regimes where Pt and Ir reconstruct). These models can capture the thermodynamics and kinetics of adsorbed layers for the individual reactants species, such as CO/M(100) and O/M(100), as well as the interaction and reaction between different reactant species in mixed adlayers, such as (CO + O)/M(100). The msLG models allow population of any of hollow, bridge, and top sites. This enables a more flexible and realistic description of adsorption and adlayer ordering, as well as of reaction configurations and configuration-dependent barriers. Adspecies adsorption and interaction energies, as well as barriers for various processes, constitute key model input. The choice of these energies is guided by experimental observations, as well as by extensive Density Functional Theory analysis. Model behavior is assessed via Kinetic Monte Carlo (KMC) simulation. We also address the simulation challenges and theoretical ramifications associated with very rapid diffusion and local equilibration of reactant adspecies such as CO. These msLG models are applied to describe adsorption, ordering, and temperature programmed desorption (TPD) for individual CO/M(100) and O/M(100) reactant adlayers. In addition, they are also applied to predict mixed (CO + O)/M(100) adlayer structure on the nanoscale, the complete bifurcation diagram for reactive steady-states under continuous flow conditions, temperature programmed reaction (TPR) spectra, and titration reactions for the CO-oxidation reaction. Extensive and reasonably successful comparison of model predictions is made with experimental data. Furthermore, we discuss the possible transition from traditional mean-field-type bistability and reaction kinetics for lower-pressure to multistability and enhanced fluctuation effects for moderate- or higher-pressure. Behavior in the latter regime reflects a stronger influence of adspecies interactions and also lower diffusivity in the higher-coverage mixed adlayer. We also analyze mesoscale spatiotemporal behavior including the propagation of reaction diffusion fronts between bistable reactive and inactive states, and associated nucleation-mediated transitions between these states. This behavior is controlled by complex surface mass transport processes, specifically chemical diffusion in mixed reactant adlayers for which we provide a precise theoretical formulation. The msLG models together with an appropriate treatment of chemical diffusivity enable equation-free heterogeneous coupled lattice-gas (HCLG) simulations of spatiotemporal behavior. In addition, msLG + HCLG modeling can describe coverage variations across polycrystalline catalysts surfaces, pressure variations across catalyst surfaces in microreactors, and could be incorporated into a multiphysics framework to describe mass and heat transfer limitations for high-pressure catalysis. (C) 2013 Elsevier Ltd. All rights reserved.

Liu, Dajiang [Ames Laboratory; Evans, James W. [Ames Laboratory

2013-12-01T23:59:59.000Z

380

Smaller Footprint Drilling System for Deep and Hard Rock Environments; Feasibility of Ultra-High-Speed Diamond Drilling  

SciTech Connect (OSTI)

The two phase program addresses long-term developments in deep well and hard rock drilling. TerraTek believes that significant improvements in drilling deep hard rock will be obtained by applying ultra-high rotational speeds (greater than 10,000 rpm). The work includes a feasibility of concept research effort aimed at development that will ultimately result in the ability to reliably drill ''faster and deeper'' possibly with smaller, more mobile rigs. The principle focus is on demonstration testing of diamond bits rotating at speeds in excess of 10,000 rpm to achieve high rate of penetration (ROP) rock cutting with substantially lower inputs of energy and loads. The significance of the ''ultra-high rotary speed drilling system'' is the ability to drill into rock at very low weights on bit and possibly lower energy levels. The drilling and coring industry today does not practice this technology. The highest rotary speed systems in oil field and mining drilling and coring today run less than 10,000 rpm-usually well below 5,000 rpm. This document details the progress at the end of Phase 1 on the program entitled ''Smaller Footprint Drilling System for Deep and Hard Rock Environments: Feasibility of Ultra-High-Speed Diamond Drilling'' for the period starting 1 March 2006 and concluding 30 June 2006. (Note: Results from 1 September 2005 through 28 February 2006 were included in the previous report (see Judzis, Black, and Robertson)). Summarizing the accomplished during Phase 1: {lg_bullet} TerraTek reviewed applicable literature and documentation and convened a project kickoff meeting with Industry Advisors in attendance (see Black and Judzis). {lg_bullet} TerraTek designed and planned Phase I bench scale experiments (See Black and Judzis). Some difficulties continued in obtaining ultra-high speed motors. Improvements were made to the loading mechanism and the rotational speed monitoring instrumentation. New drill bit designs were developed to provided a more consistent product with consistent performance. A test matrix for the final core bit testing program was completed. {lg_bullet} TerraTek concluded Task 3 ''Small-scale cutting performance tests.'' {sm_bullet} Significant testing was performed on nine different rocks. {sm_bullet} Five rocks were used for the final testing. The final tests were based on statistical design of experiments. {sm_bullet} Two full-faced bits, a small diameter and a large diameter, were run in Berea sandstone. {lg_bullet} Analysis of data was completed and indicates that there is decreased specific energy as the rotational speed increases (Task 4). Data analysis from early trials was used to direct the efforts of the final testing for Phase I (Task 5). {lg_bullet} Technology transfer (Task 6) was accomplished with technical presentations to the industry (see Judzis, Boucher, McCammon, and Black).

Arnis Judzis; Homer Robertson; Alan Black

2006-06-22T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Global analysis of data on the spin-orbit-coupled A {sup 1{Sigma}}{sub u}{sup +} and b {sup 3{Pi}}{sub u} states of Cs{sub 2}  

SciTech Connect (OSTI)

We present experimentally derived potential curves and spin-orbit interaction functions for the strongly perturbed A {sup 1{Sigma}}{sub u}{sup +} and b {sup 3{Pi}}{sub u} states of the cesium dimer. The results are based on data from several sources. Laser-induced fluorescence Fourier transform spectroscopy (LIF FTS) was used some time ago in the Laboratoire Aime Cotton primarily to study the X {sup 1{Sigma}}{sub g}{sup +} state. More recent work at Tsinghua University provides information from moderate resolution spectroscopy on the lowest levels of the b {sup 3{Pi}}{sub 0u}{sup {+-}} state as well as additional high-resolution data. From Innsbruck University, we have precision data obtained with cold Cs{sub 2} molecules. Recent data from Temple University was obtained using the optical-optical double resonance polarization spectroscopy technique, and finally, a group at the University of Latvia has added additional LIF FTS data. In the Hamiltonian matrix, we have used analytic potentials (the expanded Morse oscillator form) with both finite-difference (FD) coupled-channel and discrete variable representation (DVR) calculations of the term values. Fitted diagonal and off-diagonal spin-orbit functions are obtained and compared with ab initio results from Temple and Moscow State universities.

Bai, Jianmei; Ahmed, E. H.; Beser, B.; Guan, Y.; Kotochigova, S.; Lyyra, A. M.; Ashman, S.; Wolfe, C. M.; Huennekens, J.; Xie, Feng; Li, Dan; Li, Li; Tamanis, M.; Ferber, R.; Drozdova, A.; Pazyuk, E.; Stolyarov, A. V.; Danzl, J. G.; Naegerl, H.-C.; Bouloufa, N. [Physics Department, Temple University, Philadelphia, Pennsylvania 19122 (United States); Department of Physics, Lehigh University, Bethlehem, Pennsylvania 18015 (United States); Department of Physics and Key Lab of Atomic and Molecular Nanoscience, Tsinghua University, Beijing 100084 (China); Laser Center, Department of Physics, University of Latvia, 19 Rains Blvd., Riga LV-1586 (Latvia); Department of Chemistry, Moscow State University, GSP-2 Leninskie gory 1/3, Moscow RU-119992 (Russian Federation); Institut fuer Experimentalphysik und Zentrum fuer Quantenphysik, Universitaet Innsbruck, Technikerstrasse 25, A-6020 Innsbruck (Austria); Laboratoire Aime Cotton, CNRS, Universite Paris-Sud, Bat. 505, F-91405 Orsay Cedex (France); Department of Physics and Astronomy, SUNY, Stony Brook, New York 11794-3800 (United States)

2011-03-15T23:59:59.000Z

382

East Coast (PADD 1) Imports from All Countries  

U.S. Energy Information Administration (EIA) Indexed Site

Import Area: East Coast (PADD 1) Midwest (PADD 2) Gulf Coast (PADD 3) Rocky Mountain (PADD 4) West Coast (PADD 5) Period/Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day Import Area: East Coast (PADD 1) Midwest (PADD 2) Gulf Coast (PADD 3) Rocky Mountain (PADD 4) West Coast (PADD 5) Period/Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day Country: All Countries Persian Gulf OPEC Algeria Angola Ecuador Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Argentina Aruba Australia Austria Azerbaijan Bahamas Bahrain Barbados Belarus Belgium Brazil Brunei Bulgaria Cameroon Canada Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Denmark Dominican Republic Egypt El Salvador Equatorial Guinea Estonia Finland France Gabon Georgia, Republic of Germany Ghana Gibralter Greece Guatemala Guinea Hong Kong Hungary India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Kazakhstan Korea, South Kyrgyzstan Latvia Liberia Lithuania Malaysia Malta Mauritania Mexico Morocco Namibia Netherlands Netherlands Antilles Niue Norway Oman Pakistan Panama Peru Philippines Poland Portugal Puerto Rico Romania Russia Senegal Singapore South Africa Spain Swaziland Sweden Switzerland Syria Taiwan Thailand Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Ukraine United Kingdom Uruguay Vietnam Virgin Islands (U.S.) Yemen

383

Multichannel response analysis on 2D projection views for detection of clustered microcalcifications in digital breast tomosynthesis  

SciTech Connect (OSTI)

Purpose: To investigate the feasibility of a new two-dimensional (2D) multichannel response (MCR) analysis approach for the detection of clustered microcalcifications (MCs) in digital breast tomosynthesis (DBT). Methods: With IRB approval and informed consent, a data set of two-view DBTs from 42 breasts containing biopsy-proven MC clusters was collected in this study. The authors developed a 2D approach for MC detection using projection view (PV) images rather than the reconstructed three-dimensional (3D) DBT volume. Signal-to-noise ratio (SNR) enhancement processing was first applied to each PV to enhance the potential MCs. The locations of MC candidates were then identified with iterative thresholding. The individual MCs were decomposed with HermiteGaussian (HG) and LaguerreGaussian (LG) basis functions and the channelized Hotelling model was trained to produce the MCRs for each MC on the 2D images. The MCRs from the PVs were fused in 3D by a coincidence counting method that backprojects the MC candidates on the PVs and traces the coincidence of their ray paths in 3D. The 3D MCR was used to differentiate the true MCs from false positives (FPs). Finally a dynamic clustering method was used to identify the potential MC clusters in the DBT volume based on the fact that true MCs of clinical significance appear in clusters. Using two-fold cross validation, the performance of the 3D MCR for classification of true and false MCs was estimated by the area under the receiver operating characteristic (ROC) curve and the overall performance of the MCR approach for detection of clustered MCs was assessed by free response receiver operating characteristic (FROC) analysis. Results: When the HG basis function was used for MCR analysis, the detection of MC cluster achieved case-based test sensitivities of 80% and 90% at the average FP rates of 0.65 and 1.55 FPs per DBT volume, respectively. With LG basis function, the average FP rates were 0.62 and 1.57 per DBT volume at the same sensitivity levels. The difference in the two sets of basis functions for detection of MCs did not show statistical significance. Conclusions: The authors' experimental results indicate that the MCR approach is promising for the detection of MCs on PV images. The HG or LG basis functions are both effective in characterizing the signal response of MCs using the channelized Hotelling model. The coincidence counting method for fusion of the 2D MCR in 3D is an important step for FP reduction. Further study is underway to improve the MCR approach for microcalcification detection in DBT.

Wei, Jun, E-mail: jvwei@umich.edu; Chan, Heang-Ping; Hadjiiski, Lubomir M.; Helvie, Mark A.; Lu, Yao; Zhou, Chuan; Samala, Ravi [Department of Radiology, University of Michigan, Ann Arbor, Michigan 48109-5842 (United States)] [Department of Radiology, University of Michigan, Ann Arbor, Michigan 48109-5842 (United States)

2014-04-15T23:59:59.000Z

384

The Department of Energy's Innovation in GM's Chevrolet Volt | Department  

Broader source: Energy.gov (indexed) [DOE]

The Department of Energy's Innovation in GM's Chevrolet Volt The Department of Energy's Innovation in GM's Chevrolet Volt The Department of Energy's Innovation in GM's Chevrolet Volt January 11, 2011 - 11:49am Addthis Chevy Volt and replica battery | Photo Courtesy of Argonne Lab's Flickr Chevy Volt and replica battery | Photo Courtesy of Argonne Lab's Flickr Patrick B. Davis Patrick B. Davis Vehicle Technologies Program Manager Last Thursday was a big day in the world of advanced vehicle batteries. On January 6, the Department of Energy's Argonne National Laboratory announced that General Motors and its battery cell supplier, LG Chem Power Inc., have each signed licensing agreements to use Argonne's breakthrough battery technology. Funded by the Department, scientists at Argonne have developed a unique suite of cathode materials - a 'family' of lithium-rich

385

central air conditioner | OpenEI  

Open Energy Info (EERE)

central air conditioner central air conditioner Dataset Summary Description View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers. Data includes cooling capacity, cooling performance, heating capacity, and heating performance. Spreadsheet was created by combining the tables in pdf files that are included in the zip file. Source Energy Applicance Data - United States Federal Trade Commission, www.ftc.gov Date Released Unknown Date Updated Unknown Keywords air conditioner central air conditioner efficiency efficient energy heat pump Data application/vnd.ms-excel icon 2010_CentralAC_All.xls (xls, 82.4 KiB) application/zip icon 2010CentralAirConditioner.zip (zip, 398.2 KiB) Quality Metrics Level of Review Some Review

386

City of Burlington-Electric, Vermont (Utility Company) | Open Energy  

Open Energy Info (EERE)

Burlington-Electric, Vermont (Utility Company) Burlington-Electric, Vermont (Utility Company) Jump to: navigation, search Name City of Burlington-Electric Place Vermont Utility Id 2548 Utility Location Yes Ownership M NERC Location NPCC NERC NPCC Yes Operates Generating Plant Yes Activity Generation Yes Activity Transmission Yes Activity Buying Transmission Yes Activity Distribution Yes Activity Wholesale Marketing Yes Alt Fuel Vehicle Yes Alt Fuel Vehicle2 Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] Energy Information Administration Form 826[2] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Large General (LG) Rate Demand is less than 25KW- Net Metered Renewable

387

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

41 - 17350 of 28,905 results. 41 - 17350 of 28,905 results. Download VALUE STUDY http://energy.gov/management/downloads/value-study-0 Download Special Report: OAS-RA-13-10 The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc http://energy.gov/ig/downloads/special-report-oas-ra-13-10 Download URTAC Meeting- September 2013 Federal Register Notice for September 19, 2013 URTAC Meeting http://energy.gov/fe/downloads/urtac-meeting-september-2013 Download Audit Report: WR-B-99-05 Management of Laboratory Directed Research and Development at the National Renewable Energy Laboratory http://energy.gov/ig/downloads/audit-report-wr-b-99-05 Download RingCentral Mailboxes This is a list of each Departmental element's mailbox(es) used for RingCentral during a COOP event.

388

VEHICLE SPECIFICATIONS  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

VEHICLE SPECIFICATIONS 1 Vehicle Features Base Vehicle: 2011 Chevrolet Volt VIN: 1G1RD6E48BUI00815 Class: Compact Seatbelt Positions: 4 Type 2 : Multi-Mode PHEV (EV, Series, and Power-split) Motor Type: 12-pole permanent magnet AC synchronous Max. Power/Torque: 111 kW/370 Nm Max. Motor Speed: 9500 rpm Cooling: Active - Liquid cooled Generator Type: 16-pole permanent magnet AC synchronous Max. Power/Torque: 55 kW/200 Nm Max. Generator Speed: 6000 rpm Cooling: Active - Liquid cooled Battery Manufacturer: LG Chem Type: Lithium-ion Cathode/Anode Material: LiMn 2 O 4 /Hard Carbon Number of Cells: 288 Cell Config.: 3 parallel, 96 series Nominal Cell Voltage: 3.7 V Nominal System Voltage: 355.2 V Rated Pack Capacity: 45 Ah Rated Pack Energy: 16 kWh Weight of Pack: 435 lb

389

Data:A6b36bfc-6a04-42d3-ae7f-8b49715e4918 | Open Energy Information  

Open Energy Info (EERE)

bfc-6a04-42d3-ae7f-8b49715e4918 bfc-6a04-42d3-ae7f-8b49715e4918 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Public Service Co of NH Effective date: 2012/01/01 End date if known: Rate name: Rate LG, Commercial and Industrial Service INDUSTRIAL Sector: Commercial Description: Source or reference: http://www.psnh.com/RatesTariffs/Business/Small-Business-Rates.aspx Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

390

Data:5153dc85-7b21-4906-9245-5cd5d7e85826 | Open Energy Information  

Open Energy Info (EERE)

5-7b21-4906-9245-5cd5d7e85826 5-7b21-4906-9245-5cd5d7e85826 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: General Service- Single Phase Sector: Commercial Description: To any nonresidential customer for lighting, heating, and power purposes, and where the customer's billing demand does not exceed 100 KW during any three summer months or 200 KW in any four months of a 12 consecutive month period. Source or reference: http://www.loup.com/docs/customersvc/LG-1-Rates2013.pdf Source Parent:

391

Data:46ee4d23-7518-4c5a-8367-e3a1a06bab1e | Open Energy Information  

Open Energy Info (EERE)

-7518-4c5a-8367-e3a1a06bab1e -7518-4c5a-8367-e3a1a06bab1e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Gastonia, North Carolina (Utility Company) Effective date: 2012/07/01 End date if known: Rate name: SCHEDULE CX - Very Lg. Commercial Service Sector: Commercial Description: Source or reference: Rates Binder A Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

392

Data:5692e47f-44ac-4ddd-8a11-3650aaab4afc | Open Energy Information  

Open Energy Info (EERE)

2e47f-44ac-4ddd-8a11-3650aaab4afc 2e47f-44ac-4ddd-8a11-3650aaab4afc No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: KEM Electric Coop Inc Effective date: End date if known: Rate name: General Service - Three Phase/Lg Power Sector: Industrial Description: Available to all members who require multi-phase electric service. Service capacity will start at 51 kVa and shall not exceed a 999 kVa. Service shall be to a single point of service Type of Service Three Phase, 60 cycle, at secondary voltages. The Cooperative will provide meter, meter socket, and C.T. equipment necessary to measure electric usage.

