Powered by Deep Web Technologies
Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

A technical look at the WTI incinerator  

SciTech Connect

EPA has granted Waste Technologies Industries (WTI) temporary authorization to burn hazardous waste in its new incinerator in East Liverpool, Ohio. The approval is based on preliminary data showing that the incinerator was able to meet EPA`s emission standards for dioxins and furans in tests run this summer. WTI is allowed to continue burning waste pending final evaluation of its March 1993 performance tests. The action marks yet another hurdle cleared by WTI in its 11-year effort to construct and operate a commercial hazardous waste incinerator. The facility`s long-standing predicament as a target for environmental and public interest groups has made it the subject of numerous lawsuits and many legal reviews. In this article, however, we focus on the technical aspects of the system. The WTI incinerator is described in {open_quotes}Performance Testing of a Rotary Kiln Incinerator,{close_quotes} a paper by Alfred Sigg of Von Roll, Incorporated (Norcross, Georgia). The paper was presented at the 1993 Incineration Conference, which was held in Knoxville, Tennessee on May 3-7, 1993. 1 fig., 2 tabs.

NONE

1993-11-01T23:59:59.000Z

2

Picosecond laser ablation of nano-sized WTi thin film  

Science Journals Connector (OSTI)

Interaction of an Nd:YAG laser, operating at 532 nm wavelength and pulse duration of 40 ps, with tungsten-titanium (WTi) thin film (thickness, 190 nm)...2...were found to be sufficient for modification of the WTi

S. Petrovi?; B. Gakovi?; D. Peruško; T. Desai; D. Batani; M. ?ekada…

2009-08-01T23:59:59.000Z

3

Thermal diffusion in Au?WTi?Pd metallization on silicon  

Science Journals Connector (OSTI)

This paper presents the results of investigation of thermal diffusion in Au?Wti?Pd metallization on (111) n-Si. Thin films were deposited by dc sputtering to the thickness of 50 (Pd), 100–200 (WTi) and 70–200 nm (Au). After deposition the samples were subjected to thermal treatments vacuum 1 × 10?5 mbar, at temperatures up to 600°C. Characterization included RBS, AES, XRD and SEM structural analysis and sheet resistivity measurements. During annealing up to 450°C diffusion occurs only at the Pd?Si interface, at 500°C other components interdiffuse at isolated areas of the samples and at 600°C there is total interdiffusion on components. Thermal degradation oftthe \\{WTi\\} diffusion barrier is enhanced by the growth of Pd2Si phase, during which silicon is released from the substrate and mechanical stress is introduced. Better diffusion barrier properties were obtained when \\{WTi\\} films were deposited in nitrogen or oxygen atmosphere.

M Milosavljevi?; N Bibi?; M Stojanovi?; J Turkovi?; I.H Wilson

1990-01-01T23:59:59.000Z

4

Revealing asymmetries in the loss function of WTI oil futures market  

Science Journals Connector (OSTI)

This paper examines behavioural aspects of the West Texas Intermediate (WTI) oil 1-month futures from 1995 to ... regarding preferences. Even without observing fundamentals of WTI oil futures we can assess whethe...

E. C. Mamatzakis

2014-09-01T23:59:59.000Z

5

Structure–Diffusion Relationship of Magnetron-Sputtered WTi Barriers Used in Indium Interconnections  

Science Journals Connector (OSTI)

Tungsten-titanium (WTi) thin films are known as potential adhesion ... and diffusion barriers. The barrier efficiency of WTi thin films against indium (In) diffusion...in situ...annealing. Specific multilayered s...

A. Le Priol; E. Le Bourhis; P.-O. Renault; P. Muller…

2014-03-01T23:59:59.000Z

6

Economically rational expectations theory: evidence from the WTI oil price survey data  

E-Print Network (OSTI)

Economically rational expectations theory: evidence from the WTI oil price survey data Georges PRAT are not conclusive regarding this hypothesis. Moosa and Al- Loughani (1994) find that futures prices on the WTI of whether or not expectations are rational unsolved. Using private WTI oil price expectations revealed

Paris-Sud XI, Université de

7

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

7 7 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources failed to find much realization in actual stocks data. The idea that stocks are still languishing at below-normal levels is particularly persuasive when one views current levels (for key consuming regions) relative to "normal" values which account for the long-term trend in OECD stocks. We believe that monthly average WTI prices will stay around $30 per barrel for the first part of 2001. This is a noticeable upward shift in our projected average prices from even a month ago. The shift reflects greater emphasis on the lack of stock builds and less emphasis on the assumption that supply from OPEC and non-OPEC suppliers may be exceeding demand by 1-2

8

Comparison of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si with respect to thermal stability and diffusion behavior of Ti  

Science Journals Connector (OSTI)

Abstract The thermal stability of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si (1 0 0) was investigated by time of flight secondary ion mass spectrometry (ToF-SIMS) depth profiling, X-ray diffraction (XRD), electron microscopy (SEM and TEM) and X-ray photoelectron spectroscopy (XPS). For both, Al and Cu, Ti diffusion out of \\{WTi\\} into the metal was proved to occur at elevated temperatures (400 °C for Al and 600 °C for Cu) which further results in barrier film failure. Nitrogen incorporation into \\{WTi\\} leads to an elimination of the Ti diffusion and consequently to a better thermal stability of the barrier film. It is shown that besides crystal structure, Ti diffusion into the metallization is an essential factor of the barrier failure mechanism. The failure temperature for Al is lower than for Cu.

M. Fugger; M. Plappert; C. Schäffer; O. Humbel; H. Hutter; H. Danninger; M. Nowottnick

2014-01-01T23:59:59.000Z

9

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

9 9 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

10

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

6 6 Notes: Spot WTI crude oil prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

11

Evaluation of the composition and morphology of a WTi/Si system processed by a picosecond laser  

Science Journals Connector (OSTI)

In this work we studied the influence of laser radiation on the composition, structure and morphology of WTi thin films deposited on n-type (100...2...were found to be sufficient for modification of the WTi/silic...

Suzana Petrovi?; D. Peruško; I. Radovi?-Bogdanovi?…

2012-06-01T23:59:59.000Z

12

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 2. Introduction  

SciTech Connect

Contents: Overview; Facility Background; Risk Assessment History at WTI; Peer Review Comments and Key Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

13

Real-time curvature and optical spectroscopy monitoring of magnetron-sputtered \\{WTi\\} alloy thin films  

Science Journals Connector (OSTI)

Abstract \\{WTi\\} thin films are known as potential adhesion promoters and diffusion barriers. \\{WTi\\} thin films were deposited by magnetron sputtering from an alloyed target (W:Ti ~ 70:30 at.%). Real-time surface differential reflectance (SDR) spectroscopy and wafer-curvature measurements were performed during deposition to study the growth and the film continuity threshold. SDR measurements during \\{WTi\\} deposition allow the determination of the change in reflectivity of p-polarized light (at Si substrate Brewster's angle) between \\{WTi\\} film and Si substrate in order to monitor layer growth. The comparison between experimental and simulated \\{WTi\\} SDR signals assuming a homogeneous and continuous layer growth shows that film continuity is ensured beyond a thickness of 4.5 ± 0.2 nm. Real-time wafer-curvature measurements allow the determination of the intrinsic stress development in the film. Two regimes are noticed during the growth up to the development of a compressive steady state stress. The early stages of growth are rather complicated and divided into sub-regimes with similar boundaries revealed by both in situ techniques. Deposition of an interfacial continuous layer different from \\{WTi\\} bulk is suggested by both in situ techniques below a thickness of 4.5 nm.

A. Le Priol; L. Simonot; G. Abadias; P. Guérin; P.-O. Renault; E. Le Bourhis

2013-01-01T23:59:59.000Z

14

Wear behaviour of tool steels with added (WTi)C particles  

Science Journals Connector (OSTI)

The volume fraction of hard second phase particles in tool steels is limited by the formation of large interconnected carbides on solidification that embrittle the alloy. In this work, a novel carbide master alloy, FeWTiC, which contains (WTi)C particles, was used to increase the volume fraction of carbide in an H21 hot work die steel (0.3%C, 9%W, 3%Cr). Additions of up to 5 vol.% (WTi)C were successfully made to the vacuum melted steel, producing a homogeneous distribution of (WTi)C throughout the microstructure. TEM and fracture testing confirmed that a good bond existed between the (WTi)C and martensitic matrix. Wear testing was undertaken using pure sliding against an M2 tool steel counterface, in a block on ring configuration, in the load range of 54–254 N and a sliding speed of 0.98 m/s. At 54 N, an increase in volume fraction of (WTi)C gave a reduction in wear coefficient, associated with predominantly oxidational wear, with associated ploughing of the tool steel surface by oxide particles. At higher loads the addition of (WTi)C did not result in reduced wear rates. In addition to oxidational wear, delamination occurred, frequently initiated at the matrix/M6C particle interface. Fracture of the (WTi)C became more common as the load increased. A 1% (WTi)C marginally reduced the depth of deformation compared to the H21, but further additions had little additional effect. Detailed TEM indicated the complex interaction between oxide formation and surface deformation of the tool steel. The relationship between wear mechanism and microstructure is discussed.