393

TTRDC - Publications - Transforum Vol. 11 No. 1  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Battery Tech Licensed to Several Companies Battery Tech Licensed to Several Companies Argonne has now licensed its groundbreaking battery technology to five companies. In addition to GM and LG Chem, the following companies are working with the Argonne-developed cathode material: Envia - In January 2011, this California start-up signed a license with Argonne. The lab's cathode material will contribute complementary technology to Envia's development of industry-leading lithium-ion battery solutions. This deal builds on an existing Argonne-Envia collaboration that garnered an R&D 100 award from R&D Magazine in 2009 for the joint development of an innovative composite electrode material technology. BASF - In June 2009, the world's largest chemical company signed a worldwide licensing agreement to mass produce and market Argonne's patented composite cathode materials to manufacturers of advanced lithium-ion batteries.

394

heat pump | OpenEI  

Open Energy Info (EERE)

heat pump heat pump Dataset Summary Description View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers. Data includes cooling capacity, cooling performance, heating capacity, and heating performance. Spreadsheet was created by combining the tables in pdf files that are included in the zip file. Source Energy Applicance Data - United States Federal Trade Commission, www.ftc.gov Date Released Unknown Date Updated Unknown Keywords air conditioner central air conditioner efficiency efficient energy heat pump Data application/vnd.ms-excel icon 2010_CentralAC_All.xls (xls, 82.4 KiB) application/zip icon 2010CentralAirConditioner.zip (zip, 398.2 KiB) Quality Metrics Level of Review Some Review

395

Data:E1661572-d93e-439c-a8c4-c4429f3774ed | Open Energy Information  

Open Energy Info (EERE)

61572-d93e-439c-a8c4-c4429f3774ed 61572-d93e-439c-a8c4-c4429f3774ed No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: General Service- Three Phase Sector: Commercial Description: To any nonresidential customer for lighting, heating, and power purposes, and where the customer's billing demand does not exceed 100 KW during any three summer months or 200 KW in any four months of a 12 consecutive month period. Source or reference: http://www.loup.com/docs/customersvc/LG-1-Rates2013.pdf Source Parent:

396

TYPE OF OPERATION  

Office of Legacy Management (LM)

OWNEF? (S) OWNEF? (S) Current: ____ LcrcJksLG! _________ Owner contacted n yes WI-IO; if yes, date contacted-- TYPE OF OPERATION ----_-------_---- m Research & Development Cl Pilot Scale Cl Disposal/Storaqe TYPE OF CDNTRACT ---__------__--- q Prime 0 Subcnntractor Cl Purchase Order 0 Other infcrmation (i.e., cnst + fixed fee, unit price, time 84 materi+, e.tc) v-7Y07-&G-W ---------------------------- Contract/Pur&aae Order # 0 -?+7- FJc-(CL --___--------~----_______________ CONTRACTING PEXIOD: fl& ,&I;'"'-?;': (&e-?)_-- ' ------------------ OWNERSHIP: AEC/MED GEC/MED SOVT GOVT CONTRACTOR CCNTRACTOR OWNE3 LEASE3 OWNE3 LEASED OWNE3 ----- ------ ----- ------ -__------- LE.352 LANDS u u q BUILDINGS EQUIPMENT 0 FINAL PRODUCT WASTE G RESIDUE a

397

ConsumTechNotes2012.vp  

Gasoline and Diesel Fuel Update (EIA)

Data: Data: Consumption 31 P E T R O L E U M O V E R V I E W U.S. Energy Information Administration 32 State Energy Data: Consumption Petroleum Products Residential Sector Estimated Consumption (RC) Commercial Sector Estimated Consumption (CC) Industrial Sector Estimated Consumption (IC) Transportation Sector Estimated Consumption (AC) Electric Power Sector Estimated Consumption (EI) Total Estimated Consumption (TC) Asphalt and Road Oil (AR) ARIC = ARTC + + Aviation Gasoline (AV) AVAC = AVTC + + Distillate Fuel Oil (DF) DFRC + DFCC + DFIC + DFAC + DFEI = DFTC + + + + + + Jet Fuel (JF) JFAC JFEU = JFTC + + Kerosene (KS) KSRC + KSCC + KSIC = KSTC + + + + Liquefied Petroleum Gases (LG) LGRC + LGCC + LGIC + LGAC = LGTC + + + Lubricants (LU) + LUIC LUAC = LUTC + + + Motor Gasoline (MG) MGCC MGIC MGAC = MGTC + + + + Residual Fuel Oil (RF) RFCC RFIC + RFAC + RFEI = RFTC + + + Other Petroleum Products (PO) PCCC 1 + POIC 2 + PCEI 1 = POTC Total

398

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

91 - 19400 of 28,560 results. 91 - 19400 of 28,560 results. Page Fossil Energy RSS Feeds RSS, sometimes known as Really Simple Syndication, is a popular means of sharing content (such as news headlines) without requiring readers to constantly visit a Web site to see what's new. RSS... http://energy.gov/fe/fossil-energy-rss-feeds Download Minnesota Recovery Act State Memo http://energy.gov/downloads/minnesota-recovery-act-state-memo Download Special Report: OAS-RA-13-10 The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc http://energy.gov/ig/downloads/special-report-oas-ra-13-10 Download Memorandum for General Counsels, NEPA Liaisons and Participants in Scoping As part of its continuing oversight of the implementation of the NEPA

399

X:\ARM_19~1\P273-281.WPD  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Z Z c T KL In[q KL /q SO ] 1 q SO 0.622 Lg R v T KL C p g R D 1 C (1 g kg 1 ) Z c , Session Papers 277 Figure 1. Simulation at 1800 GMT, +6 hrs. A Shallow Convection Parameterization for the Non-Hydrostatic MM5 Mesoscale Model N. L. Seaman, J. S. Kain, and A. Deng Pennsylvania State University, Department of Meteorology University Park, Pennsylvania A shallow convection parameterization suitable for the non-hydrostatic Pennsylvania State University (PSU)/ National Center for Atmospheric Research MM5 mesoscale model is being developed at PSU. The parameterization is based on parcel perturbation theory developed in conjunction with a 1-D Mellor-Yamada 1.5-order planetary boundary layer (PBL) scheme and the Kain-Fritsch (KF) deep convection model (Kain and Fritsch 1990). Development is done within a 1-D framework to allow

400

 

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Voids in the Local Volume galaxy sample and in high resolution simulations: Voids in the Local Volume galaxy sample and in high resolution simulations: Limit on appearance of a galaxy in a Dark Matter halo Dr. Anton Tikhonov, St.Petersburg, Russia Abstract: Current explanation of the overabundance of dark matter subhalos in the Local Group (LG) indicates that there maybe a limit on mass of a halo, which can host a galaxy. This idea can be tested using voids in the distribution of galaxies: at some level small voids should not contain any (even dwarf) galaxies. We use observational samples complete to M_B=-12 with distances less than 8 Mpc to construct the void function (VF): the distribution of sizes of voids empty of any galaxies. There are ~30 voids with sizes ranging from 1 to 5 Mpc. We also study the distribution of dark matter halos in very high resolution simulations of the LCDM model. The

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Oil and Gas Company Oil and Gas Company Address Place Zip Website  

Open Energy Info (EERE)

Company Oil and Gas Company Address Place Zip Website Company Oil and Gas Company Address Place Zip Website Abu Dhabi National Oil Company Abu Dhabi National Oil Company Abu http www adnoc ae default aspx Al Furat Petroleum Company Al Furat Petroleum Company Damascus Syria http www afpc sy com new history htm Dolphin Energy Dolphin Energy Abu Dhabi Trade Center Building Abu Dhabi United Arab Emirates http www dolphinenergy com Public default index htm ExxonMobil ExxonMobil Las Colinas Boulevard Irving Texas http www exxonmobil com Corporate Gazprom Gazprom Nametkina St Moscow Russia http www gazprom com Gulfsands Petroleum Gulfsands Petroleum Cork Street London United Kingdom W1S LG http www gulfsands com s Home asp Kuwait Petroleum Corporation Kuwait Petroleum Corporation Safat Kuwait http www kpc com kw default aspx

402

The Department of Energy's Innovation in GM's Chevrolet Volt | Department  

Broader source: Energy.gov (indexed) [DOE]

Innovation in GM's Chevrolet Volt Innovation in GM's Chevrolet Volt The Department of Energy's Innovation in GM's Chevrolet Volt January 11, 2011 - 11:49am Addthis Chevy Volt and replica battery | Photo Courtesy of Argonne Lab's Flickr Chevy Volt and replica battery | Photo Courtesy of Argonne Lab's Flickr Patrick B. Davis Patrick B. Davis Vehicle Technologies Program Manager Last Thursday was a big day in the world of advanced vehicle batteries. On January 6, the Department of Energy's Argonne National Laboratory announced that General Motors and its battery cell supplier, LG Chem Power Inc., have each signed licensing agreements to use Argonne's breakthrough battery technology. Funded by the Department, scientists at Argonne have developed a unique suite of cathode materials - a 'family' of lithium-rich

403

ConsumTechNotes2011.vp  

Gasoline and Diesel Fuel Update (EIA)

Data Data 2011: Consumption 31 P E T R O L E U M O V E R V I E W U.S. Energy Information Administration 32 State Energy Data 2011: Consumption Petroleum Products Residential Sector Estimated Consumption (RC) Commercial Sector Estimated Consumption (CC) Industrial Sector Estimated Consumption (IC) Transportation Sector Estimated Consumption (AC) Electric Power Sector Estimated Consumption (EI) Total Estimated Consumption (TC) Asphalt and Road Oil (AR) ARIC = ARTC + + Aviation Gasoline (AV) AVAC = AVTC + + Distillate Fuel Oil (DF) DFRC + DFCC + DFIC + DFAC + DFEI = DFTC + + + + + + Jet Fuel (JF) JFAC JFEU = JFTC + + Kerosene (KS) KSRC + KSCC + KSIC = KSTC + + + + Liquefied Petroleum Gases (LG) LGRC + LGCC + LGIC + LGAC = LGTC + + + Lubricants (LU) + LUIC LUAC = LUTC + + + Motor Gasoline (MG) MGCC MGIC MGAC = MGTC + + + + Residual Fuel Oil (RF) RFCC RFIC + RFAC + RFEI = RFTC + + + Other Petroleum Products (PO) PCCC 1 + POIC 2 + PCEI

404

Gulfsands Petroleum | Open Energy Information  

Open Energy Info (EERE)

Gulfsands Petroleum Gulfsands Petroleum Jump to: navigation, search Logo: Gulfsands Petroleum Name Gulfsands Petroleum Address 2-4 Cork Street Place London, United Kingdom Zip W1S 3LG Product oil and gas exploration and production Stock Symbol AIM:GPX Phone number +44 20 7434 60 60 Website http://www.gulfsands.com/s/Hom References Gulfsands Petroleum[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Gulfsands Petroleum is a company based in London, United Kingdom. Gulfsands Petroleum has oil exploration and development projects in Syria, oil exploration projects in Tunisia, and upstream and midstream oil and gas development activities in Iraq. While Gulfsands Petroleum's focus areas are

405

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

30, 2011 30, 2011 CX-007657: Categorical Exclusion Determination Preparation of Phase-Pure Standards CX(s) Applied: B3.6 Date: 11/30/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 30, 2011 CX-007656: Categorical Exclusion Determination Operation of Extrel MAX300LG Mass Spectrometer and VICI Metronics Dynacalibrator Calibration Gas Generator at 999-1W CX(s) Applied: B3.6 Date: 11/30/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 30, 2011 CX-007398: Categorical Exclusion Determination Scalable High-Efficiency Thin-Crystalline Silicon Cells Enabled by Light-Trapping Nanostructures CX(s) Applied: A9, B3.6 Date: 11/30/2011 Location(s): Massachusetts Offices(s): Golden Field Office November 30, 2011 CX-007580: Categorical Exclusion Determination

406

TYPE OF OPERATION R Research & Development T& Facility Type  

Office of Legacy Management (LM)

--____ --____ R Research & Development T& Facility Type 0 Production scale testing a Pilat scale Y-. Bench Scale Process i Theoretical Studies Sample & Analysis 0 Productian 0 Disposal/Storage a Research Organization a Government 0 Other Sponsored i F[fa' tty ------__------__ I Prime 5 Subcontractor 0 Purchase Order a Other information (i.e., cost + fixed fee, unit p CgNTRACTING PERIOD: L.&G , PX& & cx LFkoL ~~~~~~~~~----------_ __ _______ OWNERSH; P: AEC/MED AEC/MED GOVT GOVT CONTRACTOR Cot+ "ACTOR OWNED LEASED ----- -----_ w!ET) C_EtlSLE ~~s!_NE!?~~ z L ACZD -------- - LANDS a BUILDINGS 0 EQUIPMENT u ORE OR RAW MATL FINAL PRODUCT f i ; : ' 0 WASTE .% RESIDLIE q 0 G G &EC/NED INVOLVEtiE?4T AT SITE .--------_------___~~~~~~~-- ,I

407

THE AEROSPACE CORPORATION  

Office of Legacy Management (LM)

,' ,' \ -_e /' Suite 4000, 955 L' Erzfunt Plaza. S. W , bhrhrnqton, D.C. 20024, Telephone: (202) 488.6000 7117-01.87.sej.16 Mr. Andrew Wallo, III, NE-23 Division of Facility & Site Decommissioning Projects U.S. Department of Energy Germantown, Maryland 20545 Dear Mr. Wallo: FINAL ELIMINATION REPORTS AND SITE SUMMARIES Aerospace has completed its review and is forwarding the final elimination reports and site summaries for the following sites: /jZ.~la pi.0; I) PAA 0 z 0 p 1.7 , Cd> I 0 ( ' i ' 7 ' !, 0 ' C E q ' I) ~~~I' ~~ . LG.0 I@ iJ r; r>7, 0 w,or l University of Arizona, Tucson, AZ TVA, Muscle Shoals, AL Dow Chemical Company, Walnut Creek, CA Colorado School of M ines, Golden, CO Havens Lab, Bridgeport Brass, Bridgeport, CT General Chemical (Allied Chemical), N. Claymont, DE

408

KENNECOTT COPPER CORPORATION  

Office of Legacy Management (LM)

* * ?a, a5 fF#LG 44 it .L &=d ,,*, " ~=iL.oeL~~ KENNECOTT COPPER CORPORATION 101 EAST 42.. STREET $7/$ ,2 : -$ NEW YORU 17, N. Y. AND KOPPERS COMPAN,Y, INC. KOppERS B",'o,,,,G PITTSBURGH 19. PA. Classification Officer, OR0 October ,30, l!% ?!r. S. R. Saptile, Mmagez Oak Ridge Operations Office II. S. Atomic Enerfg Comission P. 0. BOX R. Oak Ridge, Tennessee Attention; Hr. John It. Moore, Director Contract Dltisloa Subjects Addendum (A) to F~oposal for a Feed Materials Processing Plant, dated September 27, WS6 Dear !&. Moore: In the proposal for a feed materials proce.esGg plaut for the production of uranium hexafluoride that uas submitted ~olntly by, Koppers Cm, Inc. and Kennecott Copper Corporation uuder dateof September 27, W%, we described a

409

Y NATIOXAL RESFARCH CORPCRATION  

Office of Legacy Management (LM)

P P Y NATIOXAL RESFARCH CORPCRATION 70 ?deacrial Drive Cambridge 42, Uassachusetts hA, IO Dr. Chsrles D. f!arringtcn Zallinckrodt Chanicol works Second and Malli.nc:nodt Streets St. Louis 7, Missouri Sear Dr. Harri..gtcnr During your visit to Natlcnal Research Ccrpcrnticn on July 16, 1949,~ yoil requastcdthat we Submit a DrCPCSd for DrB~mh? 12 in~0t.S d x-m&alto be used in the study f cllcwing program: Iib propose the I?lrpcse of 'fiork -- TW3lV3 25-pound ingot! are to be ' f;.. prepnrcd bjr vacu'~3 melting md castins of charge material supplied by hlallinc~c&t Chemical Wcrla for the purpose of determin- i?lg the effects of variation in operating pressure 011 yield, purity, and certain prcp- erties. In addition to the ingots, Natimal Resew& will deliver all scrap and remnants

410

Recovery Act Reports | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

February 19, 2013 February 19, 2013 Examination Report: OAS-RA-13-09 North Carolina State Energy Office - Energy Efficiency and Conservation Block Grant Program Funds Provided by the American Recovery and Reinvestment Act of 2009 February 8, 2013 Special Report: OAS-RA-13-10 The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc January 17, 2013 Audit Report: OAS-RA-13-07 The Department of Energy's Weatherization Assistance Program Funded under the American Recovery and Reinvestment Act for the State of Maryland January 17, 2013 Examination Report: OAS-RA-13-06 Montgomery County Department of Housing and Community Affairs - Weatherization Assistance Program Funds Provided by the American Recovery and Reinvestment Act of 2009

411

DOE Receives Responses on the Implementation of Large-Capacity Clothes  

Broader source: Energy.gov (indexed) [DOE]

Receives Responses on the Implementation of Large-Capacity Receives Responses on the Implementation of Large-Capacity Clothes Washer Waivers DOE Receives Responses on the Implementation of Large-Capacity Clothes Washer Waivers December 8, 2010 - 11:02am Addthis The Department last week invited interested parties to submit views on the proper application of waivers establishing alternative test procedures for existing large-capacity residential clothes washer models and units. We received responses from several parties, which can be found below. Alliance Laundry Systems EarthJustice Electrolux GE Appliances and Lighting LG Electronics Whirlpool Corporation The Department is currently reviewing these responses and will promptly make public its conclusions. Addthis Related Articles DOE Solicits Views on the Implementation of Large-Capacity Clothes Washer

412

Categorical Exclusion Determinations: B3.6 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

30, 2011 30, 2011 CX-007410: Categorical Exclusion Determination Deep Geothermal Drilling using Millimeter Wave Technology CX(s) Applied: A9, B3.6 Date: 11/30/2011 Location(s): Massachusetts Offices(s): Golden Field Office November 30, 2011 CX-007657: Categorical Exclusion Determination Preparation of Phase-Pure Standards CX(s) Applied: B3.6 Date: 11/30/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 30, 2011 CX-007656: Categorical Exclusion Determination Operation of Extrel MAX300LG Mass Spectrometer and VICI Metronics Dynacalibrator Calibration Gas Generator at 999-1W CX(s) Applied: B3.6 Date: 11/30/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 30, 2011 CX-007398: Categorical Exclusion Determination

413

Media Center - TTRDC in the News  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Press Coverage - Argonne strikes licensing deals with LG Chem, GM for advanced battery technology January 18, 2011 -- Green Investing GM To Build On U.S. Lab's EV Battery January 12, 2011 -- Consumer Reports GM and Argonne sign deal to provide advanced battery technology January 7, 2011 -- Foreign Policy Magazine A U.S. shot in the battery wars January 7, 2011 -- Chicago Tribune Expectations high for Argonne's battery technology January 7, 2011 -- Popular Science GM's New Battery Chemistry? It's Already In the Chevy Volt January 6, 2011 -- New York Times General Motors Licenses Promising Battery Technology January 6, 2011 -- Detroit Free Press GM, Argonne, reach deal for Chevy Volt battery January 6, 2011 -- Wall Street Journal GM Licenses Technology to Double Battery Performance

414

ARM - Datastreams - fslruc60  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Datastreamsfslruc60 Datastreamsfslruc60 Documentation XDC documentation Data Quality Plots ARM Data Discovery Browse Data Comments? We would love to hear from you! Send us a note below or call us at 1-888-ARM-DATA. Send Datastream : FSLRUC60 Rapid Update Cycle (RUC) model: FSL output, 60 km resolution Active Dates 1994.10.24 - 1994.11.16 Measurement Categories Atmospheric State, Radiometric, Surface Properties Originating Instrument Rapid Update Cycle Model Data (RUC) Measurements The measurements below provided by this product are those considered scientifically relevant. Measurement Variable Precipitation ConvP Latent heat flux LHF Precipitation LgSP Atmospheric pressure MMSP Net broadband total irradiance NR Precipitation PR Precipitation PW Sensible heat flux SHF Soil surface temperature ST Atmospheric pressure

415

air conditioner | OpenEI  

Open Energy Info (EERE)

air conditioner air conditioner Dataset Summary Description View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers. Data includes cooling capacity, cooling performance, heating capacity, and heating performance. Spreadsheet was created by combining the tables in pdf files that are included in the zip file. Source Energy Applicance Data - United States Federal Trade Commission, www.ftc.gov Date Released Unknown Date Updated Unknown Keywords air conditioner central air conditioner efficiency efficient energy heat pump Data application/vnd.ms-excel icon 2010_CentralAC_All.xls (xls, 82.4 KiB) application/zip icon 2010CentralAirConditioner.zip (zip, 398.2 KiB) Quality Metrics Level of Review Some Review

416

efficiency | OpenEI  

Open Energy Info (EERE)

efficiency efficiency Dataset Summary Description View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers. Data includes cooling capacity, cooling performance, heating capacity, and heating performance. Spreadsheet was created by combining the tables in pdf files that are included in the zip file. Source Energy Applicance Data - United States Federal Trade Commission, www.ftc.gov Date Released Unknown Date Updated Unknown Keywords air conditioner central air conditioner efficiency efficient energy heat pump Data application/vnd.ms-excel icon 2010_CentralAC_All.xls (xls, 82.4 KiB) application/zip icon 2010CentralAirConditioner.zip (zip, 398.2 KiB) Quality Metrics Level of Review Some Review

417

Data:Ca3573cf-221c-44ab-86ff-89eee32076ac | Open Energy Information  

Open Energy Info (EERE)

cf-221c-44ab-86ff-89eee32076ac cf-221c-44ab-86ff-89eee32076ac No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: KEM Electric Coop Inc Effective date: End date if known: Rate name: Public Use - Single Phase/Lg Power Sector: Commercial Description: Available to all members who require single phase electric service, and are a government unit: federal, state, local, or public school. Service capacity will be greater than 50 kVa and shall not exceed 999kVa. Service shall be to a single point of service. Type of Service Single Phase, 60 cycles, at secondary voltages. The Cooperative will provide meter, meter socket, and C.T. equipment necessary to measure electric usage.

418

Town of Apex, North Carolina (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Apex, North Carolina (Utility Company) Apex, North Carolina (Utility Company) Jump to: navigation, search Name Town of Apex Place North Carolina Utility Id 719 Utility Location Yes Ownership M NERC Location SERC NERC SERC Yes ISO Other Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png LARGE GENERAL SERVICE Industrial LARGE GENERAL SERVICE COINCIDENT PEAK (CP) Industrial LARGE GENERAL SERVICE TIME-OF-USE Industrial MEDIUM GENERAL SERVICE Industrial MEDIUM GENERAL SERVICE - COINCIDENT PEAK (CP) Industrial MEDIUM GENERAL SERVICE TIME-OF-USE Industrial RENEWABLE ENERGY FACILITIES - CREDIT RIDER (MG and LG) Commercial

419

efficient | OpenEI  

Open Energy Info (EERE)

efficient efficient Dataset Summary Description View 2010 energy efficiency data from AeroSys Inc, Coaire, Cold Point, First Operations, LG Electronics, Nordyne, and Quietside manufacturers. Data includes cooling capacity, cooling performance, heating capacity, and heating performance. Spreadsheet was created by combining the tables in pdf files that are included in the zip file. Source Energy Applicance Data - United States Federal Trade Commission, www.ftc.gov Date Released Unknown Date Updated Unknown Keywords air conditioner central air conditioner efficiency efficient energy heat pump Data application/vnd.ms-excel icon 2010_CentralAC_All.xls (xls, 82.4 KiB) application/zip icon 2010CentralAirConditioner.zip (zip, 398.2 KiB) Quality Metrics Level of Review Some Review

420

Data:3bc716a5-0024-4c68-acd6-5ae37e87eebf | Open Energy Information  

Open Energy Info (EERE)

-0024-4c68-acd6-5ae37e87eebf -0024-4c68-acd6-5ae37e87eebf No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Gastonia, North Carolina (Utility Company) Effective date: 2012/07/01 End date if known: Rate name: SCHEDULE TOU - Lg. general time of use Sector: Commercial Description: *Fixed Monthly Charge = $137.50 + REPS($2.31) = $139.81 Source or reference: *Binder "A" Gastonia, North Carolina Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V):

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

CX-007656: Categorical Exclusion Determination | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

656: Categorical Exclusion Determination 656: Categorical Exclusion Determination CX-007656: Categorical Exclusion Determination Operation of Extrel MAX300LG Mass Spectrometer and VICI Metronics Dynacalibrator Calibration Gas Generator at 999-1W CX(s) Applied: B3.6 Date: 11/30/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office The mass spectrometer will be used to measure the composition of gases from laboratory experiments at 999-1W. The VICI Metronics Dynacalibrator will be used to generate low concentration calibration gases; initially, mercury in nitrogen or argon calibration gases will be generated. Other calibration gases may be generated in the future. CX-007656.pdf More Documents & Publications CX-008636: Categorical Exclusion Determination CX-009617: Categorical Exclusion Determination

422

MEMORANDUM TO: FILE FROM: TYPE OF OPERATION  

Office of Legacy Management (LM)

, , TYPE OF OPERATION ~_--_-----_---___ 69 Research & Development a Facility. Type 0 Production scale testing Cl Pilat Scale IK Bench Scale Process 0 Theoretical Studies u Sample & Analysis q Production 0 Disposal/Storage a Manufacturing 0 University 0 Research Organization 0 Government Sponsored Facility 0 Other --------------__----- TYPE OF CONTRACT ---------------- 0 Prime 0 Other information (i.e., cost 0 Subcontractor + fixed fee, unit price, 5 Purchase Order ~SlvtM ay LuPo~l- time & material, r+c) _L-G~-~~~ ------GA------ Contract/Purchase Order # 3 I -? ciYl---------------------------- AZ. FG CONTRACTING PERIOD: --------__--_____- ----&-b&-f zw------ ______________ OWNERSHIP: AEC/MED AEC/MED OWE_3 LE_A_sEQ GOUT GOVT CONTRACTOR CONTRACTOR

423

Time-dependent fluorescence in nanoconfined solvents: Linear-response approximations and Gaussian statistics  

E-Print Network [OSTI]

of the equi- librium fluctuations of #2;E in the ground state, Cg(t) ? ??#2;E(t)?#2;E(0)?g/??#2;E(0)2?g; see Eq. (29) below. This approach has been successfully applied to solvation dynamics 0021-9606/2011/135(8)/084511/13/$30.00 2011 American Institute... the excitation at t = 0. Evaluating the Poisson bracket associated with L#2;feq(p,q) gives13 L#2;feq(p,q) = ?? ?#2;E feq(p,q), (11) so that ?A(t)?ne = ? dp ? dq A(0)feq(p,q) + ? ? dp ? dq A(0) ? t 0 ds e? Lg (t?s) ?#2;E feq(p,q) = ?A?g + ? ? t 0 ds ? dp...

Laird, Brian Bostian; Thompson, Ward H.

2011-08-26T23:59:59.000Z

424

The vapour pressure of 3,3,4,4-tetrahydrothiophene-1,1-dioxide by the effusion method  

Science Journals Connector (OSTI)

The vapour pressure was determined at 18 temperatures in the range 30-75 degrees C, with a minimum of two results at each temperature. Measured vapour pressures were in the range 0.3 to 30 mTorr and are expressed by the following equation for the solid phase of this compound: lg p=11.74-(4631/T), where p is the vapour pressure in Torr and T is the absolute temperature in K. The 95% confidence limits for the respective constants of the equation are 0.26 and 85. The average difference between the raw data and the fitted data was 3.8%. Experimental conditions studied included effusion hole diameter and effusion time. The compound undergoes no phase change or decomposition below 143 degrees C, at which temperature there is a loss of HCl.

R S De Pablo

1978-01-01T23:59:59.000Z

425

Liquefied gaseous fuels safety and environmental control assessment program: third status report  

SciTech Connect (OSTI)

This Status Report contains contributions from all contractors currently participating in the DOE Liquefied Gaseous Fuels (LG) Safety and Environmental Control Assessment Program and is presented in two principal sections. Section I is an Executive Summary of work done by all program participants. Section II is a presentation of fourteen individual reports (A through N) on specific LGF Program activities. The emphasis of Section II is on research conducted by Lawrence Livermore National Laboratory (Reports A through M). Report N, an annotated bibliography of literature related to LNG safety and environmental control, was prepared by Pacific Northwest Laboratory (PNL) as part of its LGF Safety Studies Project. Other organizations who contributed to this Status Report are Aerojet Energy Conversion Company; Applied Technology Corporation; Arthur D. Little, Incorporated; C/sub v/ International, Incorporated; Institute of Gas Technology; and Massachusetts Institute of Technology. Separate abstracts have been prepared for Reports A through N for inclusion in the Energy Data Base.

Not Available

1982-03-01T23:59:59.000Z

426

The mechanical analogy for the flow of gas  

E-Print Network [OSTI]

is shomn in textbooks on the xlnstlo theo'"y o? gases that the nunhsr Of noise;class s strikin- a unit area in o unit tine is given by N~Nu She Awe peamhhee4 Ae %ha pic? ha hpexeaX Aa Xahwhh Xa V ~axles chs ~ ece4lebag cha plat? ia ppopepcloeA ha (Nu...)(Lg) s Xh 1a ?1ea ahoWXX hy RiXXeC4? ChaaXXy Chah so Chat chs xxwebsx' eCx XMxxg che place ie pxopox cioxxaX Co &id("r&) This pors~stsx nay bs Csvslcpsd in tex'xe of Rsoh boxxbsx' SM Reynolds 5Mktsx" by sfQPloyjQQ bbs x slsbioxla R (pVLp hs oos...

Flanagan, Lindley Eric

2012-06-07T23:59:59.000Z

427

An insect assay for essential fatty acids  

E-Print Network [OSTI]

3. fat~@ aoM. eaasntkel fatty ac3. 6 eet3. vlty 'aa She sqMvelsnt of 10 eLX3, 3. lgrema of 12nolei. c go3-:oL. Xn etudLLea of ~ 13y3. de esbebollan of 2naeoCa, . Pg@~3. en6 Blsvett flgAG, lgAI) have 6snonaM~ets5 Chs nse@ of sasen41&1 f egin, @o...?"- bel(eve@, waa (kue to the k)x, 'eaenoe of lm~o3. ele aol(k. A~"tees t a Ca devaloka s b~ossss' foe'eat?ate~, '"atty'::. seasan. VCCh- Chs z'. scoGnlClon Of Che z'ole-. p1aysd by Chs . . . eeasnC3al fiC'Cj'. "-ac $. @s, :, sC&CZee on the 'tuvea...

Kerur, Dundappa Ramachandrappa

2012-06-07T23:59:59.000Z

428

Collecting and analyzing deep-sea sediments from central Gulf of Mexico  

E-Print Network [OSTI]

COLLECTING AiJD APsQ YFING DERP~EA SFIKIFGTG FRO. '4 CPATRQ BU F OF MK. l:CO A Toesis by WILLIAM ARTHUR bUi?V! Submittc8 to tbe Gr? us, e Coilore pf Texas Alii Universe ty 9n partial fulfil sent of the requirements for tbs de@ eo of v...ASTER OF SCIEi'iCE~ January lg'70 'ia, "', or Sub ject: G clerical Ooea". ogr apby COTM&TI?G PAD AEPLZ71liC . "iK" F--B0 SPEXYPiEIS FPOEE CE ~Tr'?K (iJLF OF i&~CO Thesis WILLIM AEGIS'BJR EyJElS Apu. evm3 ae to style a. "8 content by& hairman of Committee...

Burns, William Arthur

2012-06-07T23:59:59.000Z

429

Control in Probabilistic Boolean Networks  

E-Print Network [OSTI]

beers rece?tly intr&&dnced as a rule-l&ascd pur;?ligm fo?' nodeliug gene regulatory?etworks. Such n& two&ks provide a convenient tool f&&r st?dyiug ir&teracl, ious b&stwee? &liff'exe?t g& ucs while allowiug for uncertai?ty iu the kuowlc&lg&& &&I... the scqucucc of co?trol actions th &t minimize & give? perfor&?ance iud&'x &&ve&' a fi&?te nu?&her olsteps. The p&occdu&e is based on the theory of controlled hi?rkov chains sud &nak&. s use of the classical technique of Dyna&ni&& Progra&nming, The &hoice...

Choudhary, Ashish

2012-06-07T23:59:59.000Z

430

United States involvement during the Arab-Israeli Six-Day War, June 1967: a study in crisis decision making  

E-Print Network [OSTI]

IJNITED S'I'AI'FS I. "ENVOI. Hi~If'?I' I)!fill. "I(; Tiff, :"IIA)l ISIJAi t. l SIX f)A'( IfAII, )UUI: 1967: A S'lflf)T IX CE'ISIS I' f. '. JSEO" )JAI'f. 'ff: I'I; . i s PAYNE IU'(I'IRIS))N, . 'IC. Sub))fitted to I i)c fil arluatc I ul...)loilg&h an cxcc! lent l&g?1 sc!!olui (55), hi ' pci ~ on:. ! Io', ; hcy &!&!", &!ai. or prob!lb! y ins not. onc that gcnci-;&to&1 public uttra!1!oi- - Is may I! I "0 h&11 c b&-'" n t!I&. c!Isc of Bits I& d! u' I!Ig !'I L'I L coul c !! s Sc&' I ?' Ilr'&' o f...

Harrison, Payne

2012-06-07T23:59:59.000Z

431

Studies on the effect of 1,2-dimethyl-5-nitroimidazole on growth and reproduction in turkeys and its residual concentration in tissues  

E-Print Network [OSTI]

cc kdby c cj tls Id g HI ct: ~lee ct d I. h *csee It c I L1 th dtc similar levels of 2-amino-5-nitrothiasole, and was better tolerated. Nt tt'?iisri'fe proved to ba vary wf far ctya ??r 0. 06g ot tbe d f? t fn rvduc tng moxcslftv utter... "?. Ai pt oi e t tt a, id 9(?I? Cal, T" lies of pro?fui t I?1'e? tttcrg?T pet pioufld f&f fce?t (0aloc ie:protein ral io. AA: l) was !Od t 1'o?s "0 'h;ougi; lg we? I: of age ('I'ah(1. l), a! whl?ph t Isis, 1''. ?e gT??wt h?aporia?. ?ti wir? t. Cr...

Condren, Howard B

2012-06-07T23:59:59.000Z

432

A study of the influence of rate of digestion upon rate of gain in immature beef cattle  

E-Print Network [OSTI]

~". vo '0 pip'lificoPte Thoro lg 0 q&pcs'. ~vo corro10t'ioo Vo't%000 r~)" (~B 0~id di. ' OOtirv) rot0 Pf ox%. ' 0 five' ~ ?ll)o co ro185ioll Cogff1~)ioot 0 of ~3++ M 'll0 CQOO af Crate i)rotor QM, pr' Oi)g9 for cru30 fit)or appar ~w bo i~);z~ lu4 doo... Vf Q rvX'OuOIl frco O. . tI'Qclip 'lZi+rll 11O &11?'. CO. WrlIO Otia??-O''ICOQSI. ='"Iir hi uic OvI'l r CO. rola"ioil Cce' fiCWI1:Oi t'. io' -" t-r csgoiloro IIQO Q Qoii-ci al: i'j cail'o IICI, Qtlvo cor elotioll bouilmoii :XI-I IIII1 rX;"OSti...