A.J. Leonard; W.M. Rainforth

2003-01-01T23:59:59.000Z

15

Development of WTI and turbidity estimation model using SMA — application to Kushiro Mire, eastern Hokkaido, Japan  

Science Journals Connector (OSTI)

A new water-turbidity index (WTI) based on multispectral images was developed and tested at Kushiro Mire, eastern Hokkaido, Japan. An algorithm for turbidity estimation was developed and applied to Landsat TM images to monitor the turbid water on the mire surface during the snow-melting season. We used spectral mixture analysis (SMA) to produce a turbidity estimation model. The SMA “unmixes” a mixed pixel determining the fractions due to each spectral end member. In this study, we used four end members (1, alder; 2, reed; 3, high-concentration turbid water (485 ppm); 4, low-concentration turbid water (10 ppm) measured in the test site. The WTI was determined by the following equation: WTI=amax/(amax+amin), where amax is abundance of high-concentration turbid water and amin is abundance of low-concentration turbid water. The end-member spectra of alder and reed were measured in the laboratory using specimens collected at the test site. The spectrum of turbid water was measured at the test sites. The relative abundance of each end member was estimated based on this spectral information using SMA. The same formula was applied to Landsat TM images. Then we applied the WTI equation to the end-member images to obtain a WTI map. In the mire wetland region, turbid water spreads under alder trees and reed grasses. To verify our turbidity estimation method based on WTI under these conditions, we constructed a small experimental wetland consisting of mixed stands of alder and reed. WTI was calculated from the mixed spectrum of this “artificial wetland” and the regression curve for the relation between WTI and the actual turbidity was determined (R2=.91). Finally, this regression equation was used to derive a turbidity map from the WTI image.

Satoshi Kameyama; Yoshiki Yamagata; Futoshi Nakamura; Masami Kaneko

2001-01-01T23:59:59.000Z

16

Composition and structure modification of a WTi/Si system by short laser pulses  

Science Journals Connector (OSTI)

Picosecond (40 ps) pulsed Nd:YAG laser irradiation of a WTi thin film on silicon with a wavelength...2...was performed in air. This led to significant changes of the chemical composition and morphology on the sur...

S. Petrovi?; B. Gakovi?; D. Peruško; B. Radak; T. Desai; J. Kova?…

2010-03-01T23:59:59.000Z

17

Exploring the WTI crude oil price bubble process using the Markov regime switching model  

Science Journals Connector (OSTI)

Abstract The sharp volatility of West Texas Intermediate (WTI) crude oil price in the past decade triggers us to investigate the price bubbles and their evolving process. Empirical results indicate that the fundamental price of WTI crude oil appears relatively more stable than that of the market-trading price, which verifies the existence of oil price bubbles during the sample period. Besides, by allowing the WTI crude oil price bubble process to switch between two states (regimes) according to a first-order Markov chain, we are able to statistically discriminate upheaval from stable states in the crude oil price bubble process; and in most of time, the stable state dominates the WTI crude oil price bubbles while the upheaval state usually proves short-lived and accompanies unexpected market events.

Yue-Jun Zhang; Jing Wang

2014-01-01T23:59:59.000Z

18

Chemical and structural modifications of laser treated WTi surfaces at different ambient conditions  

Science Journals Connector (OSTI)

In this work we have studied the influence of laser modification on the composition and structure of tungsten titanium (WTi) thin films, deposited on n...-type (100) silicon wafers. After deposition, the samples ...

S. Petrovi?; D. Peruško; D. Milovanovi?; Z. Siketi?; M. Jakši?…

2011-11-01T23:59:59.000Z

19

Influence of target structure on film stress in WTi sputtering  

SciTech Connect

In this report, the effect of sputtering target microstructure on the deposited film stress was investigated. By controlling the metallurgical process, two types of W-10wt%Ti target constituents, namely single-phase and multiple-phase WTi, were prepared. The former one was composed of W-rich ({beta}Ti,W) phase only, the latter one was with W, W-rich ({beta}Ti,W) and Ti-rich ({beta}Ti,W) phases. The stress of the films deposited on 12.7 cm diameter silicon oxide wafers from the single-phase target tends to be more compressive than that from the multiple-phase target. By increasing wafer temperature, the compressive stress was linearly decreased. In addition, the level of film stress was also affected by the film thickness and other sputtering parameters. To understand the causes for the differences in film stress between the multiple-phase and single-phase derived films, an evaluation of the film structure using a field-emission scanning electron microscope (FE-SEM) and mechanical testing using a nano-indentation instrument were performed. Finer domains with denser laminar structure were observed on the films deposited from the single-phase target. However, no significant difference in mechanical properties was found between these two from the nano-indentation measurements. It is envisioned that the more uniform solid solution between the W and Ti in the films obtained by sputtering the single-phase targets generates a higher compressive stress when deposited on the silicon oxide wafers resulting in a higher compressive stress.

Lo, C.F.; Wang, H.; Gilman, P. [Materials Research Corp., Orangeburg, NY (United States)

1998-12-31T23:59:59.000Z

20

Influence of a d.c. substrate bias on the resistivity, composition, crystallite size and microstrain of \\{WTi\\} and WTi-N films  

Science Journals Connector (OSTI)

The influence of a d.c. substrate bias on the properties of \\{WTi\\} and WTi-N films deposited by r.f. magnetron sputtering has been studied. The bias voltage was varied from 0 to ?200 V. The \\{WTi\\} films structure is b.c.c. W with the presence of the h.c.p. Ti phase at low bias (0 to ?50 V). For the WTi-N films, the structure is f.c.c. TiN at low bias and b.c.c. W + f.c.c. TiN at high bias (?100 V to ?200 V). Both films exhibit the columnar morphology. The titanium fraction in the films is lower than in the target and decreases when the bias increases owing to a titanium preferential resputtering caused by the ion bombardment of the substrate. The same behaviour is found for the film resistivity which diminishes when the bias is increased whereas the crystallite size increases. The microstrains have a more complex variation with the bias.

H. Ramarotafika; G. Lemperiere

1995-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Microsoft PowerPoint - uncertainty_wti_2011_2012.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

1 1 - December 2012 January 2011 December 2012 Historical WTI price and 95% NYMEX Confidence Interval, January 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, February 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, March 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, April 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, May 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5

22

Microsoft PowerPoint - uncertainty_wti_2009_2010.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

09 09 - December 2010 January 2009 December 2010 Historical WTI price and 95% NYMEX Confidence Interval, January 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 1 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, February 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 2 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, March 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 3 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, April 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 4 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX

23

Microsoft PowerPoint - uncertainty_past_wti.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

3 3 - January 2014 January 2013 January 2014 Historical WTI price and 95% NYMEX Confidence Interval, January 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, February 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, March 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, April 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, May 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5 2012

24

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio)  

SciTech Connect

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

25

Effects of the pulse duration in laser modification of nano-sized WTi film on Si  

Science Journals Connector (OSTI)

A study of morphological and composition changes of the WTi/Si system induced by nanosecond and picosecond laser pulses is presented. A 190 nm thick WTi film was deposited on a silicon substrate of n-type (100). The pulsed laser systems used were: nanosecond TEA CO2 laser (emission, 10.6 µm; pulse FWHM; pulse duration 120 ns) and picosecond Nd:YAG laser (emission, 532 nm; pulse FWHM; pulse duration 40 ps). During experiments the used fluences (?) had similar values, ?1 = 20 J  cm ? 2 in case of the TEA CO2 laser and ?2 = 16 J cm ? 2 for the Nd:YAG laser. The laser-induced morphological and composition modifications showed a dependence on pulse duration. Generally, the following morphological changes were observed: (i) ablation/exfoliation of the WTi thin film, (ii) appearance of hydrodynamic features such as resolidified material, and (iii) formation of nano-sized grains and globules. Overall morphological modifications were more pronounced after the picosecond laser action. The surface composition analysis showed a quite different distribution of sample components depending on the pulse duration. Formation of the silicon dioxide (SiO2) was recorded only in the case of irradiation of the WTi/Si system by picosecond laser pulses.

Suzana Petrovi?; D Peruško; D Milovanovi?; J Kova?; M ?ekada; P Panjan; B Gakovi?; M Trtica

2010-01-01T23:59:59.000Z

26

Speculative trading and oil price dynamic: A study of the WTI market  

Science Journals Connector (OSTI)

The aim of this paper is to study the oil price dynamic in West Texas Intermediate (WTI) market in the US. By using statistical and econometric tools, we first attempt to identify the long term relationship between WTI spot prices and the prices of futures contracts on the New York Mercantile Exchange (NYMEX). Subsequently we model the short term dynamic between these two prices and this analysis points up several breaks. On this basis, a short term Markov Switching Vectorial Error Correction model (MS-VECM) with two distinct states (standard state and crisis state) has been estimated. Finally we introduce the volumes of transactions observed on the NYMEX for the WTI contracts and we estimate the influence of the non-commercial players. We conclude that the hypothesis of an influence of non-commercial players on the probability for being in the crisis state cannot be rejected. In addition, we show that the rise in liquidity of the first financial contracts, as measured by the volume of open interest, is a key element to understand the dynamics in market prices.