Baker, John Patton

2012-06-07T23:59:59.000Z

433

Graphical description of local Gaussian operations for continuous-variable weighted graph states  

E-Print Network [OSTI]

The form of a local Clifford (LC, also called local Gaussian (LG)) operation for the continuous-variable (CV) weighted graph states is presented in this paper, which is the counterpart of the LC operation of local complementation for qubit graph states. The novel property of the CV weighted graph states is shown, which can be expressed by the stabilizer formalism. It is distinctively different from the qubit weighted graph states, which can not be expressed by the stabilizer formalism. The corresponding graph rule, stated in purely graph theoretical terms, is described, which completely characterizes the evolution of CV weighted graph states under this LC operation. This LC operation may be applied repeatedly on a CV weighted graph state, which can generate the infinite LC equivalent graph states of this graph state. This work is an important step to characterize the LC equivalence class of CV weighted graph states.

Jing Zhang

2008-10-08T23:59:59.000Z

434

Fusion of symmetric $D$-branes and Verlinde rings  

E-Print Network [OSTI]

We explain how multiplicative bundle gerbes over a compact, connected and simple Lie group $G$ lead to a certain fusion category of equivariant bundle gerbe modules given by pre-quantizable Hamiltonian $LG$-manifolds arising from Alekseev-Malkin-Meinrenken's quasi-Hamiltonian $G$-spaces. The motivation comes from string theory namely, by generalising the notion of $D$-branes in $G$ to allow subsets of $G$ that are the image of a $G$-valued moment map we can define a `fusion of $D$-branes' and a map to the Verlinde ring of the loop group of $G$ which preserves the product structure. The idea is suggested by the theorem of Freed-Hopkins-Teleman. The case where $G$ is not simply connected is studied carefully in terms of equivariant bundle gerbe modules for multiplicative bundle gerbes.

A. L. Carey; Bai-Ling Wang

2005-05-14T23:59:59.000Z

435

A theoretical temperature distribution model for asymmetric and isotropic hollow-fiber bioreactors  

E-Print Network [OSTI]

nmnbering method will be used as the second order differential terms of equations (lg)-(18) have variable coefficients which are dependent on r (fig. 2). (ml+m2+m3+1 ) (n+1)+1 (m1+m2+m3+1 ) (n+1 ) re 'on re ion 2 re ion 1 a+2 1 2 . 1 g ~ 2 Numbering...;?ataj dv a ? 0 m1+m2+1 (T2)a j=m1+1 ml+m2+ms+1 S)3 ) j=ml+m'2+1 ml+m2+ 2 rajaadaj dr =52r ? dp(~ ? 52 Q T2 j rafaa~ajaj?dr jmml+ 2 BT' mr+m2+m3+1 T / aa;, aa?a j+ml+m2+1 r733t dr (65) Equation (65) can be expressed in matrix form dT' (~'H...

Nam, Ki Yun

2012-06-07T23:59:59.000Z

436

Characterization of Cathode Materials for Rechargeable Lithium Batteries using Synchrotron Based In Situ X-ray Techniques  

SciTech Connect (OSTI)

The emergence of portable telecommunication, computer equipment and ultimately hybrid electric vehicles has created a substantial interest in manufacturing rechargeable batteries that are less expensive, non-toxic, operate for longer time, small in size and weigh less. Li-ion batteries are taking an increasing share of the rechargeable battery market. The present commercial battery is based on a layered LiCoO{sub 2} cathode and a graphitized carbon anode. LiCoO{sub 2} is expensive but it has the advantage being easily manufactured in a reproducible manner. Other low cost layered compounds such as LiNiO{sub 2}, LiNi{sub 0.85}Co{sub 0.15}O{sub 2} or cubic spinels such as LiMn{sub 2}O{sub 4} have been considered. However, these suffer from cycle life and thermal stability problems. Recently, some battery companies have demonstrated a new concept of mixing two different types of insertion compounds to make a composite cathode, aimed at reducing cost and improving self-discharge. Reports clearly showed that this blending technique can prevent the decline in capacity caused by cycling or storage at elevated temperatures. However, not much work has been reported on the charge-discharge characteristics and phase transitions for these composite cathodes. Understanding the structure and structural changes of electrode materials during the electrochemical cycling is the key to develop better .lithium ion batteries. The successful commercialization of the lithium-ion battery is mainly built on the advances in solid state chemistry of the intercalation compounds. Most of the progress in understanding the lithium ion battery materials has been obtained from x-ray diffraction studies. Up to now, most XRD studies on lithium-ion battery materials have been done ex situ. Although these ex situ XRD studies have provided important information about the structures of battery materials, they do face three major problems. First of all, the pre-selected charge (discharge) states may not be representative for the full picture of the structural changes during charge (discharge). In other words, the important information might be missed for those charge (discharge) states which were not selected for ex situ XRD studies. Secondly, the structure of the sample may have changed after removed from the cell. Finally, it is impossible to use the ex situ XRD to study the dynamic effects during high rate charge-discharge, which is crucial for the application of lithium-ion batteries for electric vehicle. A few in situ studies have been done using conventional x-ray tube sources. All of the in situ XRD studies using conventional x-ray tube sources have been done in the reflection mode in cells with beryllium windows. Because of the weak signals, data collection takes a long time, often several hundred hours for a single charge-discharge cycle. This long time data collection is not suitable for dynamic studies at all. Furthermore, in the reflection mode, the x-ray beam probes mainly the surface layer of the cathode materials. Iri collaboration with LG Chemical Ltd., BNL group designed and constructed the cells for in situ studies. LG Chemical provided several blended samples and pouch cells to BNL for preliminary in situ study. The LG Chemical provided help on integrate the blended cathode into these cells. The BNL team carried out in situ XAS and XRD studies on the samples and pouch cells provided by LG Chemical under normal charge-discharge conditions at elevated temperature.

Yang, Xiao-Qing

2007-05-23T23:59:59.000Z

437

Universitt Hannover Studierendenstatistik WS 2002/03 Seite 1 von 9 Studiengang Abschlu-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

13 20 10 2 LGH 3 3 6 3 1 LGHR HR 4 12 7 4 2 4 1 34 16 1 LBS Bf. 11 2 7 3 5 1 3 32 12 LSo 11 10 10 14 LGH 1 1 0 0 LGHR HR 2 3 3 1 3 1 1 14 8 1 LBS Bf. 5 1 4 4 2 16 6 Promotion 7 7 2 6 8 2 4 1 1 3 91 132 (Erdkunde) LG 16 5 11 2 5 4 5 1 8 5 62 31 2 LR 2 3 11 16 7 LGH 1 1 0 LGHR HR 1 5 4 4 1 15 8 LSo 7 1 5 2 5 4

Vollmer, Heribert

438

Universitt Hannover Studierendenstatistik SS 2001 Studiengang Abschluss-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

36 19 2 LGH 8 3 3 14 7 2 LGHR HR 6 4 1 5 1 17 8 LBS 11 4 4 4 3 1 5 32 12 LSo 13 15 7 9 13 14 71 22 LR 1 3 2 4 10 6 LGH 1 1 0 0 LGHR HR 4 2 2 1 1 10 7 1 LBS 2 5 1 1 6 2 3 20 8 Erg.Prüf. 1 1 1 Promotion (Erdkunde) LG 14 1 10 3 6 1 10 2 3 2 9 61 31 1 LR 2 5 1 9 11 28 13 LGH 1 1 0 LGHR HR 4 4 2 1 11 6 LSo 9 3 2

Vollmer, Heribert

439

Nonlinear adaptive internal model control using neural networks  

E-Print Network [OSTI]

]. This concept of relative order allows one to determine whether the mapping between the input and out, put is one to one. For our system with Relative Order I, Lsh(*) j 0 Now, ah Lth(s) = ? f(*) as 3 191 W W as ah Lgh(s) = ? g(s) r ays Ws ? Wg rig 3...(. ) are the same asin the original system and L&h(Z) and LgL& 'h(Z) are Lze derivatives. rz is the relative order of the system. Thus the inverse of the recurrent neural network is the network itself. For cz = 1, ~s, ? Lgh(Z) Lsh(Z) Lsh(Z) g 0 m Ws ? Wzziz...

Gandhi, Amit Krushnavadan

2012-06-07T23:59:59.000Z

440

The microplankton off southern California  

E-Print Network [OSTI]

'I 3I 30 lgh I tdh T ld I I Tld I hl I Tld dig I Tld 0 NI I Il TM 29 Figure 5. June 1968 Dissolved and Particulate Organic Carbon (mg C/1) Figure 6. June 1968 Diatom and Total Numbers (No. /1) Figure 7. June 1968 Dinoflagellates... 0 1500 I I. I, I&I Oo tggh high High bib( Il ~ I J lbl bib ((gilt &Tltl lg(H/\\) Io 10 10 10 2 40D D30D -I JOUU I JN 1 t. 00 I 15 / D 15 t 3 High lgh I IM lgh ] 0 h I I&DO II ~ I (&0 31 drift and migration of phytoplanktors...

Whitley, Glenn Ross

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Universitt Hannover Studierendenstatistik WS 1999/2000 Seite 1 von 9 Studiengang Abschlu-Fachflle je Semester Summe Summe Summe  

E-Print Network [OSTI]

90 528 518 37 LG 40 3 24 51 3 41 4 44 1 35 67 313 153 3 LR 2 9 2 13 11 1 2 13 53 27 2 LGH 8 6 3 1 2 18 1 13 20 15 1 12 20 123 60 1 LR 1 4 2 1 3 5 16 8 1 LGH 1 1 1 LGHR HR 1 2 3 1 LBS 8 1 6 2 4 2 2 25 9 2 5 2 3 1 5 8 61 30 1 LR 1 8 11 2 7 4 8 41 20 LGH 1 1 LGHR HR 3 3 2 8 4 LSo 3 2 5 1 Promotion 1 1 15

Vollmer, Heribert

442

Nearly Tight Bounds on the Encoding Length of the Burrows-Wheeler Transform (Extended Abstract)  

E-Print Network [OSTI]

having length at most h such that every string from h has a unique pre x in Ph. Immediate consequences of this encoding- motivated entropy measure are that H h Hh and nH h lg n, but nHh can be a small constant. Let the optimal pre x cover P h... be the pre x cover that minimizes H h in (2.2). Thus, (2.2) can be equiva- lently stated as H h = 1n Px2P h jwxjH 0(wx).2 The empirical probabilities that are employed in the de - nition of the high-order empirical entropy can be ob- tained from the number...

Gupta, Ankur; Grossi, Roberto; Vitter, Jeffrey Scott

2008-01-01T23:59:59.000Z

443

Nepali Aawaz Volume 1, Issue 1, 5-12 October 2005  

E-Print Network [OSTI]

| kf/]sf5g . ufFpdf eL8Gt, xTofsf 36gfx? geP klg hgdfg;df ;Defljt eL8Gt, cfqmd0fsf] qf; eg] sfod} 5 .Continued on page 6 Discussing the Constitution Speculation over the governments plans to change the 1990 constitution has been strife in Nepal... ever since Vice-Chairman Tulsi Giris speech in Biratnagar on 20 Sept. Continued on page 8. sfg'gL ;Nnfx k|To]s AolQmsf] ;d:of j]Unf j]Un} vfnsf x'g] x'Fbf P6gL{ sf] ;Nnfx cg';f/ Asylum sf nflu cfj]bg ug]{ jf gug]{ egL lgSof}{n ug''{ plrt x'g] 5...

Shrestha, Kashish Das

444

Nepali Aawaz Volume 1, Issue 14, 10 May 2006  

E-Print Network [OSTI]

Qm ^) xhf/ lnP/ k7fPsf df]/sf oL tLg hgf b'O{ dlxgfb]lv stf/df cnkq k/]sf x'g\\ . pgLx?nfO{ vfg / a:g ;d]t sl7g ePsf] 5 . United we stand snfsf/x?sf] lab]z df]x 1974 AD: On Air bnfnn] em'SofP/ stf/df g]kfnL cnkq 21 #25; Nepali Aawaz... achieved something through this revolution. - Prem#25;Shrestha, Abukhaireni, Tanahun, in a letter to the editor of Kantipur. ut d+l;/ & ut] ;ft /fhg}lts bn tyf xfd|f] kf6L{aLr ;DkGg !@a'Fb] P]ltxfl;s ;dembf/Lk|lt k"0f{ k|lta4 x'Fb} ;+ljwfg...

Shrestha, Kashish Das

445

A study of load transfer capacities of four types of transverse contraction joints in concrete pavements  

E-Print Network [OSTI]

of the day. However, it is believed that Te~exatare Sisters Pertaining to Joiate ' lq R~ 8 $ ef the Dowele4 4'ointe Lfte~on Vemyerr tuxe. Time TSay? l2 F30 l&50 2l~ gs$0 4&~ 5&% 6& 30 'P &?0 8&$0 as%4 60 P 64 62 65 65 6l 62 lie X2t~ 3... 228 e 36 / I 33 ?Q28 ?020 44/ ?Q28 ?0?2 44?0 )t 10 ?01) ?017' it% ?2 - ?022 228 + $6 T F00 . 032 ?02343?8 +036 . ?034 -48?6 . 012 o012 30 0 ?018 30?0 230 + 36 P&83 gay OP4 lg 1 038 033 46 3 . 4c2$ -?013 All3 30 0 Aihk A22 $0?0 231 + 36 P q23, 020...

McDonald, James Newton

2012-06-07T23:59:59.000Z

446

Some factors influencing digestion and growth rates of beef steers  

E-Print Network [OSTI]

~K 20i49 34. 78 '2221 20+49 26. 81 mgs 20i49 26, 81 19i92 66i51 KlI 19a92 ~38. 7 21i10 ~0+9 Oi93 Oe93 0. 93 0, 90 8. 5T 98 e9 0 94 8. 63 98. 9 Oi94 Oi94 5. 23 li03 7. 49 4 01 KGF 1 i03 4il2 li22 lg ilHSUL')S kg... of the steers under the ccnditicns cf this oxparincnt? Dttssttss trials Tho results of tbo digestion tria1s aro a~ed in Table 5. Ths addition of cny supple+mt to tbo basal ration u ed throughout tlaso studies very signifioantIy (p (0. 01) inprcved ths...

Gossett, John Warren

2012-06-07T23:59:59.000Z

447

A study of the relationship between recreational user-day visits and the physical and economic characteristics of Texas water impoundment areas  

E-Print Network [OSTI]

St MldixLg ~ccd f Or 0 OIDPO i 8011 Pu P0888 c C lawson hc18 grOuped tb888 R eas an@ ' aotiViticss into broad Cat8gOX'ice I distz "bLLtiQXL olobe3y' appr01xixIatss thst of' tbe total population. These arei1s are used prizIarlly ln the af'ter work...+ & ~9. n+ 0@@@sex'. Beex'a@4ken~ Pv@e easel An 0 Tea e? Texea Agz culturgal Expex'ix3ent Sea@icn& S@lleWm, 3L01$~ Celle@e S@atien, Tepee, 3. $64 ~3. awe, Balskgh . eed. Reea eh cn Ch e en mie Peli As egfs eg 0 ee Re eie . . ' @Per yx'esenee4& W...

Jones, Ronnie D

2012-06-07T23:59:59.000Z

448

An investigation of the correlation of core analysis data with original core saturations in the Kelly-Snyder Field, Scurry County, Texas  

E-Print Network [OSTI]

with the oil ?as obtained, a copy of which is included as Table I' GAS ANALYSES Gas From Line 0 Keli - der Field A 8c M Colic e sll Ro~ %el Mo Aver s vsrage Mo Gas Used in Ex rijasnta vsr 8 Mo Carbon Diomide Nitrogen Methane Ethane Propane Iso-Butane... Normal-Butane Iao-Pentane Normal Pentane Heaanes plus . 26 4-99 54. 58 lg 80 1*23 3+33 . 28 ~ 27 1-75 5. 60 . 80 1, $9 . 63 1. 0$ lP. O) 51. 31 19~?7 19 ' 3Q 17. 68 16. @ 93 30 1. 69 ~ 27 ~ 07 66 51. 25 19 gO 28. 83 100 00 100...

Van Meter, Orville Everett, Jr

1952-01-01T23:59:59.000Z

449

A study of the error associated with global integration of differential equations  

E-Print Network [OSTI]

2 2 I- X cf W Jl- ? W O? Vl lg cc V Z 2 J 2 M VI Q J IU X O Q 2 0 I- 0 e Q VI J?IV ? 8 IU VflU R RS0 Ijl O II 0 J Y I- cf VQO 0 Vl Pl Pl Pl ~ ' 4 l 0 0 X I 0 Z IA 2 O X AII- N ? 0 25 VI 0 IU Z PI 0 d Pl a VINO... 1 +P (x) F(v)~ P&(v)-P&(v) dv 0 1 +Pg(x) F(v)~ Pg(v)-P2(v) dv+. . . . 0 0 'Hara also shows that 5 P& 1 (x)-P (x) = + x(1-x)P&(x); therefore, with more manipulation and the retention of the first m terms 1 y(xO+hx)='y(x )+h P (x) F(v) (1-v...

Farley, Arthur Reid

2012-06-07T23:59:59.000Z

450

A study of the plant composition and utilization by mixed classes of livestock and white-tailed deer on the Kerr Wildlife Management area  

E-Print Network [OSTI]

^ z*\\ ^ z * A A M CULlEGE OF TEXAS A STUDY OF THE PLOT COMPOSITION AND UTILIZATION BY MIXED CLASSES OF LIVESTOCK AND WHITE-TAILED DEER ON THE KERR WILDLIFE MANAGEMENT AREA A MCUULlEGECOF TOlEOF TGX S18cCEEL- EO E2L (lG-1GEL So2OOp Oe E2L... AnlCo1pE1lGp GF- TLo2GFCoGp ;OppLnL Oe )LsGU CF hGlECGp e1peCppcLFE Oe E2L lLa1ClLcLFEU eOl E2L MLnlLL Oe MOoEOl Oe d2CpOUOh2X JGF1GlXP 1959. Major Subject; Range Management A STUDY OF THE PLANT COM?031 ?ION AND UTILIZATION BY MIXED CLASSES...

May, Morton

2013-10-04T23:59:59.000Z

451

The influence of maleic hydrazide on apical dominance in Southern peas, Vigna sinensis, and broccoli, Brassica oleracea var. italica  

E-Print Network [OSTI]

+ to P% yya eyyliea te eelerf, ~ea ~els~s tsaneyLnssts, Ln ~ tbe nusher of see4staLhs. thite (A) vcr~? vith apples, Malus ~su . , xouM that "one appliccticn of abogt m(VA) px'. & cau oi n c(Replete 0 tcx". porarg csc of. apical ~nal&e PQI10'itin~~ th... for the eecueulstion of corbies. 8truck- yer (LG ) end ~1sen (Zg) reeor44 the phloen vsse~ bund1e Ls vRFJCcg eeeaee of collapse both ill etea i%st 1ANlveee Currier et a1. (9) cited tbe ?orb of Ofrolae4 who obeerired. %set fleas, ~ IN~tat ~~ txeaaed eitb a...

Jordan Molero, Francisco Luis

1954-01-01T23:59:59.000Z

452

Stresses in adhesive joints due to moisture sorption  

E-Print Network [OSTI]

) + independent variations bul, bu, bu, bv, bw, bw, 6w, bw, bql, e 2 6q2, 6P1, and 6p2 we obtain the following field equations: -N 1 -q =0 1 (a) N2 + q2 0 (b) -N -q +q =0 2 1 (c) a a ')e - ~22 ? ~21 - M, = ' (d) ? 5 1 h 1 -p =0 1 (e) -M2" = 0 lg a e...J e e = f 5 a c h n c As a further step consider the following non-dimensional quantities 18 and ND ue ? aue ND ye Te ND wl ? awl ND wZ = awZ ND x X c (35) whereby d 1 d 1 ? = ? = ? 0 dx c d ND c dx The non...

Jen, Ming-Hwa Robert

1980-01-01T23:59:59.000Z

453

Further fractionation studies on unidentified growth factors in distillers dried solubles  

E-Print Network [OSTI]

J. ?ro:&th f:&c oro. 'ev. ". ~1 labor. tor. i. ;. . ucv", utt . n?te. ' to 1. &cia:. o &'J m g' a ?. , uniko'&. '1 & iel "r3, i & f ' 0 "o . . r . & & n & ural eources ~ '&ovM . ZQ1 . Iau;9, . -'3) le . c &. '3, ? ' t 1e;r3 &9rt &. oo?f & f 3 'tor 1...ounl in 1 till r irioz uol ' 1 . . ~ fh& 1' gc' o; ', ', ':tahle o hoot, =":. ' ani . lkzli; olu)lo in =&her, e. . &ol ter ut . il lg 1'f oren-' &'. ! v. lu&; reci i . te i hg, shoal &otun- c c &cia &mt 1 . i &ce uto. I;; . : ot , . rhcJ. on fuller...

Rozacky, Eugene Emil

2012-06-07T23:59:59.000Z

454

Carcass studies of shortfed Hereford and crossbred (Hereford X Brahman) yearlings  

E-Print Network [OSTI]

, trachea, esophagus, ' snd hide trimmings. Ca;. &ass gx*a4eb Adgxxsteg . axes of eye nxxsole (Sq. in. ) Fat, thiolmess (mxx) , V, +88 40, 41 8. QV: N. S ~ lVa Sl N, S. e+-, Ql-Signifioant at, the lg livel of px. obability. a Wxxxsxaxy...?51 6Q?V5 11V. M ~SQ ~591: . 40, M ~80'1 TOTAL 945. 94 555, 5 5Q6. QV 5R8. 19 4'?QV 118 R4 6%i R . 58, . 15 41?QR 58?V5 a - Adjusted body length to mean carcase weight. b, Adjusted width of ehonlder to mean camaaa . weight. e - Adgwstsd width of a...

Handlin, Dale Lee

2012-06-07T23:59:59.000Z

455

U.S. DEPARThlFNT OF ENFRGY EERE PROJECT MANAGEMENT CENTER NFPA DETEIU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

~"I,' l\ ~"I,' l\ U.S. DEPARThlFNT OF ENFRGY EERE PROJECT MANAGEMENT CENTER NFPA DETEIU.llNATION RECIPIENT:Fairbanks North Star Borough PROJECT TITLE: Fairbanks Geothermal Energy Project Page 1 of2 STATE: AK Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO3219 GF0-0003219-002 0 Rued on my review orlhe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 45I.1A), I bne made the (ollowing determination: ex, EA, EIS APPENDIX AND NUMBt-:R: Description: 65.12 Workover (operations to restore production, such as deepening, plugging back, pulling and resetting lines. and squeeze cementll'lg) of an existing oil, gas, or geothermal well to restore production when workOVElf operations will be restricted

456

Modeling Turbulent Flow  

National Nuclear Security Administration (NNSA)

Turbulent Turbulent Flow with Implicit LES L.G. Margolin 1 Proceedings of the Joint Russian-American Five Laboratory Conference on Computational Mathematics/Physics 19-23 June, 2005 Vienna, Austria 1 Applied Physics Division, Los Alamos National Laboratory, Los Alamos, NM 87545, len@lanl.gov 1 Abstract Implicit large eddy simulation (ILES) is a methodology for modeling high Reynolds' num- ber flows that combines computational efficiency and ease of implementation with predictive calculations and flexible application. Although ILES has been used for more than fifteen years, it is only recently that significant effort has gone into providing a physical rationale that speaks to its capabilities and its limitations. In this talk, we will present new theoret- ical results aimed toward building a justification and discuss some remaining gaps in our understanding and our practical

457

Parke County Rural E M C | Open Energy Information  

Open Energy Info (EERE)

Parke County Rural E M C Parke County Rural E M C Jump to: navigation, search Name Parke County Rural E M C Place Indiana Utility Id 14471 Utility Location Yes Ownership C NERC Location RFC NERC RFC Yes ISO MISO Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png RATE SCHEDULE C (Rate 3 and 4) Commercial RATE SCHEDULE LG-OP (Rate 5) Commercial Rate Rider DG (Rate 11) Distributed Generation Rider Option 1 Commercial Rate Rider DG (Rate 11) Distributed Generation Rider Option 2 Commercial Rate Rider P (Rate 66) Prepaid Service Commercial Rate Rider RE(RATE 66) Residential

458

Data:De9a0635-838e-41b7-8641-83745123c0d1 | Open Energy Information  

Open Energy Info (EERE)

a0635-838e-41b7-8641-83745123c0d1 a0635-838e-41b7-8641-83745123c0d1 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Rock Hill, South Carolina (Utility Company) Effective date: 2013/07/01 End date if known: Rate name: General Service/Large Demand (Schedule LG) Sector: Industrial Description: Availability: Available only to consumers with a metered demand in excess of 750 kw, including commercial and industrial consumers, county building, schools, churches, and other eleemosynary consumers, for lighting, cooking, heating, refrigeration, water heating and other power service supplies to the individual store, industry, commercial establishment, or other qualified consumer through a single meter at one delivery point.

459

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

11 - 3320 of 26,777 results. 11 - 3320 of 26,777 results. Download Special Report: OAS-RA-13-10 The Department of Energy's Management of the Award of a $150 Million Recovery Act Grant to LG Chem Michigan Inc http://energy.gov/ig/downloads/special-report-oas-ra-13-10 Download CX-010687: Categorical Exclusion Determination Optimization Project Area #1 CX(s) Applied: B2.5, B5.2, B5.4, B5.5 Date: 07/26/2013 Location(s): Wyoming Offices(s): RMOTC http://energy.gov/nepa/downloads/cx-010687-categorical-exclusion-determination Download EIS-0350-S1: Amended Record of Decision Nuclear Facility Portion of the Chemistry and Metallurgy Research Building Replacement Project at Los Alamos National Laboratory, Los Alamos, NM http://energy.gov/nepa/downloads/eis-0350-s1-amended-record-decision Download EIS-0375: Draft Environmental Impact Statement

460

SATELLITES IN MILKY-WAY-LIKE HOSTS: ENVIRONMENT DEPENDENCE AND CLOSE PAIRS  

SciTech Connect (OSTI)

Previous studies showed that an estimate of the likelihood distribution of the Milky Way (MW) halo mass can be derived using the properties of the satellites similar to the Large and Small Magellanic Clouds (LMC and SMC). However, it would be straightforward to interpret such an estimate only if the properties of the Magellanic Clouds (MCs) are fairly typical and are not biased by the environment. In this study, we explore whether the environment of the MW affects the properties of the SMC and LMC such as their velocities. To test for the effect of the environment, we compare velocity distributions for MC-sized subhalos around MW hosts in a sample selected simply by mass and in the second sample of such halos selected with additional restrictions on the distance to the nearest cluster and the local galaxy density, designed to mimic the environment of the Local Group (LG). We find that satellites in halos in the LG-like environments do have somewhat larger velocities, as compared to the halos of similar mass in the sample without environmental constraints. For example, the fraction of subhalos matching the velocity of the LMC is 23% {+-} 2% larger in the LG-like environments. We derive the host halo likelihood distribution for the samples in the LG-like environment and in the control sample and find that the environment does not significantly affect the derived likelihood. We use the updated properties of the SMC and LMC to derive the constraint on the MW halo mass of log(M{sub 200}/M{sub Sun }) = 12.06{sub -0.19}{sup +0.31} (90% confidence interval). We also explore the incidence of close pairs with relative velocities and separations similar to those of the LMC and SMC and find that such pairs are quite rare among {Lambda}CDM halos. Only 2% of halos in the MW mass range have a relatively close pair ({Delta}r < 40 kpc and {Delta}s < 160 km s{sup -1}) of subhalos with circular velocities v{sub circ} > 50 km s{sup -1}. Pairs with masses and separations similar to those of the LMC and SMC ({Delta}r{sub MC} = 23.4 {+-} 10 kpc and {Delta}s{sub MC} = 128 {+-} 32 km s{sup -1}) are found only in one out of Almost-Equal-To 30, 000 MW-sized halos. Interestingly, the halo mass likelihood distribution for host halos constrained to have MC-like close pairs of subhalos is quite different from the global likelihood from which the MW halo mass constraint discussed above was derived. Taking into account the close separation of the MCs in the Busha et al. method results in the shift of the MW halo mass estimate to smaller masses, with the peak shifting approximately by a factor of two.

Gonzalez, Roberto E.; Kravtsov, Andrey V.; Gnedin, Nickolay Y., E-mail: regonzar@oddjob.uchicago.edu [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States)

2013-06-20T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

A review of Geocorinae of the United States east of the 100th parallel (Hemiptera: lygaeidae)  

E-Print Network [OSTI]

, Geocoris sonoraensis Van Duzeep G. BQ1 lt tht d, G. mt lt '1 -B, G. ~Std lt Elyb, 'dG~M'1 e tt h t ddd t y Ph dg. b< pl d Blebby, G. ~Mtt 1'N t BtR dg. ~ltt h dlN t d M dt p 1 tt . N typ d lg tdf G. ~td tdy), h. ~att (Say), G. bullatus (Say), and I... and the parameres of the male were dissected and removed to a clean spot plate. A few drops of 90? ethanol were placed on the spermatheca or paramere while it was being examined and drawn; care had to be taken to insure consistency in the views figured...

Sweet, Janice Readio

2012-06-07T23:59:59.000Z

462

Nonresonant hyper?Raman and hyper?Rayleigh scattering in benzene and pyridine  

E-Print Network [OSTI]

is discussed in Sec. III, and results and discussion are presented in Sec. IV, The HRS spectra of benzene and pyr- a) ACS-PRF Summer Research Fellow. Current address: Carroll College, Waukesha, WI 53186. b) Author to whom correspondence should be addressed...I(c)lI(a) + GG'rG'JrJI rIG (OJIi,GO -OJ\\)(OJJJ,GO -OJ\\ +OJs ) + GG'rG'JrJI rIG h a lI(b)lI(a)lI(c) ] (OJIi,GO + OJs )(OJJj,GO - OJ\\ + OJs ) (glQa li) vii) (l10) } X , b - b, where f..Lg'J = (G I (OIf..La IJ(O, etc. (7) The A term is the Condon...

Neddersen, John P.; Mounter, Sarah A.; Bostick, James M.; Johnson, Carey K.

1989-01-01T23:59:59.000Z

463

Heat pulse propagation in chaotic 3-dimensional magnetic fields  

E-Print Network [OSTI]

Heat pulse propagation in $3$-D chaotic magnetic fields is studied by solving the parallel heat transport equation using a Lagrangian-Green's function (LG) method. The LG method provides an efficient and accurate technique that circumvents limitations of finite elements and finite difference methods. The main two problems addressed are: (i) The dependence of the radial transport on the magnetic field stochasticity (controlled by the amplitude of the perturbation, $\\epsilon$); and (ii) The role of reversed shear configurations on pulse propagation. In all the cases considered there are no magnetic flux surfaces. However, radial transport is observed to depend strongly on $\\epsilon$ due to the presence of high-order magnetic islands and Cantori that act as quasi-transport barriers that preclude the radial penetration of heat pulses within physically relevant time scale. The dependence of the magnetic field connection length, $\\ell_B$, on $\\epsilon$ is studied in detail. The decay rate of the temperature maximum, $\\langle T \\rangle_{max}(t)$, the time delay of the temperature response as function of the radius, $\\tau$, and the radial heat flux $\\langle {{\\bf q}\\cdot {\\hat e}_\\psi} \\rangle$, are also studied as functions of the magnetic field stochasticity and $\\ell_B$. In all cases, the scaling of $\\langle T \\rangle_{max}$ with $t$ transitions from sub-diffusive, $\\langle T \\rangle_{max} \\sim t^{-1/4}$, at short times ($\\chi_\\parallel t 10^5$). A strong dependence on $\\epsilon$ is also observed on $\\tau$ and $\\langle {{\\bf q}\\cdot {\\hat e}_\\psi} \\rangle$. The radial propagation of pulses in fully chaotic fields considerably slows down in the shear reversal region and, as a result, $\\tau$, in reversed shear configurations is an order of magnitude longer than the one in monotonic $q$-profiles.

D. del-Castillo-Negrete; D. Blazevski

2014-09-10T23:59:59.000Z

464

SHORT VERSUS LONG AND COLLAPSARS VERSUS NON-COLLAPSARS: A QUANTITATIVE CLASSIFICATION OF GAMMA-RAY BURSTS  

SciTech Connect (OSTI)

Gamma-ray bursts (GRBs) are traditionally divided into long and short according to their durations (lg2 s). It was generally believed that this reflects a different physical origin: collapsars (long) and non-collapsars (short). We have recently shown that the duration distribution of collapsars is flat, namely, independent of the duration, at short durations. Using this model for the distribution of Collapsars we determine the duration distribution of non-Collapsars and estimate the probability that a burst with a given duration (and hardness) is a Collapsar or not. We find that this probability depends strongly on the spectral window of the observing detector. While the commonly used limit of 2 s is conservative and suitable for BATSE bursts, 40% of Swift's bursts shorter than 2 s are Collapsars and the division lg0.8 s is more suitable for Swift. We find that the duration overlap of the two populations is very large. On the one hand there is a non-negligible fraction of non-Collapsars longer than 10 s, while on the other hand even bursts shorter than 0.5 s in the Swift sample have a non-negligible probability to be Collapsars. Our results enable the construction of non-Collapsar samples while controlling the Collapsar contamination. They also highlight that no firm conclusions can be drawn based on a single burst and they have numerous implications concerning previous studies of non-Collapsar properties that were based on the current significantly contaminated Swift samples of localized short GRBs. Specifically (1) all known short bursts with z > 1 are most likely Collapsars; (2) the only short burst with a clear jet break is most likely a Collapsar, indicating our lack of knowledge concerning non-Collapsar beaming; and (3) the existence of non-Collapsars with durations up to 10 s imposes new challenges to non-Collapsar models.

Bromberg, Omer; Piran, Tsvi; Sari, Re'em [Racah Institute of Physics, The Hebrew University, 91904 Jerusalem (Israel)] [Racah Institute of Physics, The Hebrew University, 91904 Jerusalem (Israel); Nakar, Ehud [The Raymond and Berverly Sackler School of Physics and Astronomy, Tel Aviv University, 69978 Tel Aviv (Israel)] [The Raymond and Berverly Sackler School of Physics and Astronomy, Tel Aviv University, 69978 Tel Aviv (Israel)

2013-02-20T23:59:59.000Z

465

Performance Characteristics of Fluidized Bed Syngas Methanation over Ni-Mg/Al2O3 Catalyst  

Science Journals Connector (OSTI)

Abstract The performance characteristics of isothermal fluidized bed syngas methanation for substitute natural gas is investigated over a self-made Ni-Mg/Al2O3 catalyst. Via atmospheric methanation in a laboratory fluidized bed reactor it was clarified that the CO conversion varied in 5% when changing the space velocity in 40-120Lg-1h-1 but the conversion increased obviously by raising the superficial gas velocity from 4 to 12.4cms-1. The temperature 823K is suitable for syngas methanation while obvious deposition of uneasy-oxidizing C? occurs on the catalyst at temperatures around 873K. From kinetic aspect, the lowest reaction temperature is suggested to be 750K when the space velocity is 60Lg-1h-1. Raising the H2/CO ratio of the syngas increased proportionally the CO conversion and CH4 selectivity, showing that at enough high H2/CO ratios the active sites on the catalyst are sufficient for CO adsorption and in turn the reaction with H2 for forming CH4. Introducing CO2 into the syngas feed increased H2 consumption but suppressed water gas shift and Boudouard reactions. The ratio of CO2/CO in syngas should be better below 0.52 because varying the ratio from 0.52 to 0.92 resulted in negligible increases in the H2 conversion and CH4 selectivity but decreased the CH4 yield. Introducing steam into the feed gas affected little the CO conversion but decreased the selectivity to CH4. The tested Ni-Mg/Al2O3 catalyst manifested good stability in structure and activity even in syngas containing water vapor.