Emmanuel Hache; Frédéric Lantz

2013-01-01T23:59:59.000Z

27

Structure-stress-resistivity relationship in WTi alloy ultra-thin and thin films prepared by magnetron sputtering  

Science Journals Connector (OSTI)

WTi thin films were prepared from an alloyed target (W:Ti ? 70:30?at. %) by magnetron sputtering. Body-centered cubic W x T i 1 ? x solid solutions with a { 110 } fiber texture and columnar grains have been produced with 0.75 WTi thin films is about 60 ? 200 ? ? ? ? cm depending on the film thickness and microstructure (sputtering conditions). For both ultra-thin (9.5?nm) and thin (180?nm) films a stress transition from compressive to tensile is observed as the working pressure increases. The process-structure-property relations of the WTi ultra-thin and thin films are discussed in relation with the state of the art.

P.-O. Renault

2013-01-01T23:59:59.000Z

28

Modeling dynamic conditional correlations in WTI oil forward and futures returns  

Science Journals Connector (OSTI)

This paper estimates the dynamic conditional correlations in the daily returns on West Texas Intermediate (WTI) oil forward and futures prices from 3 January 1985 to 16 January 2004, using recently developed multivariate conditional volatility models. We find that the dynamic conditional correlations can vary dramatically, being negative in four of ten cases and being close to zero in another five cases. Only in the case of the dynamic volatilities of the three-month and six-month futures returns is the range of variation relatively narrow, namely (0.832, 0.996).

Alessandro Lanza; Matteo Manera; Michael McAleer

2006-01-01T23:59:59.000Z

29

Minimum variance hedging with bivariate regime-switching model for WTI crude oil  

Science Journals Connector (OSTI)

This paper proposes a four-regime bivariate Markov regime-switching model to estimate the daily time-varying minimum variance hedge ratios for West Texas Intermediate (WTI) crude oil, and evaluates its in- and out-of-sample hedging performances with two-regime model, CC-GARCH, TVC-GARCH, and OLS models. Empirical results reveal that the four-regime Markov switching model outperforms the other models for both in- and out-of-sample hedging performance. Based on Hansen’s SPA test (2005), the four-regime model significantly outperforms the other models for only in-sample hedging.

Jui-Cheng Hung; Yi-Hsien Wang; Matthew C. Chang; Kuang-Hsun Shih; Hsiu-Hsueh Kao

2011-01-01T23:59:59.000Z

30

Treatment of \\{WTi\\} Contacts on silicon with low energy argon ions  

Science Journals Connector (OSTI)

Thin layers of \\{WTi\\} were deposited by ion sputtering on p- and n-type Si(111) substrates. The initial target composition is 90: 10 W: Ti, the thicknesses of the layers were 200 and 350 nm, and the layers were grown at a rate of 10 nm min?1. After deposition, the contacts were bombarded by backsputtering with Ar+ ions at 3.5 keV. The as-deposited layers from a surface barrier on both substrates (0.62 V on n-Si and 0.66 V on p-Si). During ion bombardment, to doses from 0.5 × 1018 to 5 × 1018 ions cm?2, the barrier is reduced until the contacts become non-rectifying. The main effect during bombardment is sputtering and development of topography (scanning electron microscopy analysis), but there is also a shallow mixing at the interface (as shown by Rutherford backscattering and X-ray analyses). During annealing at 800 °C, pronounced metal-silicon interdiffusion is observed in bombarded specimens and not in unbombarded specimens. So-formed silicides renew the rectifying properties of \\{WTi\\} contacts, with an effective barrier height of 0.66–0.69 V on n-Si.

M. Milosavljevi?; N. Bibi?; I.H. Wilson; D. Peruško

1988-01-01T23:59:59.000Z

31

Report on the technical workshop on WTI incinerator risk issues. Held in Washington, DC on December 8-9, 1993  

SciTech Connect

The report includes information and materials from a peer review workshop organized by EPA's Risk Assessment Forum (RAF) for the Office of Solid Waste and Emergency Response and Region 5. The meeting was held in Washington, DC, at the Holiday Inn Capitol on December 8-9, 1993. The subject of the peer review was a draft project plan prepared by EPA Region 5 for assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. The peer review panel was convened to evaluate the project plan as the scientific foundation for a risk assessment, which will be used in setting final permit conditions for the WTI facility.

Not Available

1993-12-01T23:59:59.000Z

32

WTI Crude Oil Prices Are Expected To Remain Relatively High Through At  

Gasoline and Diesel Fuel Update (EIA)

5 5 Notes: As we just saw, one of the primary factors impacting gasoline price is the crude oil price. This graph shows monthly average spot West Texas Intermediate crude oil prices. Spot WTI crude oil prices broke $36 per barrel in November briefly as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. Crude oil prices are expected to be about $30 per barrel for the rest of this year, but note the uncertainty bands on this projection. They give an indication of how difficult it is to know what these prices are going to do. Also, EIA does not forecast volatility. This relatively flat forecast could be correct on average, with wide swings around the base line. With the EIA forecast for crude prices staying high this year,

33

Can GARCH-class models capture long memory in WTI crude oil markets?  

Science Journals Connector (OSTI)

This paper investigates the issue whether GARCH-type models can well capture the long memory widely existed in the volatility of WTI crude oil returns. In this frame, we model the volatility of spot and futures returns employing several GARCH-class models. Then, using two non-parametric methods, detrended fluctuation analysis (DFA) and rescaled range analysis (R/S), we compare the long memory properties of conditional volatility series obtained from GARCH-class models to that of actual volatility series. Our results show that GARCH-class models can well capture the long memory properties for the time scale larger than a year. However, for the time scale smaller than a year, the GARCH-class models are misspecified.

Yudong Wang; Chongfeng Wu; Yu Wei

2011-01-01T23:59:59.000Z

34

Surface modification of a \\{WTi\\} thin film on Si substrate by nanosecond laser pulses  

Science Journals Connector (OSTI)

Interaction of a nanosecond transversely excited atmospheric (TEA) CO2 laser, operating at 10.6 ?m, with tungsten–titanium thin film (190 nm) deposited on silicon of n-type (1 0 0) orientation, was studied. Multi-pulse irradiation was performed in air atmosphere with laser energy densities in the range 24–49 J/cm2. The energy absorbed from the laser beam was mainly converted to thermal energy, which generated a series of effects. The following morphological changes were observed: (i) partial ablation/exfoliation of the \\{WTi\\} thin film, (ii) partial modification of the silicon substrate with formation of polygonal grains, (iii) appearance of hydrodynamic features including nano-globules. Torch-like plumes started appearing in front of the target after several laser pulses.

S. Petrovi?; B. Gakovi?; D. Peruško; M. Trtica; B. Radak; P. Panjan; Š. Miljani?

2008-01-01T23:59:59.000Z

35

Behavior patterns of axis deer (Axis axis) in Texas  

E-Print Network (OSTI)

BEHAVIOR PATTERNS OF AXIS DEER (AXIS AXIS) IN TEXAS A Thesis by Eugene Robert Fuchs Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree MASTER OF SCIENCE August 1976 Major... Subject: Wildlife and Fisheries Sciences BEHAVIOR PATTERNS OF AXIS DEER (AXIS AXIS) IN TEXAS A Thesis by Eugene Robert Fuchs Approved as to style and content by: (Chairman of Comm ttee) Head of Department) Member ) ( ember August 1976 ABSTRACT...

Fuchs, Eugene Robert

2012-06-07T23:59:59.000Z

36

Auto-correlated behavior of WTI crude oil volatilities: A multiscale perspective  

Science Journals Connector (OSTI)

In this paper, we investigate the long-range auto-correlated behavior of WTI crude oil volatility series employing multifractal detrended fluctuation analysis. Our findings show that the for small time scales, the auto-correlations of volatilities were multifractal while for large time scales, the auto-correlations were nearly monofractal. Based on multiscale analysis, we also investigate the dynamics of auto-correlations for different intervals of time scales and find that several shocks could make significant effects on the auto-correlated behaviors for small time scales. Analyzing the dynamics of multifractality degrees of auto-correlations for small time scales, we find that the stronger auto-correlations were always related to the lower degrees of multifractality. At last, we have discussions on the determination factors of price behavior, the predictive implications of scaling behavior in volatilities for oil markets and the reasons why long-range auto-correlations of volatility were always strong for both small time scales and large time scales. Our results are very important theoretically and practically.