Jiao Liu; Dianmiao Cui; Jian Yu; Fabing Su; Guangwen Xu

2014-01-01T23:59:59.000Z

466

Total All Countries Exports of Crude Oil and Petroleum Products by  

U.S. Energy Information Administration (EIA) Indexed Site

Destination: Total All Countries Afghanistan Albania Algeria Andora Angola Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahama Islands Bahrain Barbados Belarus Belgium Belize Benin Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Bermuda Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Fiji Finland France French Guiana French Pacific Islands Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Ivory Coast Jamaica Japan Jordon Kazakhstan Kenya Korea, South Korea, North Kyrgyzstan Kutubu Kuwait Latvia Lebanon Liberia Libya Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands/Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Qatar Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Saudi Arabia Senegal Serbia and Montenegro Seychelles Sierra Leone Singapore Slovakia Slovenia Soloman Islands South Africa Spain Spratly Islands Sri Lanka Sudan Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Tonga Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Arab Emirates United Kingdom Uruguay Uzbekistan Vanuatu Venezuela Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Zambia Period-Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day

467

Studies of leukemia and thyroid disease among Chernobyl clean-up workers from the Baltics  

SciTech Connect (OSTI)

Following the reactor accident at Chernobyl in late April of 1986, hundreds of thousands of men from throughout the former Soviet Union were sent to Chernobyl to entomb the damaged reactor, remove radioactive debris, and help decontaminate the local environment. They remained for an average of three months and were allowed to accumulate up to 25 cGy of radiation before being sent home. Doses for some workers may have exceeded the allowable limit. The experience of Chernobyl clean-up workers is potentially informative about cancer risk associated with protracted exposure to low levels of radiation. Cohorts of clean-up workers from the Baltic Republics were assembled for study, based on military records and other lists. The study population includes 4,833 men from Estonia 5,709 from Latvia and at least 5,446 from Lithuania, where a pilot study is underway. They are being monitored for cancer incidence through linkages with the corresponding national cancer registries. Biodosimetric assays, including fluorescent in situ hybridization (FISH) for chromosome translocation analysis and the glycophorin A (GPA) somatic cell mutation assay, are being used to supplement information about radiation doses from worker records and questionnaires. Thyroid screening examinations, including palpation, ultrasound and, selectively, fine-needle aspiration biopsies were performed on nearly 2,000 workers in the Estonian cohort (mean age, 40 y) during the spring of 1995, nine years after the reactor accident. The study is still in progress. Work began first in Estonia, and results presented here pertain to this subgroup except as otherwise noted. The average age at the time of arrival at Chernobyl was 31 years. 62% were sent in 1986. Possible reasons for the apparent absence or rarity of radiation-induced thyroid nodules include low and protracted doses, low susceptibility among men exposed as adults, and insufficient passage of time since the accident.

Inskip, P.D. [National Cancer Institute, Rockville, MD (United States); Tekkel, M.; Rahu, M. [Institute of Experimental and Clinical Medicine, Tallinn (Estonia)] [and others

1997-03-01T23:59:59.000Z

468

Sustainable energy in Baltic States  

Science Journals Connector (OSTI)

Integration of New Member States to the European Union has created a new situation in the frame of implementation of the Lisbon strategy and EU Sustainable Development. The closure of Ignalina NPP is the biggest challenge to the energy sector development of the Baltic States. The Baltic States have quite limited own energy resources and in the Accession agreement with the EU Lithuania, Latvia and Estonia have verified their targets to increase the share of electricity produced from renewable energy sources (RES-E) by the year 2010. A wider use of renewable energy and increase of energy efficiency can make a valuable contribution to meeting the targets of sustainable development. The article presents a detailed overview of the present policies and measures implemented in the Baltic States, aiming to support the use of RES and the increase of energy efficiency. The review of possibilities to use the EU Structural Funds (SF) for the implementation of sustainable energy projects in the Baltic States was performed.The use of regional socialeconomicenvironmental indicators is the main key to integrate sustainable energy development at the program deployment level. The indicators to be used should describe the contribution of energy programs to the sustainable development, medium- and long-term trends and inter-relationship between them and the typical energy indicators (saved toe, improved energy efficiency, percentage of RES). Municipalities may play a considerable role by promoting sustainable energy since local authorities are fulfilling their functions in the energy sector via a number of roles. The Netherlands example shows that municipalities may act as facilitators by implementing national environmental policy and increasing energy efficiency in an integral part of these activities. The guidelines for Lithuanian local sustainable energy development using the SF co-financing have been presented.

Valentinas Klevas; Dalia Streimikiene; Ramute Grikstaite

2007-01-01T23:59:59.000Z

469

Total Net Imports of Crude Oil and Petroleum Products into the U.S.  

U.S. Energy Information Administration (EIA) Indexed Site

Country: Total All Countries Persian Gulf OPEC Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Afghanistan Albania Andora Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Egypt El Salvador Equatorial Guinea Ethiopia Eritrea Estonia Fiji Finland France French Pacific Islands French Guiana Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Korea, South Kutubu Kyrgyzstan Latvia Lebanon Liberia Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Senegal Serbia and Montenegro Sierra Leone Singapore Slovakia Slovenia South Africa Spain Spratly Islands Sri Lanka Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Togo Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Kingdom Uruguay Uzbekistan Vanuatu Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Other Non OPEC Period-Unit: Monthly-Thousand Barrels per Day Annual-Thousand Barrels per Day

470

wprime_s056210-web.dvi  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

May May 2012 by G. Brooijmans (Columbia University), M.-C. Chen (UC Irvine) and B.A. Dobrescu (Fermilab). The W ' boson is a hypothetical massive particle of electric charge ±1 and spin 1, which is predicted in various extensions of the Standard Model. W ' couplings to quarks and leptons. The Lagrangian terms describing couplings of a W '+ boson to fermions are given by W '+ µ √ 2 u i C R q ij P R +C L q ij P L γ µ d j +ν i C R l ij P R +C L l ij P L γ µ e j . (1) Here u, d, ν and e are the Standard Model fermions in the mass eigenstate basis, i, j = 1, 2, 3 label the fermion generation, and P R,L = (1 ± γ 5 )/2. The coefficients C L q ij , C R q ij , C L l ij , C R l ij are complex dimensionless parameters. If C R l ij = 0, then the ith generation includes a right-handed neutrino. Using this notation, the Standard Model W couplings are C L q = gV CKM , C L l = g and C R q = C R l = 0. Unitarity considerations imply that the W ' is a gauge boson

471

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays. Results from AMS-01  

E-Print Network [OSTI]

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper the relative abundances of the light nuclei lithium, beryllium, boron and carbon are presented. The secondary to primary ratios Li/C, Be/C and B/C have been measured in the kinetic energy range 0.35-45 GeV/nucleon. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3 GV. The secondary to secondary ratios Li/Be, Li/B and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model....

Aguilar, M; Allaby, J; Alpat, B; Ambrosi, G; Anderhub, H; Ao, L; Arefiev, A; Arruda, L; Azzarello, P; Basile, M; Barao, F; Barreira, G; Vartoloni, A; Battiston, R; Becker, R; Becker, U; Bellagamba, L; Bene, P; Berdugo, J; Berges, P; Bertucci, B; Biland, A; Bindi, V; Boella, G; Boschini, M; Bourquin, M; Bruni, G; Buenerd, M; Burger, J D; Burger, W J; Cai, X D; Cannarsa, P; Capell, M; Casadei, D; Casaus, J; Castellini, G; Cernuda, I; Chang, Y H; Chen, H F; Chen, H S; Chen, Z G; Chernoplekov, N A; Chiueh, T H; Choi, Y Y; Cindolo, F; Commichau, V; Contin, A; Cortina-Gil, E; Crespo, D; Cristinziani, M; Dai, T S; Dela Guia, C; Delgado, C; Di Falco, S; Djambazov, L; D'Antoine, I; Dong, Z R; Duranti, M; Engelberg, J; Eppling, F J; Eronen, T; Extermann, P; Favier, J; Fiandrini, E; Fisher, P H; Flugge, G; Fouque, N; Galaktionov, Y; Gervasi, M; Giovacchini, F; Giusti, P; Grandi, D; Grimm, O; Gu, W Q; Haino, S; Hangarter, K; Hasan, A; Hermel, V; Hofer, H; Hungerford, W; Ionica, M; Jongmanns, M; Karlamaa, K; Karpinski, W; Kenney, G; Kim, D H; Kim, G N; Kim, K S; Kirn, T; Klimentov, A; Kossakowski, R; Kounine, A; Koutsenko, V; Kraeber, M; Laborie, G; Laitinen, T; Lamanna, G; Laurenti, G; Lebedev, A; Lechanoine-Leluc, C; Lee, M W; Lee, S C; Levi, G; Lin, C H; Liu, H T; Lu, G; Lubelsmeyer, K; Luckey, D; Lustermann, W; Mana, C; Margotti, A; Mayet, F; McNeil, R R; Menichelli, M; Mihul, A; Mujunen, A; Oliva, A; Palmonari, F; Park, H B; Park, W H; Pauluzzi, M; Pauss, F; Pereira, R; Perrin, E; Pevsner, A; Pilo, F; Pimenta, M; Plyaskin, V; Pojidaev, V; Pohl, M; Produit, N; Quadrani, L; Rancoita, P G; Rapin, D; Ren, D; Ren, Z; Ribordy, M; Richeux, J P; Riihonen, E; Ritakari, J; Ro, S; Roeser, U; Sagdeev, R; Santos, D; Sartorelli, G; Sbarra, C; Schael, S; Schultz von Dratzig, A; Schwering, G; Seo, E S; Shin, J W; Shoumilov, E; Shoutko, V; Siedenburg, T; Siedling, R; Son, D; Song, T; Spada, F R; Spinella, F; Steuer, M; Sun, G S; Suter, H; Tang, X W; Ting, Samuel C C; Ting, S M; Tomassetti, N; Tornikoski, M; Torsti, J; Trumper, J; Ulbricht, J; Urpo, S; Valtonen, E; Vandenhirtz, J; Velikhov, E; Verlaat, B; Vetlitsky, I; Vezzu, F; Vialle, J P; Viertel, G; Vite, D; Von Gunten, H; Waldmeier Wicki, S; Wallraff, W; Wang, J Z; Wiik, K; Williams, C; Wu, S X; Xia, P C; Xu, S; Xu, Z Z; Yan, J L; Yan, L G; Yang, C G; Yang, J; Yang, M; Ye, S W; Zhang, H Y; Zhang, Z P; Zhao, D X; Zhou, F; Zhou, Y; Zhu, G Y; Zhu, W Z; Zhuang, H L; Zichichi, A; Zimmermann, B; Zuccon, P

2010-01-01T23:59:59.000Z

472

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays. Results from AMS-01  

E-Print Network [OSTI]

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper the relative abundances of the light nuclei lithium, beryllium, boron and carbon are presented. The secondary to primary ratios Li/C, Be/C and B/C have been measured in the kinetic energy range 0.35-45 GeV/nucleon. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3 GV. The secondary to secondary ratios Li/Be, Li/B and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model. A 10-15% overproduction of Be is found in the model predictions and can be attributed to uncertainties in the production cross-section data.

The AMS-01 Collaboration

2010-08-30T23:59:59.000Z

473

X-ray driven channeling acceleration in crystals and carbon nanotubes  

SciTech Connect (OSTI)

Acceleration of particles channeling in a crystal by means of diffracted x-rays via Bormann anomalous transmission was conceived for heavy ions and muons by Tajima and Cavenago [Phys. Rev. Lett. 59, 1440 (1987)], which potentially offers an appreciably high field gradient on the order of GV/cm. The theoretical model of the high gradient acceleration has been studied in two kinds of atomic structure, crystals and carbon nanotubes (CNTs), with analytic calculations and electromagnetic eigenmode simulations. A range of acceleration gradients and cutoffs of the x-ray power (the lowest power limit to overcome the Bremsstrahlung radiation losses) are characterized in terms of the lattice constants, unit cell sizes, and photon energies. The parametric analysis indicates that the required x-ray power can be reduced to an order of megawatt by replacing crystals with CNTs. Eventually, the equivalent dielectric approximation of a multi-wall nanotube shows that 250810 MeV muons can be synchronously coupled with x-rays of 0.651.32 keV in the accelerating structure.

Shin, Young-Min [Department of Physics, Northern Illinois Center for Accelerator and Detector Development (NICADD), Northern Illinois University, Dekalb, Illinois 60115 (United States) [Department of Physics, Northern Illinois Center for Accelerator and Detector Development (NICADD), Northern Illinois University, Dekalb, Illinois 60115 (United States); Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States); Still, Dean A.; Shiltsev, Vladimir [Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States)] [Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States)

2013-12-15T23:59:59.000Z

474

An asymmetric emittance electron source for the GALAXIE dielectric-laser accelerator injector  

SciTech Connect (OSTI)

The GALAXIE project is a program to develop an all-optical, very high field accelerator and undulator integrated SASE FEL system based on dielectric laser-excited structures that support >GV/m fields. These structures are very wide in one direction to allow adequate charge given beam loading considerations, but also having small (subwavelength) apertures in the narrow direction. Such small vertical dimensions yield strict restrictions on the emittance in this direction, while no such constraint exists in the wide transverse direction. However, the overall beam brightness is restricted by the performance requirements on the FEL. To meet these demands, we are studying a very high field gun with a magnetized cathode, yielding a beam with angular momentum content. This beam is then subject to a skew-quad triplet that splits the emittances; this process is reversed to give a round beam after acceleration. This symmetric emittance beam avoids gain-degrading multiple-transverse-mode operation of the FEL, which also demands that the effects of the angular momentum in the beam be mitigated. In this paper we discuss the RF design of an X-band gun to be operated at {approx}200 MV/m peak field giving a 1 pC magnetized beam with unprecedented brightness. We examine the design of the focusing and skew-quad systems, investigating the associated beam dynamics and efficacy of emittance splitting.

Valloni, A.; Cahill, A.; Fukusawa, A.; Musumeci, P.; Spataro, B.; Yakub, A.; Rosenzweig, J. B. [Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); Accelerator Division, Laboratori Nazionali di Frascati (INFN-LNF), Via E. Fermi 40, Frascati (RM) 00044 (Italy); Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States)

2012-12-21T23:59:59.000Z

475

Study of laser plasma interactions in the relativistic regime  

SciTech Connect (OSTI)

We discuss the first experimental demonstration of electron acceleration by a laser wakefield over instances greater than a Rayleigh range (or the distance a laser normally propagates in vacuum). A self-modulated laser wakefield plasma wave is shown to have a field gradient that exceeds that of an RF linac by four orders of magnitude (E => 200 GV/m) and accelerates electrons with over 1-nC of charge per bunch in a beam with space-charge-limited emittance (1 mm-mrad). Above a laser power threshold, a plasma channel, created by the intense ultrashort laser pulse (I approx. 4 x1018 W/CM2, gamma = 1 micron, r = 400 fs), was found to increase the laser propagation distance, decrease the electron beam divergence, and increase the electron energy. The plasma wave, directly measured with coherent Thomson scattering is shown to damp-due to beam loading-in a duration of 1.5 ps or approx. 100 plasma periods. These results may have important implications for the proposed fast ignitor concept.

Umstadter, D.

1997-08-13T23:59:59.000Z

476

Evidences of high energy protons with energies beyond 0.4 GeV in the solar particle spectrum as responsible for the cosmic rays solar diurnal anisotropy  

E-Print Network [OSTI]

Analysis on the daily variations of cosmic ray muons with $E_{\\mu}\\geq 0.2 GeV$ based on the data of two directional muon telescopes at sea level and with a rigidity of response to cosmic proton spectrum above 0.4 GV is presented. The analysis covers two months of observations and in 60% of days, abrupt transitions between a low to a high muon intensity and vice-verse is observed, the period of high muon intensity is from $\\sim 8.0h$ up to $\\sim 19.0h$ (local time) and coincides with the period when the interplanetary magnetic field (IMF) lines overtake the Earth. This behavior strongly suggest that the high muon intensity is due to a contribution of solar protons (ions) on the muon intensity produced by the galactic cosmic rays, responsible for the low muon intensity. This implies that the solar particle spectrum extends to energies beyond 1 GeV. We show that this picture can explain the solar daily variation origin, and it is a most accurate scenario than the assumption of corotating galactic cosmic ray with the IMF lines, specially in the high rigidity region. Obtained results are consistent with the data reported in others papers. Some aspects on the sensitivity of our muon telescopes are also presented.

C. E. Navia; C. R. A. Augusto; M. B. Robba; K. H. Tsui

2007-06-26T23:59:59.000Z

477

A study of the influence of vitamins, antibiotics and amino acids in the diet on the amino acid content of the plasma of chicks  

E-Print Network [OSTI]

'ead of Department ^Student Advisor) TUDO F HEINL CV EM, BPVKI,Ph, CV eBEFsBPHi FPEBbBCEBhH FPN FsBPC FhBNH BP EM, NB,E Cy EM, FsBPC FhBN hCPE,PE CV EM, nKFHsF CV hMBhyH F EG.lal AS Kocc kp brvordt( ac HfmAa}}.' }d }G. k^v'fv}. HtGddr du }G. F)^atfr}f^vr vc...' s.tGvcatvr hdrr.). du E.7vl ac ?v^}avr ufruarrA.c} du }G. ^.wfa^.A.c}l ud^ }G. '.)^.. du NChECg CV nMBKCHCnML TUDO badtG.Aal}^o vc' Pf}^a}adc FhyPCo?K,Nk,s,PEH EG. vf}Gd^ 1alG.l }d .7?^.ll Gal v??^.tav}adc vc' }Gvc(l }d Kp gp gatGv^'ldc ud^ Gal...

Blaylock, Lynn

2013-10-04T23:59:59.000Z

478

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays: Results from AMS-01  

Science Journals Connector (OSTI)

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper, the relative abundances of light-nuclei lithium, beryllium, boron, and carbon are presented. The secondary-to-primary ratios Li/C, Be/C, and B/C have been measured in the kinetic energy range 0.35-45GeVnucleon1. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3GV. The secondary-to-secondary ratios Li/Be, Li/B, and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model. A 10%-15% overproduction of Be is found in the model predictions and can be attributed to uncertainties in the production cross-section data.

M. Aguilar; J. Alcaraz; J. Allaby; B. Alpat; G. Ambrosi; H. Anderhub; L. Ao; A. Arefiev; L. Arruda; P. Azzarello; M. Basile; F. Barao; G. Barreira; A. Bartoloni; R. Battiston; R. Becker; U. Becker; L. Bellagamba; P. Bn; J. Berdugo; P. Berges; B. Bertucci; A. Biland; V. Bindi; G. Boella; M. Boschini; M. Bourquin; G. Bruni; M. Bunerd; J. D. Burger; W. J. Burger; X. D. Cai; P. Cannarsa; M. Capell; D. Casadei; J. Casaus; G. Castellini; I. Cernuda; Y. H. Chang; H. F. Chen; H. S. Chen; Z. G. Chen; N. A. Chernoplekov; T. H. Chiueh; Y. Y. Choi; F. Cindolo; V. Commichau; A. Contin; E. Cortina-Gil; D. Crespo; M. Cristinziani; T. S. Dai; C. dela Guia; C. Delgado; S. Di Falco; L. Djambazov; I. D'Antone; Z. R. Dong; M. Duranti; J. Engelberg; F. J. Eppling; T. Eronen; P. Extermann; J. Favier; E. Fiandrini; P. H. Fisher; G. Flgge; N. Fouque; Y. Galaktionov; M. Gervasi; F. Giovacchini; P. Giusti; D. Grandi; O. Grimm; W. Q. Gu; S. Haino; K. Hangarter; A. Hasan; V. Hermel; H. Hofer; W. Hungerford; M. Ionica; M. Jongmanns; K. Karlamaa; W. Karpinski; G. Kenney; D. H. Kim; G. N. Kim; K. S. Kim; T. Kirn; A. Klimentov; R. Kossakowski; A. Kounine; V. Koutsenko; M. Kraeber; G. Laborie; T. Laitinen; G. Lamanna; G. Laurenti; A. Lebedev; C. Lechanoine-Leluc; M. W. Lee; S. C. Lee; G. Levi; C. H. Lin; H. T. Liu; G. Lu; Y. S. Lu; K. Lbelsmeyer; D. Luckey; W. Lustermann; C. Maa; A. Margotti; F. Mayet; R. R. McNeil; M. Menichelli; A. Mihul; A. Mujunen; A. Oliva; F. Palmonari; H. B. Park; W. H. Park; M. Pauluzzi; F. Pauss; R. Pereira; E. Perrin; A. Pevsner; F. Pilo; M. Pimenta; V. Plyaskin; V. Pojidaev; M. Pohl; N. Produit; L. Quadrani; P. G. Rancoita; D. Rapin; D. Ren; Z. Ren; M. Ribordy; J. P. Richeux; E. Riihonen; J. Ritakari; S. Ro; U. Roeser; R. Sagdeev; D. Santos; G. Sartorelli; C. Sbarra; S. Schael; A. Schultz von Dratzig; G. Schwering; E. S. Seo; J. W. Shin; E. Shoumilov; V. Shoutko; T. Siedenburg; R. Siedling; D. Son; T. Song; F. R. Spada; F. Spinella; M. Steuer; G. S. Sun; H. Suter; X. W. Tang; Samuel C. C. Ting; S. M. Ting; N. Tomassetti; M. Tornikoski; J. Torsti; J. Trmper; J. Ulbricht; S. Urpo; E. Valtonen; J. Vandenhirtz; E. Velikhov; B. Verlaat; I. Vetlitsky; F. Vezzu; J. P. Vialle; G. Viertel; D. Vit; H. Von Gunten; S. Waldmeier Wicki; W. Wallraff; J. Z. Wang; K. Wiik; C. Williams; S. X. Wu; P. C. Xia; S. Xu; Z. Z. Xu; J. L. Yan; L. G. Yan; C. G. Yang; J. Yang; M. Yang; S. W. Ye; H. Y. Zhang; Z. P. Zhang; D. X. Zhao; F. Zhou; Y. Zhou; G. Y. Zhu; W. Z. Zhu; H. L. Zhuang; A. Zichichi; B. Zimmermann; P. Zuccon

2010-01-01T23:59:59.000Z

479

Muon Capture in Gaseous Hydrogen  

Science Journals Connector (OSTI)

An experiment to measure the muon nuclear capture rate in ultrapure gaseous hydrogen (8 atm, 293K) has been performed using a special target in which a system of gas proportional counters, working with the pure hydrogen of the target itself, were operating. Neutrons from the capture reactions were detected using a scintillation-counter technique, and the ?-ray background was eliminated by pulse-shape discrimination. The working conditions ensured that the captures were taking place in ?p atomic systems in a singlet total-spin state. The experimental result is ?expt=65157 sec-1, which has to be compared with the theoretical rate ?s,theor=62626 sec-1. From the experimental capture rate, and within the framework of the currently accepted theory, we have obtained for the induced pseudoscalar coupling constant gp=(-7.33.7)gV. The results of the present experiment are analyzed, together with results obtained from stopping negative muons in liquid hydrogen.

A. Alberigi Quaranta; A. Bertin; G. Matone; F. Palmonari; G. Torelli; P. Dalpiaz; A. Placci; E. Zavattini

1969-01-25T23:59:59.000Z

480

Recent Advances in Plasma Acceleration  

SciTech Connect (OSTI)

The costs and the time scales of colliders intended to reach the energy frontier are such that it is important to explore new methods of accelerating particles to high energies. Plasma-based accelerators are particularly attractive because they are capable of producing accelerating fields that are orders of magnitude larger than those used in conventional colliders. In these accelerators a drive beam, either laser or particle, produces a plasma wave (wakefield) that accelerates charged particles. The ultimate utility of plasma accelerators will depend on sustaining ultra-high accelerating fields over a substantial length to achieve a significant energy gain. More than 42 GeV energy gain was achieved in an 85 cm long plasma wakefield accelerator driven by a 42 GeV electron drive beam in the Final Focus Test Beam (FFTB) Facility at SLAC. Most of the beam electrons lose energy to the plasma wave, but some electrons in the back of the same beam pulse are accelerated with a field of {approx}52 GV/m. This effectively doubles their energy, producing the energy gain of the 3 km long SLAC accelerator in less than a meter for a small fraction of the electrons in the injected bunch. Prospects for a drive-witness bunch configuration and high-gradient positron acceleration experiments planned for the SABER facility will be discussed.

Hogan, Mark

2007-03-19T23:59:59.000Z

Note: This page contains sample records for the topic "lg latvia gv" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Ecological factors affecting growth and formation of sclerotia in Sclerotium rolfsii  

E-Print Network [OSTI]

L I B R A R Y A ft M COLLEGE OF TEXAS AftMtCOfLM ELfGFAT LXXAfGOSC CPtaG; LSe gtPcLGOtS tX TfMAhtGOL OP TfGiGAcurGGG2I PtMGTnn osg StAcLS el XMLetT L e2ddpgv*v2lr T3o02vvp! vl vHp Cg*!3*vp TJHll- lI vHp Lmg2J3-v3g*- *r! cpJH*r2J*- fl--pmp l...I GpD*d 2r 5*gv2*- I3-I2--0prv lI vHp gp132gp0prvd Ilg vHp !pmgpp lI etfGth t. .;OMtTt.;4 c*6 8)7? c*slg T3ospJv, .-*rv .*vHl-lm6 MOPhLh4

Flados, Norman D.

2013-10-04T23:59:59.000Z

482

A study of conception rates resulting from natural and artificial breeding of dairy cattle in Texas  

E-Print Network [OSTI]

? CCG89p-KXXt ji8X'ge't 8 4X"~ pt85CQ't sty:"M (Q) N8888X'L8$Cj vjt9 &ptttjXljeiLOXt8 ping'? Azmef. M Nm xt't 88888in X~z&88&81 RreeM@g P~ytx8 . , 'iitxt . 'txteett~ PA 48 Sag hatt 3, X+g, 8Xt8 f888 m~t Xg~ 294$ 'CXt QX8t~jtey Q? lQV, XA 'M ~i "8G...~33 'R, + gQ~QQ 6s. ? 5455 Q~, M 6g. & Wa Y9 5&~ ~9 Ui3& vp. M &6, 6'7 V2 y97 VQ~QV 78m, gV 6QyQg V2, N 27 I ZP M 83 B. ~J)8 TAKE XX 6 CG;K&~~ QF P% CERT RN-RET~ SY-~88 FUR CERTAIN BRTXFEXLX ~XM kQSQCXNXQM 3~ ~w, XEZXGD CCT~ 1, 1@gg...

Burleson, Richard Earl

2012-06-07T23:59:59.000Z

483

Farm and home television viewing habits and preferences of Caldwell County residents in 1955  

E-Print Network [OSTI]

vievigg '@le Qi'ogP@n. on en Qv@X'age of R, pl ti9nee:yex' nonuh, She, 70 m'henites who vptche5 the. yyogj'en eav iti on en GvQx'apB' Qf 2'~'g '69@os yex' PAnCh& 'Qh&&8 She 8( , :, , " LIHRARV. . A 4 IR CGt:L'AGE 'GF 7'g. ". AS. I 1$ gjgbXe 4, $'ejg... $$ mye. Wm. ~~@~ ~;@j:. 1 &@~O~@QP@', @QV 5g"; '~jj ~~@8jj:, '~$4I, ~q ~ t@ 8~4&4 Cy 6'~4. " 0~~~%4 FBS~W8: ~~ pg . , eU~tgg~ 4 ~:pC@ ~~8 M 5~4 @8~~ ~~. , ;"gg~ gQ, @ %et'e4 &e @~a~ X 4?~ve X4ee4 M CeX4xeX3, , 6~8;~ gg ~~~ 44~~'P~Q, p AQUA, . cv 4...

Sloan, Jack Thomas

2012-06-07T23:59:59.000Z

484

Controlled Electron Injection into Plasma Accelerators and SpaceCharge Estimates  

SciTech Connect (OSTI)

Plasma based accelerators are capable of producing electron sources which are ultra-compact (a few microns) and high energies (up to hundreds of MeVs) in much shorter distances than conventional accelerators. This is due to the large longitudinal electric field that can be excited without the limitation of breakdown as in RF structures.The characteristic scale length of the accelerating field is the plasma wavelength and for typical densities ranging from 1018 - 1019 cm-3, the accelerating fields and scale length can hence be on the order of 10-100GV/m and 10-40 mu m, respectively. The production of quasimonoenergetic beams was recently obtained in a regime relying on self-trapping of background plasma electrons, using a single laser pulse for wakefield generation. In this dissertation, we study the controlled injection via the beating of two lasers (the pump laser pulse creating the plasma wave and a second beam being propagated in opposite direction) which induce a localized injection of background plasma electrons. The aim of this dissertation is to describe in detail the physics of optical injection using two lasers, the characteristics of the electron beams produced (the micrometer scale plasma wavelength can result in femtosecond and even attosecond bunches) as well as a concise estimate of the effects of space charge on the dynamics of an ultra-dense electron bunch with a large energy spread.

Fubiani, Gwenael J.

2005-09-01T23:59:59.000Z

485

X-ray study of the electric double layer at the n-hexane/nanocolloidal silica interface  

E-Print Network [OSTI]

The spatial structure of the transition region between an insulator and an electrolyte solution was studied with x-ray scattering.The electron density profile across the n-hexane/silica sol interface (solutions with 5-nm, 7-nm, and 12-nm colloidal particles) agrees with the theory of the electrical double layer and shows separation of positive and negative charges. The interface consists of three layers, i.e., a compact layer of Na+, a loose monolayer of nanocolloidal particles as part of a thick diffuse layer, and a low-density layer sandwiched between them. Its structure is described by a model in which the potential gradient at the interface reflects the difference in the potentials of "image forces" between the cationic Na+ and anionic nanoparticles and the specific adsorption of surface charge. The density of water in the large electric field (1-10 GV/m) of the transition region and the layering of silica in the diffuse layer is discussed.

Aleksey M. Tikhonov

2006-09-11T23:59:59.000Z

486

Separation of flue-gas scrubber sludge into marketable products. Second quarterly technical progress report, December 1, 1993--February 28, 1994 (Quarter No. 2)  

SciTech Connect (OSTI)

To reduce their sulfur emissions, many coal-fired electric power plants use wet flue-gas scrubbers. These scrubbers convert sulfur oxides into solid sulfate and sulfite sludge, which must then be disposed of This sludge is a result of reacting limestone with sulfur dioxide to precipitate calcium sulfite and calcium sulfate. It consists of calcium sulfite (CaSO{sub 3}{lg_bullet}0.5H{sub 2}0), gypsum (CaSO{sub 4}{lg_bullet}2H{sub 2}0), and unreacted limestone (CaCO{sub 3}) or lime (Ca(OH){sub 2}), with miscellaneous objectionable impurities such as iron oxides; silica; and magnesium, sodium, and potassium oxides or salts. Currently, the only market for scrubber sludge is for manufacture of gypsum products, such as wallboard and plaster, and for cement. However, the quality of the raw sludge is often not high enough or consistent enough to satisfy manufacturers, and so the material is difficult to sell. This project is developing a process that can produce a high-quality calcium sulfite or gypsum product while keeping process costs low enough that the material produced will be competitive with that from other, more conventional sources. This purification will consist of minimal-reagent froth flotation, using the surface properties of the particles of unreacted limestone to remove them and their associated impurities from the material, leaving a purified gypsum or calcium sulfite product. The separated limestone will be a useful by-product, as it can be recycled to the scrubber, thus boosting the limestone utilization and improving process efficiency. Calcium sulfite will then be oxidized to gypsum, or separated as a salable product in its own right from sludges where it is present in sufficient quantity. The main product of the process will be either gypsum or calcium sulfite, depending on the characteristics of the sludge being processed. These products will be sufficiently pure to be easily marketed, rather that being landfilled.

Kawatra, S.K.; Eisele, T.C.

1994-03-01T23:59:59.000Z

487

THE ACS LCID PROJECT. VI. THE STAR FORMATION HISTORY OF THE TUCANA dSph AND THE RELATIVE AGES OF THE ISOLATED dSph GALAXIES  

SciTech Connect (OSTI)

We present a detailed study of the star formation history (SFH) of the Tucana dwarf spheroidal galaxy. High-quality, deep HST/ACS data, collected in the framework of the LCID project, allowed us to obtain the deepest color-magnitude diagram to date, reaching the old main-sequence turnoff (F814 {approx} 29) with good photometric accuracy. Our analysis, based on three different SFH codes, shows that Tucana is an old and metal-poor stellar system, which experienced a strong initial burst of star formation at a very early epoch ({approx_equal}13 Gyr ago) which lasted a maximum of 1 Gyr (sigma value). We are not able to unambiguously answer the question of whether most star formation in Tucana occurred before or after the end of the reionization era, and we analyze alternative scenarios that may explain the transformation of Tucana from a gas-rich galaxy into a dSph. Current measurements of its radial velocity do not preclude that Tucana may have crossed the inner regions of the Local Group (LG) once, and so gas stripping by ram pressure and tides due to a close interaction cannot be ruled out. A single pericenter passage would generate insufficient tidal heating to turn an originally disky dwarf into a true dSph; however, this possibility would be consistent with the observed residual rotation in Tucana. On the other hand, the high star formation rate measured at early times may have injected enough energy into the interstellar medium to blow out a significant fraction of the initial gas content. Gas that is heated but not blown out would also be more easily stripped via ram pressure. We compare the SFH inferred for Tucana with that of Cetus, the other isolated LG dSph galaxy in the LCID sample. We show that the formation time of the bulk of star formation in Cetus is clearly delayed with respect to that of Tucana. This reinforces the conclusion of Monelli et al. that Cetus formed the vast majority of its stars after the end of the reionization era implying, therefore, that small dwarf galaxies are not necessarily strongly affected by reionization, in agreement with many state-of-the-art cosmological models.

Monelli, M.; Gallart, C.; Hidalgo, S. L.; Aparicio, A.; Drozdovsky, I., E-mail: monelli@iac.e [Instituto de Astrofisica de Canarias, La Laguna, Tenerife (Spain)

2010-10-20T23:59:59.000Z

488

The stimulation of osteogenic differentiation of human adipose-derived stem cells by ionic products from akermanite dissolution via activation of the ERK pathway  

Science Journals Connector (OSTI)

Our previous study indicates that akermanite, a type of Ca-, Mg-, Si-containing bioceramic, can promote the osteogenic differentiation of hASCs. To elucidate the underlying mechanism, we investigated the effect of the extract from akermanite, on proliferation and osteogenic differentiation of hASCs. The original extract was obtained at 200mg akermanite/ml LG-DMEM and further diluted with LG-DMEM. The final extracts were denoted as 1/2, 1/4, 1/8, 1/16, and 1/32 extracts based on the concentrations of the original extract. The LDH assay and live/dead stain were used to reveal the cytotoxicity of the different extracts on hASCs, while the DNA assay was carried out to quantitatively evaluate the proliferation of cells after being cultured with the extracts for 1, 3 and 7 days. Flow cytometry for cell cycle analysis was carried out on cells cultured in two media (GM and 1/2 extract) in order to further analyze the effect of the extract on cell proliferation behaviors. Osteogenic differentiation of hASCs cultured in the extracts was detected by ALP expression and calcium deposition, and further confirmed by real-time PCR analysis. It was shown that Ca, Mg and Si ions in the extract could suppress the LDH release and proliferation of hASCs, whereas promote their osteogenic differentiation. Such effects were concentration-dependent with the 1/4 extract (Ca 2.36mM, Mg 1.11mM, Si 1.03mM) being the optimum in promoting the osteogenic differentiation of hASCs. An immediate increase in ERK was observed in cells cultured in the 1/4 extract and such osteogenic differentiation of hASCs promoted by released ions could be blocked by MEK1-specific inhibitor, PD98059. Briefly, Ca, Mg and Si ions extracted from akermanite in the concentrations of 2.36, 1.11, 1.03mM, respectively, could facilitate the osteogenic differentiation of hASCs via an ERK pathway, and suppress the proliferation of hASCs without significant cytotoxicity.