Yudong Wang; Yu Wei; Chongfeng Wu

2010-01-01T23:59:59.000Z

37

WTI crude oil Futures in portfolio diversification: The time-to-maturity effect  

Science Journals Connector (OSTI)

The aim of the paper is to analyze the diversification effect brought by crude oil Futures contracts, the most liquid commodity Futures, into a portfolio of stocks. The studies that have documented the very low- and essentially negative-correlations between commodities and equities typically rely on normally distributed returns, which is not the case for crude oil Futures and stocks indexes. Moreover, the particular time-to-maturity chosen for the Future contract used as an investment vehicle is an important matter that needs to be addressed, in presence of forward curves switching between backwardation and contango shapes. Our goal in this paper is twofold: (a) we introduce copula functions to have a better representation of the dependence structure of oil Futures with equity indexes; (b) using this copula representation, we are able to analyze in a precise manner the “maturity effect” in the choice of crude oil Future contract with respect to its diversification benefits. Our finding is that, in the case of distant maturities Futures, e.g., 18 months, the negative correlation effect is more pronounced whether stock prices increase or decrease. This property has the merit to avoid the hurdles of a frequent roll over while being quite desirable in the current trendless equity markets. Empirical evidence is exhibited on a database comprising the NYMEX WTI crude oil Futures and S&P 500 index over a 15 year-time period.

Hélyette Geman; Cécile Kharoubi

2008-01-01T23:59:59.000Z

38

Testing the weak-form efficiency of the WTI crude oil futures market  

Science Journals Connector (OSTI)

Abstract The weak-form efficiency of energy futures markets has long been studied and empirical evidence suggests controversial conclusions. In this work, nonparametric methods are adopted to estimate the Hurst indexes of the WTI crude oil futures prices (1983–2012) and a strict statistical test in the spirit of bootstrapping is put forward to verify the weak-form market efficiency hypothesis. The results show that the crude oil futures market is efficient when the whole period is considered. When the whole series is divided into three sub-series separated by the outbreaks of the Gulf War and the Iraq War, it is found that the Gulf War reduced the efficiency of the market. If the sample is split into two sub-series based on the signing date of the North American Free Trade Agreement, the market is found to be inefficient in the sub-periods during which the Gulf War broke out. The same analysis on short-time series in moving windows shows that the market is inefficient only when some turbulent events occur, such as the oil price crash in 1985, the Gulf war, and the oil price crash in 2008.

Zhi-Qiang Jiang; Wen-Jie Xie; Wei-Xing Zhou

2014-01-01T23:59:59.000Z

39

Causality and volatility spillovers among petroleum prices of WTI, gasoline and heating oil in different locations  

Science Journals Connector (OSTI)

This paper examines the time series properties of daily spot and futures prices for three petroleum types traded at five commodity centers within and outside the United States. Examining five combinations of the spot and futures prices by petroleum type and trading center, the cointegration tests of each of these five groups suggest that spot and futures contracts offer little room for long-run commodity portfolio diversification. In the West Texas Intermediate (WTI) crude-oil group, the VEC model indicates that the New York Mercantile Exchange (NYMEX) 1-month futures price has the upper hand in terms of directional causality and volatility spillovers. In the NYMEX gasoline system, there are bi-directional causality relationships among all the gasoline spot and futures prices, but the spot price produces the greatest spillover. In the NYMEX heating oil system, information transmission and predictability among the spot, 1- and 3-month futures are found to be particularly strong and significant. In the international gasoline spot market, contrary to the world crude-oil market, there is no apparent world gasoline spot leader for the gasoline spot prices.

Shawkat Hammoudeh; Huimin Li; Bang Jeon

2003-01-01T23:59:59.000Z

40

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions. Draft report  

SciTech Connect

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume III of the report describes the methods used to estimate both stack and fugitive emission rates from the facility.

NONE

1995-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Vertical axis wind turbine  

SciTech Connect

Wind turbines are largely divided into vertical axis wind turbines and propeller (Horizontal axis) wind turbines. The present invention discloses a vertical axis high speed wind turbine provided with a starting and braking control system. This vertical axis wind turbine is formed by having blades of a proper airfoil fitted to respective supporting arms provided radially from a vertical rotary axis by keeping the blade span-wise direction in parallel with the axis and being provided with a low speed control windmill in which the radial position of each operating piece varies with a centrifugal force produced by the rotation of the vertical rotary axis.

Kato, Y.; Seki, K.; Shimizu, Y.

1981-01-27T23:59:59.000Z

42

Is WTI crude oil market becoming weakly efficient over time?: New evidence from multiscale analysis based on detrended fluctuation analysis  

Science Journals Connector (OSTI)

This paper extends the work in Tabak and Cajueiro [Are the crude oil markets becoming weakly efficient over time, Energy Economics 29 (2007) 28–36] and Alvarez-Ramirez et al. [Short-term predictability of crude oil markets: a detrended fluctuation analysis approach, Energy Economics 30 (2008) 2645–2656]. In this paper, we test for the efficiency of WTI crude oil market through observing the dynamic of local Hurst exponents employing the method of rolling window based on multiscale detrended fluctuation analysis. Empirical results show that short-term, medium-term and long-term behaviors were generally turning into efficient behavior over time. However, in this way, the results also show that the market did not evolve along stable conditions for long times. Multiscale analysis is also implemented based on multifractal detrended fluctuation analysis. We found that the small fluctuations of WTI crude oil market were persistent; however, the large fluctuations had high instability, both in the short- and long-terms. Our discussion is also extended by incorporating arguments from the crude oil market structure for explaining the different correlation dynamics.

Yudong Wang; Li Liu

2010-01-01T23:59:59.000Z

43

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 1. Executive summary. Draft report  

SciTech Connect

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

44

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions. Draft report  

SciTech Connect

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume IV describes the air dispersion model used to estimate air concentrations and particle deposition, as well as the results of the modeling exercise.

NONE

1995-11-01T23:59:59.000Z

45

Vertical axis wind turbine  

SciTech Connect

Wind turbines are largely divided into vertical axis wind turbines and propeller (Horizontal axis) wind turbines. The present invention discloses a vertical axis high speed wind turbine provided with rotational speed control systems. This vertical axis wind turbine is formed by having blades of a proper airfoil fitted to respective supporting arms provided radially from a vertical rotating shaft by keeping the blade span-wise direction in parallel with the shaft and being provided with aerodynamic control elements operating manually or automatically to control the rotational speed of the turbine.

Kato, Y.; Seki, K.; Shimizu, Y.

1981-01-27T23:59:59.000Z

46

Report on the US EPA technical workshop on WTI incinerator risk assessment issues. Held in Washington, DC on January 11, 1996  

SciTech Connect

This report presents information and materials from a peer review workshop organized by EPA`s Risk Assessment Forum for Region 5 and the Office of Solid Waste and Emergency Response. The subject of the peer review was a draft document prepared by Region 5 assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. This report summarizes the discussions that took place at the peer review workshop. The report opens with an overview of the workshop and a history of EPA`s WTI incinerator risk assessment activities (section 1), then presents the chairperson`s summary (section 2) and the five work group chairs` summaries (section 3). The body of the report ends with highlights of the peer reviewers` preliminary comments and of the comments offered by workshop observers (section 4).

NONE

1996-05-01T23:59:59.000Z

47

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 6. Screening ecological risk assessment  

SciTech Connect

The Screening Ecological Risk Assessment (SERA) includes an evaluation of available biotic information from the site vicinity to provide a preliminary description of potential ecological receptors (e.g., rare, threatened and endangered species; migratory birds; and important game species), and important ecological habitats (e.g., wetland areas). A conceptual site model is developed that describe show stressors associated with the WTI facility might affect the ecological components in the surrounding environment through the development and evaluation of specific ecological endpoints. Finally, an estimate of the potential for current and/or future adverse impacts to the biotic component of the environment is provided, based on the integration of potential exposures of ecological receptors to WTI emissions and toxicological threshold values.

NONE

1997-05-01T23:59:59.000Z

48

Left Coast Electric Formerly Left Coast Conversions | Open Energy...  

Open Energy Info (EERE)

Left Coast Electric Formerly Left Coast Conversions Jump to: navigation, search Name: Left Coast Electric (Formerly Left Coast Conversions) Place: California Sector: Services...

49

Food habits of axis deer (Axis axis) on the Coastal Plain, Calhoun County, Texas  

E-Print Network (OSTI)

FOOD HABITS OF AXIS DEER (Axis axis) ON THE COASTAL PLAIN, CALHOUN COUNTY, TEXAS A Thesis by JOHN CLARENCE SMITH Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER... OF SCIENCE December 197l Major Subject: Wildlife Science FOOD HABITS OF AXIS DEER (Axi. s axis) ON THE COASTAL PLAIN, CALHOUN COUNTY, TEXAS A Thesis by JOHN CLARENCE SMITH Approved as to style and content by: (Chairman of Committee) ! (Head...

Smith, John Clarence

2012-06-07T23:59:59.000Z

50

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 7. Accident analysis: Selection and assessment of potential release scenarios. Draft report  

SciTech Connect

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Accident Analysis is an evaluation of the likelihood of occurrence and resulting consequences from several general classes of accidents that could potentially occur during operation of the facility. The Accident Analysis also evaluates the effectiveness of existing mitigation measures in reducing off-site impacts. Volume VII describes in detail the methods used to conduct the Accident Analysis and reports the results of evaluations of likelihood and consequence for the selected accident scenarios.

NONE

1995-11-01T23:59:59.000Z

51

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 6. Screening ecological risk assessment (SERA). Draft report  

SciTech Connect

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Screening Ecological Risk Assessment (SERA) is an analysis of the potential significance of risks to ecological receptors (e.g., plants, fish, wildlife) from exposure to facility emissions. The SERA was performed using conservative assumptions and approaches to determine if a further, more refined analysis is warranted. Volume VI describes in detail the methods used in the SERA and reports the results of the SERA in terms of site-specific risks to ecological receptors.

NONE

1995-11-01T23:59:59.000Z

52

Vertical axis wind turbines  

DOE Patents (OSTI)

A vertical axis wind turbine is described. The wind turbine can include a top ring, a middle ring and a lower ring, wherein a plurality of vertical airfoils are disposed between the rings. For example, three vertical airfoils can be attached between the upper ring and the middle ring. In addition, three more vertical airfoils can be attached between the lower ring and the middle ring. When wind contacts the vertically arranged airfoils the rings begin to spin. By connecting the rings to a center pole which spins an alternator, electricity can be generated from wind.

Krivcov, Vladimir (Miass, RU); Krivospitski, Vladimir (Miass, RU); Maksimov, Vasili (Miass, RU); Halstead, Richard (Rohnert Park, CA); Grahov, Jurij (Miass, RU)

2011-03-08T23:59:59.000Z

53

Characterization of Ti diffusion in PVD deposited WTi/AlCu metallization on monocrystalline Si by means of secondary ion mass spectroscopy  

Science Journals Connector (OSTI)

The diffusion behavior of Titanium in Al0.5Cu/W18Ti (at.%) metallization stacks on monocrystalline Silicon has been investigated. The metallization system was prepared by in situ sputtering deposition. It is demonstrated that \\{WTi\\} is not stable as a diffusion barrier between Al0.5Cu and Si in temperature ranges between 623 K and 673 K due to Ti depletion. The Ti diffusion in Al0.5Cu is characterized by diffusion profiles prepared by secondary ion mass spectroscopy after annealing. The activation energy derived from this data is 2.28 eV for Ti diffusion into Al0.5Cu. The causal chain of detecting this behavior is described application-oriented.

M. Plappert; O. Humbel; A. Koprowski; M. Nowottnick

2012-01-01T23:59:59.000Z

54

EIND510 Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering\\EIND510\\EIND510 Fall 2011\\EIND510 syllabus Fall 2011.docx 1  

E-Print Network (OSTI)

of usability engineering across a range of product, service and system domains. #12;EIND510 ­ Usability usability analyses on products or services as part of a team-based usability engineering projectEIND510 ­ Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering

Dyer, Bill

55

Vertical axis wind turbine acoustics  

E-Print Network (OSTI)

Vertical Axis Wind Turbine Acoustics Charlie Pearson Corpus Christi College Cambridge University Engineering Department A thesis submitted for the degree of Doctor of Philosophy September 2013 Declaration Described in this dissertation is work... quickly to changing wind conditions, small- scale vertical axis wind turbines (VAWTs) have been proposed as an efficient solution for deployment in built up areas, where the wind is more gusty in nature. If VAWTs are erected in built up areas...

Pearson, Charlie

2014-04-08T23:59:59.000Z

56

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 5. Human health risk assessment (HHRA): Evaluation of potential risks from multipathway exposure to emissions. Draft report  

SciTech Connect

The Human Health Risk Assessment (HHRA) portion of the WTI Risk Assessment involves the integration of information about the facility with site-specific data for the surrounding region and population to characterize the potential human health risks due to emissions from the facility. The estimation of human health risks is comprised of the following general steps: (1) identification of substances of potential concern; (2) estimation of the nature and magnitude of chemical releases from the WTI facility; (3) prediction of the atmospheric transport of the emitted contaminants; (4) determination of the types of adverse effects associated with exposure to the substances of potential concern (referred to as hazard identification), and the relationship between the level of exposure and the severity of any health effect (referred to as dose-response assessment); (5) estimation of the magnitude of exposure (referred to as exposure assessment); and (6) characterization of the health risks associated with exposure (referred to as risk characterization).

NONE

1995-11-01T23:59:59.000Z

57

The effect of the financial sector on the evolution of oil prices: Analysis of the contribution of the futures market to the price discovery process in the WTI spot market  

Science Journals Connector (OSTI)

The aim of this article is to empirically measure the contribution of the futures market to the price discovery process in the spot market for benchmark crude oils, specifically that for West Texas Intermediate (WTI). For this purpose, we test the hypothesis that the recent evolution of the financial markets has affected the future oil market so as to increase its contribution to the price discovery process of the spot market. We modeled the relation between WTI spot and future prices as a cointegration relation. By using the Kalman filter technique, it was possible to obtain a time-varying measure of the contribution of future markets to the price discovery mechanism. The results show that in the case of WTI, the contribution of the futures market has been increasing, especially between 2003 and 2008 and then again after the start of 2009, evidencing the growing importance of factors particular to the financial markets in determining oil prices in recent years. During 2009, the spot prices adjusted to agents' future expectations rather than to the current supply and demand conditions.

Renan Silvério; Alexandre Szklo

2012-01-01T23:59:59.000Z

58

Two-axis angular effector  

DOE Patents (OSTI)

A new class of coplanar two-axis angular effectors. These effectors combine a two-axis rotational joint analogous to a Cardan joint with linear actuators in a manner to produce a wider range of rotational motion about both axes defined by the joint. This new class of effectors also allows design of robotic manipulators having very high strength and efficiency. These effectors are particularly suited for remote operation in unknown surroundings, because of their extraordinary versatility. An immediate application is to the problems which arise in nuclear waste remediation.

Vaughn, Mark R. (Albuquerque, NM); Robinett, III, Rush D. (Tijeras, NM); Phelan, John R. (Albuquerque, NM); Van Zuiden, Don M. (Albuquerque, NM)

1997-01-21T23:59:59.000Z

59

THIS PAGE INTENTIONALLY LEFT BLANK  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

THIS PAGE INTENTIONALLY LEFT BLANK THIS PAGE INTENTIONALLY LEFT BLANK i U.S. DEPARTMENT OF ENERGY CRITICAL MATERIALS STRATEGY DECEMBER 2011 ii THIS PAGE INTENTIONALLY LEFT BLANK iii TABLE OF CONTENTS FOREWORD ........................................................................................................................................................... 1 ACKNOWLEDGEMENTS .......................................................................................................................................... 2 EXECUTIVE SUMMARY ........................................................................................................................................... 3 CHAPTER 1. INTRODUCTION .................................................................................................................................. 8

60

AXI LLC | Open Energy Information  

Open Energy Info (EERE)

Page Page Edit with form History Facebook icon Twitter icon » AXI LLC Jump to: navigation, search Name AXI LLC Place Quincy, Massachusetts Zip 02169 Sector Biofuels Product Aims to make commercially feasible strains of algae for fuel production Coordinates 42.2363996°, -71.0200613° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.2363996,"lon":-71.0200613,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Dual Axis Radiographic Hydrodynamic Test Facility | National...  

National Nuclear Security Administration (NNSA)

Dual Axis Radiographic Hydrodynamic Test Facility | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

62

Flexible helical-axis stellarator  

DOE Patents (OSTI)

An 1=1 helical winding which spirals about a conventional planar, circular central conductor of a helical-axis stellarator adds a significant degree of flexibility by making it possible to control the rotational transform profile and shear of the magnetic fields confining the plasma in a helical-axis stellarator. The toroidal central conductor links a plurality of toroidal field coils which are separately disposed to follow a helical path around the central conductor in phase with the helical path of the 1=1 winding. This coil configuration produces bean-shaped magnetic flux surfaces which rotate around the central circular conductor in the same manner as the toroidal field generating coils. The additional 1=1 winding provides flexible control of the magnetic field generated by the central conductor to prevent the formation of low-order resonances in the rotational transform profile which can produce break-up of the equilibrium magnetic surfaces. Further, this additional winding can deepen the magnetic well which together with the flexible control provides increased stability.

Harris, Jeffrey H. (Oak Ridge, TN); Hender, Timothy C. (Abingdon, GB2); Carreras, Benjamin A. (Oak Ridge, TN); Cantrell, Jack L. (Oak Ridge, TN); Morris, Robert N. (Oak Ridge, TN)

1988-01-01T23:59:59.000Z

63

Helical axis stellarator with noninterlocking planar coils  

DOE Patents (OSTI)

A helical axis stellarator using only noninterlocking planar, non-circular coils, generates magnetic fields having a magnetic well and large rotational transform with resultant large equilibrium beta.