Huijie Gu; Fangfang Guo; Xiao Zhou; Lunli Gong; Yun Zhang; Wanyin Zhai; Lei Chen; Lian Cen; Shuo Yin; Jiang Chang; Lei Cui

2011-01-01T23:59:59.000Z

489

Hombres jvenes que tienen sexo con hombres: un colectivo en alto riesgo para la infeccin por el VIH?  

Science Journals Connector (OSTI)

ResumenObjetivos Comparar las variables asociadas al riesgo de infeccin por el VIH entre los hombres ?25 aos (jvenes) y >25 aos de edad que tienen sexo con hombres, y determinar las variables asociadas a la penetracin anal sin condn de los hombres jvenes con parejas sexuales ocasionales. Mtodo Durante 1 mes, 485 participantes ?25 aos y 1.470 >25 aos completaron una encuesta impresa aplicada en lugares de ambiente o a travs de Internet en Madrid, Barcelona, Bilbao y San Sebastin. La encuesta investig conductas sexuales de los ltimos 3 meses segn las parejas sexuales conocidas en lugares de ambiente y por Internet. Resultados No se encontraron diferencias significativas entre los hombres ?25 aos y >25 aos con respecto a la penetracin anal sin condn con parejas sexuales conocidas en lugares de ambiente (23% frente a 30%, p>0,05) o en Internet (29% frente a 30%, p>0,05), al uso del condn en la ltima penetracin anal y a haber tenido una infeccin de transmisin sexual en el ltimo ao (19% frente a 23%, p>0,05). Sin embargo, los encuestados >25 aos tuvieron un nmero promedio mayor de parejas sexuales conocidas en lugares de ambiente (9,2 frente a 7, psexo con hombres, los jvenes no estn expuestos a un mayor riesgo de infeccin por el VIH y de otras infecciones de transmisin sexual que los >25 aos. Sin embargo, algunas variables podran hablar de su vulnerabilidad. Objectives To compare variables associated with the risk of HIV among men ?25 years old who have sex with men (YMSM) and those >25 years old, and to determine the variables associated with unprotected anal intercourse (UAI) in YMSM with casual sexual partners. Method For 1 month, 485 participants ?25 years old and 1,470 aged >25 years old completed a pen-and-paper survey carried out in gay venues (GV) or via the Internet in Madrid, Barcelona, Bilbao and San Sebastin (Spain). The survey investigated sexual behaviors in the past 3 months according to whether the men met sexual partners in GV (SPGV) or on the Internet (SPI). Results No significant differences were found between YMSM and those >25 years old with respect to UAI with SPGV (23% vs. 30%, p>0.05) and SPI (29% vs. 30%, p>0.05), condom use in the last anal intercourse and having had a sexually-transmitted infection (STI) in the last year (19% vs. 23%, p>0.05). However, respondents>25 years old had a higher average number of SPGV (9.2 vs. 7, p<0.05) and SPI (8.9 vs. 6.4, p<0.05), were more likely to have used drugs while having UAI (68% vs. 55%, p<0.05, with SPI, and 73% vs. 55%, p<0.05, with SPGV) and had a higher prevalence of HIV (11% vs. 4%, p<0.05). When exploring other variables, we found that YMSM more frequently had receptive UAI with SPI (73% vs. 57%, p<0.05), had less time to be in a stable relationship, and their sexual partner more frequently convinced them to ha

Percy Fernndez-Dvila; Kati Zaragoza Lorca

2011-01-01T23:59:59.000Z

490

Newsletter Signup Form  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

EETD NEWSLETTER - MANAGE SUBSCRIPTIONS EETD NEWSLETTER - MANAGE SUBSCRIPTIONS (red fields are required) Manage subscriptions: Subscribe Unsubscribe Name E-Mail Affiliation Address Address (line 2) City State/Province Zip/Postal Code Country (please select a country) none Afghanistan Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegowina Botswana Bouvet Island Brazil British Indian Ocean Territory Brunei Darussalam Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Congo, the Democratic Republic of the Cook Islands Costa Rica Cote d'Ivoire Croatia (Hrvatska) Cuba Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France France, Metropolitan French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guinea Guinea-Bissau Guyana Haiti Heard and Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic of) Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, Democratic People's Republic of Korea, Republic of Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia, The Former Yugoslav Republic of Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia, Federated States of Moldova, Republic of Monaco Mongolia Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island Northern Mariana Islands Norway Oman Pakistan Palau Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russian Federation Rwanda Saint Kitts and Nevis Saint LUCIA Saint Vincent and the Grenadines Samoa San Marino Sao Tome and Principe Saudi Arabia Senegal Seychelles Sierra Leone Singapore Slovakia (Slovak Republic) Slovenia Solomon Islands Somalia South Africa South Georgia and the South Sandwich Islands Spain Sri Lanka St. Helena St. Pierre and Miquelon Sudan Suriname Svalbard and Jan Mayen Islands Swaziland Sweden Switzerland Syrian Arab Republic Taiwan, Province of China Tajikistan Tanzania, United Republic of Thailand Togo Tokelau Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Tuvalu Uganda Ukraine United Arab Emirates United Kingdom United States United States Minor Outlying Islands Uruguay Uzbekistan Vanuatu Venezuela Viet Nam Virgin Islands (British) Virgin Islands (U.S.) Wallis and Futuna Islands Western Sahara Yemen Yugoslavia Zambia Zimbabwe

491

Particle identification with the AMS-02 RICH detector: search for dark matter with antideuterons  

E-Print Network [OSTI]

The Alpha Magnetic Spectrometer (AMS), whose final version AMS-02 is to be installed on the International Space Station (ISS) for at least 3 years, is a detector designed to measure charged cosmic ray spectra with energies up to the TeV region and with high energy photon detection capability up to a few hundred GeV, using state-of-the art particle identification techniques. It is equipped with several subsystems, one of which is a proximity focusing Ring Imaging Cherenkov (RICH) detector equipped with a dual radiator (aerogel+NaF), a lateral conical mirror and a detection plane made of 680 photomultipliers and light guides, enabling precise measurements of particle electric charge and velocity (Delta beta / beta ~ 10^-3 and 10^-4 for Z=1 and Z=10-20, respectively) at kinetic energies of a few GeV/nucleon. Combining velocity measurements with data on particle rigidity from the AMS-02 Tracker (Delta R / R ~ 2% for R=1-10 GV) it is possible to obtain a reliable measurement for particle mass. One of the main topics of the AMS-02 physics program is the search for indirect signatures of dark matter. Experimental data indicate that dark, non-baryonic matter of unknown composition is much more abundant than baryonic matter, accounting for a large fraction of the energy content of the Universe. Apart from antideuterons produced in cosmic-ray propagation, the annihilation of dark matter will produce additional antideuteron fluxes. Detailed Monte Carlo simulations of AMS-02 have been used to evaluate the detector's performance for mass separation, a key issue for anti-D/anti-p separation. Results of these studies are presented.

Lusa Arruda; Fernando Baro; Rui Pereira

2007-10-04T23:59:59.000Z

492

Constraints on particle dark matter from cosmic-ray antiprotons  

E-Print Network [OSTI]

Cosmic-ray antiprotons represent an important channel for dark matter indirect-detection studies. Current measurements of the antiproton flux at the top of the atmosphere and theoretical determinations of the secondary antiproton production in the Galaxy are in good agreement, with no manifest deviation which could point to an exotic contribution in this channel. Therefore, antiprotons can be used as a powerful tool for constraining particle dark matter properties. By using the spectrum of PAMELA data from 50 MV to 180 GV in rigidity, we derive bounds on the dark matter annihilation cross section (or decay rate, for decaying dark matter) for the whole spectrum of dark matter annihilation (decay) channels and under different hypotheses of cosmic-rays transport in the Galaxy and in the heliosphere. For typical models of galactic propagation, the constraints are significantly strong, setting a lower bound on the dark matter mass of a "thermal" relic at about 50 -- 90 GeV for hadronic annihilation channels. These bounds are enhanced to about 150 GeV on the dark matter mass, when large cosmic-rays confinement volumes in the Galaxy are considered, and are reduced to 4-5 GeV for annihilation to light quarks (no bound for heavy-quark production) when the confinement volume is small. Bounds for dark matter lighter than few tens of GeV are due to the low energy part of the PAMELA spectrum, an energy region where solar modulation is relevant: to this aim, we have implemented a detailed solution of the transport equation in the heliosphere, which allowed us not only to extend bounds to light dark matter, but also to determine the uncertainty on the constraints arising from solar modulation modeling. Finally, we estimate the impact of soon-to-come AMS-02 data on the antiproton constraints.

N. Fornengo; L. Maccione; A. Vittino

2013-12-12T23:59:59.000Z

493

Constraints on particle dark matter from cosmic-ray antiprotons  

E-Print Network [OSTI]

Cosmic-ray antiprotons represent an important channel for dark matter indirect-detection studies. Current measurements of the antiproton flux at the top of the atmosphere and theoretical determinations of the secondary antiproton production in the Galaxy are in good agreement, with no manifest deviation which could point to an exotic contribution in this channel. Therefore, antiprotons can be used as a powerful tool for constraining particle dark matter properties. By using the spectrum of PAMELA data from 50 MV to 180 GV in rigidity, we derive bounds on the dark matter annihilation cross section (or decay rate, for decaying dark matter) for the whole spectrum of dark matter annihilation (decay) channels and under different hypotheses of cosmic-rays transport in the Galaxy and in the heliosphere. For typical models of galactic propagation, the constraints are significantly strong, setting a lower bound on the dark matter mass of a "thermal" relic at about 50-90 GeV for hadronic annihilation channels. These bounds are enhanced to about 150 GeV on the dark matter mass, when large cosmic-rays confinement volumes in the Galaxy are considered, and are reduced to 4-5 GeV for annihilation to light quarks (no bound for heavy-quark production) when the confinement volume is small. Bounds for dark matter lighter than few tens of GeV are due to the low energy part of the PAMELA spectrum, an energy region where solar modulation is relevant: to this aim, we have implemented a detailed solution of the transport equation in the heliosphere, which allowed us not only to extend bounds to light dark matter, but also to determine the uncertainty on the constraints arising from solar modulation modeling. Finally, we estimate the impact of soon-to-come AMS-02 data on the antiproton constraints.

N. Fornengo; L. Maccione; A. Vittino

2015-01-30T23:59:59.000Z

494

Lorentz Transformations  

E-Print Network [OSTI]

This paper describes a particularly didactic and transparent derivation of basic properties of the Lorentz group. The generators for rotations and boosts along an arbitrary direction, as well as their commutation relations, are written as functions of the unit vectors that define the axis of rotation or the direction of the boost (an approach that can be compared with the one that in electrodynamics, works with the electric and magnetic fields instead of the Maxwell stress tensor). For finite values of the angle of rotation or the boost's velocity, collectively denoted by V, the existence of an exponential expansion for the coordinate transformation's matrix, M (in terms of GV where G is the generator) requires that the matrix's derivative with respect to V, be equal to GM. This condition can only be satisfied if the transformation is additive as it is indeed the case for rotations, but not for velocities. If it is assumed, however, that for boosts such an expansion exists, with V = V(v), v being the velocity, and if the above condition is imposed on the boost's matrix then its expression in terms of hyperbolic cosh(V) and sinh(V} is recovered, and the expression for V(= arc tanh(v)) is determined. A general Lorentz transformation can be written as an exponential containing the sum of a rotation and a boost, which to first order is equal to the product of a boost with a rotation. The calculations of the second and third order terms show that the equations for the generators used in this paper, allow to reliably infer the expressions for the higher order generators, without having recourse to the commutation relations. The transformationmatrices for Weyl spinors are derived for finite values of the rotation and velocity, and field representations, leading to the expression for the angular momentum operator, are studied.

Bernard R. Durney

2011-12-09T23:59:59.000Z

495

UI,!JTYT) CTaTT:$ A'  

Office of Legacy Management (LM)

.w. .w. q7 -3 UI,!JTYT) CTaTT:$ A' =O:iI c E' XI:' ;' r' CO1 1-1 S?IO" New Ynrl: Operations Office 70 Columbus iivenue xew Yor'k '?5, 3. Y. I;JFOi< ~,4?' 101? F(:i{ Ti!T; DRESS P)R j:g&isZ No. 17, fi?HIL 2, i-31r:j T:?l3i",TlAY r. I.:. Tel. No. Plaza r[-3600, Ext. 2rjj Aridi l!.L, lg.l3 The United States Atomic Energy Commission has oomploted arrangements with the Federal 'urorlrs Agency for tne use of ths Magnesium Keduction Plant (Pluncor 649) at Luckey, Ohio, for the production of beryllium metal and compounds, ililbur E. Kelley, Xanager of ;Jew ilork Operations of the U. S. Atomic Energy Commission, r?ncs\lr,ced today. Under the al*rangement with the Federai Xorl-s Agency, the Commission acquires the use of certsin plant buildings and equipment for a five year

496

Data:62c6d107-bce0-4ab1-a047-e65cfcc48d3b | Open Energy Information  

Open Energy Info (EERE)

c6d107-bce0-4ab1-a047-e65cfcc48d3b c6d107-bce0-4ab1-a047-e65cfcc48d3b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Parke County Rural E M C Effective date: 2012/04/01 End date if known: Rate name: RATE SCHEDULE LG-OP (Rate 5) Sector: Commercial Description: Parke County REMC shall charge and collect for large general off-peak electric service on the following basis: availability, application, character of service, monthly rate, minimum charge, purchased power cost adjustment clause and tax adjustment. AVAILABILITY: This schedule is available to any member of the REMC for three phase power, located within the territory served by Parke County REMC and adjacent to electric distribution facilities that are adequate and suitable for supplying required service. The member must be able to show the ability to consistently shift their peak demand away from the coincident with the peak demand of the wholesale power supplier. Service under this schedule is provided on a yearly basis. Service under this schedule is not applicable as standby service.

497

Data:76383b62-d154-4a14-a46a-1cd08a74a3e1 | Open Energy Information  

Open Energy Info (EERE)

b62-d154-4a14-a46a-1cd08a74a3e1 b62-d154-4a14-a46a-1cd08a74a3e1 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Burlington-Electric, Vermont (Utility Company) Effective date: 2010/03/01 End date if known: Rate name: Large General Service (LG) Rate Demand exceeds 25KW-Net Metered Renewable Energy Source Rider Sector: Industrial Description: Service under this rate is supplied for all purposes where energy consumption is 3,000 kWh per month or above (or greater than or equal to 100 kWh per day) for 3 consecutive months out of the last 12 months, or at the request of the customer.

498

Data:7f0301ab-b8f6-442e-bb87-e115ff1332e8 | Open Energy Information  

Open Energy Info (EERE)

01ab-b8f6-442e-bb87-e115ff1332e8 01ab-b8f6-442e-bb87-e115ff1332e8 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Burlington-Electric, Vermont (Utility Company) Effective date: 2010/03/01 End date if known: Rate name: Large General (LG) Rate Demand is less than 25KW- Net Metered Renewable Energy Source Rider Sector: Industrial Description: Service under this rate is supplied for all purposes where energy consumption is 3,000 kWh per month or above (or greater than or equal to 100 kWh per day) for 3 consecutive months out of the last 12 months, or at the request of the customer.

499

WAR DEPARTaMMeNT  

Office of Legacy Management (LM)

i i ..I WAR DEPARTaMMeNT Imentory~at ~etnl Bydridaa aa of 2i Js+ua?y is 20 toxss Bozml. .' imsntary Of 10 t0z.w allc7fs 10 tom as BX0683. p 5 Production of heels at Ravsre Coppsr & Brass Com_saay: ~ ExLrwion ia axpested to continua at 30 tons par waskand, whioh _ ..-,:~ is squix&mt to 130 tons per average nonth.Bcri;lg Febrmryx ht is estiziited ~.;'i thxt extrusionail be 6% on old specification bilf&a snd 30;; on nsv billets. It is estixstad or:ly nsa apasifioatim billets will be extmdad ., during Pm-oh sad April. Yisld of haala from new billets is eatizatsd at S$ and ou old billets at-83. C'n this basis, productioc of heals during Pebriarf ..; eouals S tons and'duriuC ,farch and Aaril equals 1% tons, xssking a total of .-;:: .Z& tons of heels available duriag this period.~ It ma assuned thst the .:;

500

Data:19353b70-5153-4557-8be7-db6dc100b549 | Open Energy Information  

Open Energy Info (EERE)

b70-5153-4557-8be7-db6dc100b549 b70-5153-4557-8be7-db6dc100b549 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Russell, Massachusetts (Utility Company) Effective date: 2009/01/01 End date if known: Rate name: LARGE GENERAL SERVICE SCHEDULE LG Sector: Industrial Description: Additional Info: Availability: To any non-residential customer having a three phase service. With a consistent demand less than (a) 80kw of demand/per 30 minutes and/or (b) 30,000 kWhr's per month. Minimum Bill: $40.00 / Month. Plus $4.00 per kVA for transformer capacity installed if customer exceeds 80kw and/or 30,000kWhr's per month.