Reiman, Allan (Princeton, NJ); Boozer, Allen H. (Rocky Hill, NJ)

1987-01-01T23:59:59.000Z

64

Dual Axis Radiographic Hydrodynamic Test Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

DARHT Facility: A critical component of stockpile stewardship DARHT Facility: A critical component of stockpile stewardship A new research frontier awaits! Our door is open and we thrive on mutually beneficial partnerships, collaborations that drive innovations and new technologies. April 12, 2012 Dominic Tafoya and Dave Honaberger prepare a refurbished DARHT (Dual Axis Radiographic Hydrotest Facility) 2nd axis accelerator cell for magnetic axis alignment measurements. Contact Group Leader Terry Priestley (505) 665-1330 Email Deputy Group Leader Tim Ferris (505) 665-2179 Email Hydrotests are critical in assessing nuclear weapons in nation's stockpile Dual Axis Radiographic Hydrodynamic Test facility 4:17 How DARHT Works The weapons programs at Los Alamos have one principal mission: ensure the safety, security, and effectiveness of nuclear weapons in our nation's

65

Vertical Axis Wind Turbine Foundation parameter study  

SciTech Connect

The dynamic failure criterion governing the dimensions of prototype Vertical Axis Wind Turbine Foundations is treated as a variable parameter. The resulting change in foundation dimensions and costs is examined.

Lodde, P.F.

1980-07-01T23:59:59.000Z

66

Automatic 5-axis NC toolpath generation  

E-Print Network (OSTI)

Despite over a decade of research, automatic toolpath generation has remained an elusive goal for 5-axis NC machining. This thesis describes the theoretical and practical issues associated with generating collision free ...

Balasubramaniam, Mahadevan, 1976-

2001-01-01T23:59:59.000Z

67

Sandia National Laboratories: Innovative Offshore Vertical-Axis...  

NLE Websites -- All DOE Office Websites (Extended Search)

WindInnovative Offshore Vertical-Axis Wind Turbine Rotors Innovative Offshore Vertical-Axis Wind Turbine Rotors This project seeks to advance large offshore vertical-axis wind...

68

T-613: Microsoft Excel Axis Properties Remote Code Execution...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Microsoft Excel Axis Properties Remote Code Execution Vulnerability T-613: Microsoft Excel Axis Properties Remote Code Execution Vulnerability May 2, 2011 - 7:42am Addthis...

69

Solasta aka The Eagle Axis | Open Energy Information  

Open Energy Info (EERE)

Eagle Axis Jump to: navigation, search Name: Solasta (aka The Eagle Axis) Place: Newton, Massachusetts Zip: 2458 Sector: Efficiency, Solar Product: Start-up planning to produce...

70

Axis Technologies Group Inc | Open Energy Information  

Open Energy Info (EERE)

Axis Technologies Group Inc Axis Technologies Group Inc Jump to: navigation, search Name Axis Technologies Group, Inc Place Lincoln, Nebraska Zip 68522 Product Designs, manufactures, and markets energy-saving and daylight harvesting electronic dimming ballasts for the commercial lighting industry. Coordinates 47.829403°, -118.419202° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":47.829403,"lon":-118.419202,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

71

Enclosed, off-axis solar concentrator  

DOE Patents (OSTI)

A solar concentrator including a housing having receiving wall, a reflecting wall and at least two end walls, the receiving, reflecting and end walls defining a three-dimensional volume having an inlet, wherein a vertical axis of the housing is generally perpendicular to the inlet, a receiver mounted on the receiving wall of the housing, the receiver including at least one photovoltaic cell, wherein a vertical axis of the receiver is disposed at a non-zero angle relative to the vertical axis of the housing, at least one clip disposed on the reflecting wall an optical element received within the three-dimensional volume, the optical element including at least one tab, the tab being engaged by the clip to align the optical element with the receiver, and a window received over the inlet to enclose the housing.

Benitez, Pablo; Grip, Robert E; Minano, Juan C; Narayanan, Authi A; Plesniak, Adam; Schwartz, Joel A

2013-11-26T23:59:59.000Z

72

Bicyclic semigroups of left I-quotients  

E-Print Network (OSTI)

In this article we study left I-orders in the bicyclic monoid $\\mathcal{B}$. We give necessary and sufficient conditions for a subsemigroup of $\\mathcal{B}$ to be a left I-oreder in $\\mathcal{B}$. We then prove that any left I-order in $\\mathcal{B}$ is straight.

Ghroda, Nassraddin

2011-01-01T23:59:59.000Z

73

A low order model for vertical axis wind turbines  

E-Print Network (OSTI)

A new computational model for initial sizing and performance prediction of vertical axis wind turbines

Drela, Mark

74

High payload six-axis load sensor  

DOE Patents (OSTI)

A repairable high-payload six-axis load sensor includes a table, a base, and at least three shear-pin load transducers removably mounted between the table and the base. Removable mounting permits easy replacement of damaged shear pins. Preferably, the shear-pin load transducers are responsive to shear forces imparted along the two axes perpendicular to an axis of minimum sensitivity characteristic of the transducer. Responsive to an applied shear force, each shear-pin load transducer can produce an electrical signal proportional to the reaction force. The load sensor can further include a structure for receiving the proportional electrical signals and computing the applied load corresponding to the proportional electrical signals. The computed load can be expressed in terms of a three-dimensional XYZ Cartesian coordinate system.

Jansen, John F. (Knoxville, TN); Lind, Randall F. (Knoxville, TN)

2003-01-01T23:59:59.000Z

75

Space variations in axis height of the jet stream core  

E-Print Network (OSTI)

height of the jet axis relative to the height of the jet maximum for slow vs. fast cases. 13 Mean height of the jet axis relative to the height at the trough. 13 Mean height of the jet axis relative to the height at the ridge. 15 Mean height... of the jet axis relative to the height at the jet maximum, when the maximum is near a trough. 15 Mean height of the jet axis relative to the height at the minimum, when the minimum is near a ridge. 17 Mean height of the jet axis relative to the height...

Leutwyler, Cooke Hearon

1965-01-01T23:59:59.000Z

76

Naturally Occurring Mutations in the WTI Gene  

Science Journals Connector (OSTI)

Dominant oncogenes, like myc or ras, confer a gain of func-tion to transformed cells.1,2 Gain-of-function mutations result in abnormal, positive signals for cell proliferation. In general, however, genetic altera...

Max J. Coppes M.D.; Ph.D.…

1995-01-01T23:59:59.000Z

77

Multi-axis Capability for Powered Ankle-Foot Prostheses  

Science Journals Connector (OSTI)

In this chapter, the concept of a multi-axis powered ankle-foot prosthesis is introduced. The feasibility of this ... proposed cable-driven mechanism for the multi-axis powered ankle-foot prosthesis is capable of...

Evandro M. Ficanha; Mohammad Rastgaar; Kenton R. Kaufman

2014-01-01T23:59:59.000Z

78

Vertical axis wind turbine with continuous blade angle adjustment  

E-Print Network (OSTI)

The author presents a concept for a vertical axis wind turbine that utilizes each blade's entire rotational cycle for power generation. Each blade has its own vertical axis of rotation and is constrained to rotate at the ...

Weiss, Samuel Bruce

2010-01-01T23:59:59.000Z

79

Two-axis tracking solar collector mechanism  

DOE Patents (OSTI)

This invention is a novel solar tracking mechanism incorporating a number of practical features that give it superior environmental resilience and exceptional tracking accuracy. The mechanism comprises a lightweight space-frame assembly supporting an array of point-focus Fresnel lenses in a two-axis tracking structure. The system is enclosed under a glass cover which isolates it from environmental exposure and enhances tracking accuracy by eliminating wind loading. Tracking accuracy is also enhanced by the system's broad-based tracking support. The system's primary intended application would be to focus highly concentrated sunlight into optical fibers for transmission to core building illumination zones, and the system may also have potential for photovoltaic or photothermal solar energy conversion.

Johnson, Kenneth C. (201 W. California Ave. #705, Sunnyvale, CA 94086)

1992-01-01T23:59:59.000Z

80

Vertical axis wind turbine control strategy  

SciTech Connect

Early expensive in automatic operation of the Sandia 17-m vertical axis research wind turbine (VAWT) has demonstrated the need for a systematic study of control algorithms. To this end, a computer model has been developed that uses actual wind time series and turbine performance data to calculate the power produced by the Sandia 17-m VAWT operating in automatic control. The model has been used to investigate the influence of starting algorithms on annual energy production. The results indicate that, depending on turbine and local wind characteristics, a bad choice of a control algorithm can significantly reduce overall energy production. The model can be used to select control algorithms and threshold parameters that maximize long-term energy production. An attempt has been made to generalize these results from local site and turbine characteristics to obtain general guidelines for control algorithm design.

McNerney, G.M.

1981-08-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Two-axis tracking solar collector mechanism  

DOE Patents (OSTI)

This invention is a novel solar tracking mechanism incorporating a number of practical features that give it superior environmental resilience and exceptional tracking accuracy. The mechanism comprises a lightweight space-frame assembly supporting an array of point-focus Fresnel lenses in a two-axis tracking structure. The system is enclosed under a glass cover which isolates it from environmental exposure and enhances tracking accuracy by eliminating wind loading. Tracking accuracy is also enhanced by the system's broad-based tracking support. The system's primary intended application would be to focus highly concentrated sunlight into optical fibers for transmission to core building illumination zones, and the system may also have potential for photovoltaic or photothermal solar energy conversion. 16 figs.

Johnson, K.C.

1992-12-08T23:59:59.000Z

82

Two-axis tracking solar collector mechanism  

DOE Patents (OSTI)

This invention is a novel solar tracking mechanism incorporating a number of practical features that give it superior environmental resilience and exceptional tracking accuracy. The mechanism comprises a lightweight space-frame assembly supporting an array of point-focus Fresnel lenses in a two-axis tracking structure. The system is enclosed under a glass cover which isolates it from environmental exposure and enhances tracking accuracy by eliminating wind loading. Tracking accuracy is also enhanced by the system's broad-based tracking support. The system's primary intended application would be to focus highly concentrated sunlight into optical fibers for transmission to core building illumination zones, and the system may also have potential for photovoltaic or photothermal solar energy conversion.

Johnson, Kenneth C. (201 W. California Ave., #401, Sunnyvale, CA 94086)

1990-01-01T23:59:59.000Z

83

A comparison of on-axis and off-axis heliostat alignment strategies  

SciTech Connect

Heliostat installation and alignment costs will be an important element in future solar power tower projects. The predicted annual performances of on- and-off axis strategies are compared for 95 m{sup 2} flat-glass heliostats and an external, molten-salt receiver. Actual approaches to heliostat alignment that have been used in the past are briefly discussed, and relative strengths and limitations are noted. The optimal approach can vary with the application.

Jones, S.A.

1996-03-01T23:59:59.000Z

84

E-Print Network 3.0 - axis factoring method Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Once this is done, we can call the setup method to properly initialize the axis... On: color values start end moveBy scaleFactor minValue maxValue AbstractAxis AxisAxisDecorator...

85

Left alone, palladium atoms get the job done | EMSL  

NLE Websites -- All DOE Office Websites (Extended Search)

Left alone, palladium atoms get the job done Left alone, palladium atoms get the job done Isolated atoms tackle carbon monoxide, potentially reducing engine emissions A vehicle's...

86

Phenomenology of the left-right twin Higgs model  

E-Print Network (OSTI)

Phenomenology of the Left-Right Twin Higgs Model* Hock-SengUniversity of California. Phenomenology of the Left-Rightwith rich collider phenomenology. In addition, there are

Goh, Hock-Seng

2008-01-01T23:59:59.000Z

87

Left-Wing Extremism: The Current Threat  

SciTech Connect

Left-wing extremism is ''alive and well'' both in the US and internationally. Although the current domestic terrorist threat within the U. S. is focused on right-wing extremists, left-wing extremists are also active and have several objectives. Leftist extremists also pose an espionage threat to U.S. interests. While the threat to the U.S. government from leftist extremists has decreased in the past decade, it has not disappeared. There are individuals and organizations within the U.S. who maintain the same ideology that resulted in the growth of left-wing terrorism in this country in the 1970s and 1980s. Some of the leaders from that era are still communicating from Cuba with their followers in the U.S., and new leaders and groups are emerging.

Karl A. Seger

2001-04-30T23:59:59.000Z

88

Constraining the Doublet Left-Right Model  

E-Print Network (OSTI)

Left-Right Models (LRM) attempt at giving an understanding of the violation of parity (or charge-conjugation) by the weak interactions in the SM through a similar description of left- and right-handed currents at high energies. The spontaneous symmetry breaking of the LRM gauge group is triggered by an enlarged Higgs sector, usually consisting of two triplet fields (left-right symmetry breaking) and a bidoublet (electroweak symmetry breaking). I reconsider an alternative LRM with doublet instead of triplet fields. After explaining some features of this model, I discuss constraints on its parameters using electroweak precision observables (combined using the CKMfitter frequentist statistical framework) and neutral-meson mixing observables.

Silva, Luiz Vale

2015-01-01T23:59:59.000Z

89

Event Rates for Off Axis NuMI Experiments  

E-Print Network (OSTI)

Neutrino interaction rates for experiments placed off axis in the NuMI beam are calculated. Primary proton beam energy is 120 GeV and four locations at 810 km from target and 6, 12, 30 and 40 km off axis are considered. This report is part of the Joint FNAL/BNL Future Long Baseline Neutrino Oscillation Experiment Study.

B. Viren

2006-08-25T23:59:59.000Z

90

3-Axis Magnetic Sensor Hybrid The Honeywell HMC2003 is a high sensitivity, three-axis magnetic sensor hybrid  

E-Print Network (OSTI)

3-Axis Magnetic Sensor Hybrid HMC2003 The Honeywell HMC2003 is a high sensitivity, three-axis magnetic sensor hybrid assembly used to measure low magnetic field strengths. Honeywell's most sensitive product excellence and performance by introducing innovative solid-state magnetic sensor solutions

Kleinfeld, David

91

Recreation Strategic Plan Page left intentionally blank  

E-Print Network (OSTI)

Recreation Strategic Plan April 2011 #12;Page left intentionally blank #12;CECW-CO DEPARTMENT AND DISTRICTS SUBJECT: U.S. Army Corps ofEngineers National Recreation Program Strategic Plan 1. The enclosed USACE National Recreation Program Strategic Plan provides long-term guidance for our recreation program

US Army Corps of Engineers

92

Left-right symmetry at LHC  

Science Journals Connector (OSTI)

We revisit the issue of the limit on the scale of left-right symmetry breaking. We focus on the minimal SU(2)L×SU(2)R×U(1)B-L gauge theory with the seesaw mechanism and discuss the two possibilities of defining left-right symmetry as parity or charge conjugation. In the commonly adopted case of parity, we perform a complete numerical study of the quark mass matrices and the associated left and right mixing matrices without any assumptions usually made in the literature about the ratio of vacuum expectation values. We find that the usual lower limit on the mass of the right-handed gauge boson from the K mass difference, MWR>2.5??TeV, is subject to a possible small reduction due to the difference between right and left Cabibbo angles. In the case of charge conjugation the limit on MWR is somewhat more robust. However, the more severe bounds from CP-violating observables are absent in this case. In fact, the free phases can also resolve the present mild discrepancy between the standard model and CP violation in the B sector. Thus, even in the minimal case, both charged and neutral gauge bosons may be accessible at the Large Hadron Collider with spectacular signatures of lepton number violation.

Alessio Maiezza; Miha Nemevšek; Fabrizio Nesti; Goran Senjanovi?

2010-09-24T23:59:59.000Z

93

DARHT: Dual-Axis Radiographic Hydrodynamic Test Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

DARHT: Dual-Axis Radiographic Hydrodynamic Test Facility DARHT: Dual-Axis Radiographic Hydrodynamic Test Facility DARHT: Dual-Axis Radiographic Hydrodynamic Test Facility DARHT, supports a critical component of LANL's primary mission: to ensure the safety, security, and effectiveness of nuclear weapons in our nation's stockpile. Los Alamos scientists built DARHT, the world's most powerful x-ray machine, to analyze mockups of nuclear weapons. At the Los Alamos National Laboratory (LANL), the Dual-Axis Radiographic Hydrodynamic Test Facility, or DARHT, supports a critical component of LANL's primary mission: to ensure the safety, security, and effectiveness of nuclear weapons in our nation's stockpile. Los Alamos scientists built DARHT, the world's most powerful x-ray machine, to analyze mockups of nuclear weapons.

94

MHK Technologies/Vertical Axis Venturi System | Open Energy Information  

Open Energy Info (EERE)

Axis Venturi System Axis Venturi System < MHK Technologies Jump to: navigation, search << Return to the MHK database homepage 275px Technology Profile Primary Organization Warrior Girl Corporation Technology Resource Click here Current Technology Type Click here Axial Flow Turbine Technology Readiness Level Click here TRL 1 3 Discovery Concept Def Early Stage Dev Design Engineering Technology Description The proprietary venturi system uses two venturies one on the upstream side of the vertical axis turbine to force the water flow into the turbine and one at the downstream side of the turbine which creates a lower pressure region that pulls the water through the turbine The vertical axis orientation of the turbine is believed by the company to allow for efficiency gains

95

Curvature gouge detection and prevention in 5-axis CNC machining.  

E-Print Network (OSTI)

??Five-axis CNC machining presents high efficiency and unparallel flexibility in the machining of complex curved surfaces. However, generation of gouge-free CNC tool path and cutter… (more)

Wang, Yin Jack

2010-01-01T23:59:59.000Z

96

A hybrid type small 5-axis CNC milling machine  

E-Print Network (OSTI)

5-axis CNC milling machines are important in a number of industries ranging from aerospace to consumer-die-mold machining because they can deliver high machining accuracy with a spindle tilting capacity. Most of these ...

Son, Seung-Kil, 1964-

2002-01-01T23:59:59.000Z

97

Center of pressure calculations for a bent-axis vehicle  

SciTech Connect

Bent-axis maneuvering vehicles provide a unique type of control for a variety of supersonic and hypersonic missions. Unfortunately, large hinge moments, incomplete pitching moment predictions, and a misunderstanding of corresponding center of pressure calculations have prevented their application. A procedure is presented for the efficient design of bent-axis vehicles given an adequate understanding of origins of pitching moment effects. In particular,sources of pitching moment contributions will be described including not only normal force, but inviscid axial force and viscous effects as well. Off-centerline center of pressure effects are first reviewed for symmetric hypersonic sphere-cone configurations. Next the effects of the bent-axis geometry are considered where axial force, acting on the deflected tail section, can generate significant pitching moment components. The unique relationship between hinge moments and pitching moments for the bent-axis class of vehicles is discussed. 15 refs.

Rutledge, W.H.; Polansky, G.F.

1992-01-01T23:59:59.000Z

98

EIS-0228: Dual Axis Radiographic Hydrodynamic Test (DARHT) Facility  

Energy.gov (U.S. Department of Energy (DOE))

This EIS evaluates the potential environmental impact of a proposal to construct and operate the Dual Axis Radiographic Hydrodynamic Test (DARHT) facility at Los Alamos National Laboratory (LANL)...

99

Impacts of Raindrop Fall Velocity and Axis Ratio Errors on Dual-Polarization Radar Rainfall Estimation  

Science Journals Connector (OSTI)

Motivated by the field observations of fall velocity and axis ratio deviations from predicted terminal velocity and equilibrium axis ratio values, the combined effects of raindrop fall velocity and axis ratio deviations on dual-polarization radar ...

Bin Pei; Firat Y. Testik; Mekonnen Gebremichael

2014-10-01T23:59:59.000Z

100

Asymmetric parametric amplification in nonlinear left-handed transmission lines  

E-Print Network (OSTI)

Asymmetric parametric amplification in nonlinear left-handed transmission lines David A. Powell amplification in nonlinear left-handed transmission lines, which serve as model systems for nonlinear negative-handed regime. © 2009 American Institute of Physics. DOI: 10.1063/1.3089842 Left-handed transmission lines

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Z-Axis Tipper Electromagnetics | Open Energy Information  

Open Energy Info (EERE)

Z-Axis Tipper Electromagnetics Z-Axis Tipper Electromagnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Z-Axis Tipper Electromagnetics Details Activities (2) Areas (2) Regions (0) NEPA(1) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Electrical Techniques Parent Exploration Technique: Magnetotelluric Techniques Information Provided by Technique Lithology: Stratigraphic/Structural: Hydrological: Thermal: Cost Information Low-End Estimate (USD): 4,827.00482,700 centUSD 4.827 kUSD 0.00483 MUSD 4.827e-6 TUSD / mile Median Estimate (USD): 6,206.14620,614 centUSD 6.206 kUSD 0.00621 MUSD 6.20614e-6 TUSD / mile High-End Estimate (USD): 17,239.291,723,929 centUSD 17.239 kUSD 0.0172 MUSD 1.723929e-5 TUSD / mile Dictionary.png

102

T-613: Microsoft Excel Axis Properties Remote Code Execution Vulnerability  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

613: Microsoft Excel Axis Properties Remote Code Execution 613: Microsoft Excel Axis Properties Remote Code Execution Vulnerability T-613: Microsoft Excel Axis Properties Remote Code Execution Vulnerability May 2, 2011 - 7:42am Addthis PROBLEM: Microsoft Excel is prone to a remote code-execution vulnerability because the applications fail to sufficiently validate user-supplied input. PLATFORM: Microsoft Excel (2002-2010) ABSTRACT: Microsoft Excel is prone to a remote code-execution vulnerability because the applications fails to sufficiently validate user-supplied input. Attackers can exploit this issue by enticing an unsuspecting user to open a specially crafted Excel file. Successful exploits can allow attackers to execute arbitrary code with the privileges of the user running the application. Failed exploit attempts will result in a denial-of-service

103

MHK Technologies/Horizontal Axis Logarithmic Spiral Turbine | Open Energy  

Open Energy Info (EERE)

Horizontal Axis Logarithmic Spiral Turbine Horizontal Axis Logarithmic Spiral Turbine < MHK Technologies Jump to: navigation, search << Return to the MHK database homepage Technology Profile Primary Organization Golden Turbines LLC Technology Resource Click here Current Technology Type Click here Axial Flow Turbine Technology Readiness Level Click here TRL 1 3 Discovery Concept Def Early Stage Dev Design Engineering Technology Description A Horizontal axis Water turbine following the logarithmic spiral to generate clean electric energy from slow moving currents like rivers or ocean currents and with least impact on marine life and the environment because it doesn t require a damn or building huge structures Technology Dimensions Device Testing Date Submitted 36:09.5 << Return to the MHK database homepage

104

Four-axis micro measuring systems performance verification  

Science Journals Connector (OSTI)

Abstract This article describes the performance verification of 3D optical measuring instruments integrating a rotational axis using an artifact. The goal is the performance verification of four-axis measuring systems for the full 3D acquisition of micro-geometric parts. This type of measurement has many potential applications, such as in micro-tool, micro-mold, or micro-device manufacturing. The artifact is as simple as possible to reduce manufacturing costs, ensure easy calibration, comply with the ISO 10360 standard and consider all volumetric error contributions. The artifact may be useful to both measuring system manufacturers and users to provide a measurement traceability path.

Giovanni Moroni; Stefano Petrò; Wahyudin P. Syam

2014-01-01T23:59:59.000Z

105

A Simplified Morphing Blade for Horizontal Axis Wind Turbines  

E-Print Network (OSTI)

A Simplified Morphing Blade for Horizontal Axis Wind Turbines Weijun WANG , St´ephane CARO, Fouad salinas@hotmail.com The aim of designing wind turbine blades is to improve the power capture ability by adjusting the twist of the blade's root and tip. To evaluate the performance of wind turbine blades

Recanati, Catherine

106

E-Print Network 3.0 - axis wind turbines Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

turbines Search Powered by Explorit Topic List Advanced Search Sample search results for: axis wind turbines...

107

E-Print Network 3.0 - axis wind turbine Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

turbine Search Powered by Explorit Topic List Advanced Search Sample search results for: axis wind turbine...

108

Serotonin, tryptophan metabolism and the brain-gut-microbiome axis  

Science Journals Connector (OSTI)

Abstract The brain-gut axis is a bidirectional communication system between the central nervous system and the gastrointestinal tract. Serotonin functions as a key neurotransmitter at both terminals of this network. Accumulating evidence points to a critical role for the gut microbiome in regulating normal functioning of this axis. In particular, it is becoming clear that the microbial influence on tryptophan metabolism and the serotonergic system may be an important node in such regulation. There is also substantial overlap between behaviours influenced by the gut microbiota and those which rely on intact serotonergic neurotransmission. The developing serotonergic system may be vulnerable to differential microbial colonisation patterns prior to the emergence of a stable adult-like gut microbiota. At the other extreme of life, the decreased diversity and stability of the gut microbiota may dictate serotonin-related health problems in the elderly. The mechanisms underpinning this crosstalk require further elaboration but may be related to the ability of the gut microbiota to control host tryptophan metabolism along the kynurenine pathway, thereby simultaneously reducing the fraction available for serotonin synthesis and increasing the production of neuroactive metabolites. The enzymes of this pathway are immune and stress-responsive, both systems which buttress the brain-gut axis. In addition, there are neural processes in the gastrointestinal tract which can be influenced by local alterations in serotonin concentrations with subsequent relay of signals along the scaffolding of the brain-gut axis to influence CNS neurotransmission. Therapeutic targeting of the gut microbiota might be a viable treatment strategy for serotonin-related brain-gut axis disorders.

S.M. O’Mahony; G. Clarke; Y.E. Borre; T.G. Dinan; J.F. Cryan

2015-01-01T23:59:59.000Z

109

Elastodynamic and elastostatic Green tensors for homogeneous weak transversely isotropic media  

Science Journals Connector (OSTI)

......TRANSVERSE ISOTROPY ( W T I ) 3.1 Definitionof WTI We shall consider a weak transversely isotropic medium (hereafter called the WTI medium) with a vertical axis of rotation...I , am"denotes the parameters of the WTI medium, and Aa,,, Au,, and are small......

Václav Vavry?uk

1997-09-01T23:59:59.000Z

110

Vertical-axis wind turbines -- The current status of an old technology  

SciTech Connect

Vertical-axis wind turbine technology is not well understood, even though the earliest wind machines rotated about a vertical axis. The operating environment of a vertical-axis wind turbine is quite complex, but detailed analysis capabilities have been developed and verified over the last 30 years. Although vertical-axis technology has not been widely commercialized, it exhibits both advantages and disadvantages compared to horizontal-axis technology, and in some applications, it appears to offer significant advantages.

Berg, D.E.

1996-12-31T23:59:59.000Z

111

E-Print Network 3.0 - assess left ventricular Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

valvular function... assess pulmonary and systemic circulatory systems 12;Left Heart Catheterisation Aorta Aorta Left... diastolic pressure 70 ... Source: Kay,...

112

Bicycles and Left-Right Tours in Locally Finite Graphs  

E-Print Network (OSTI)

Bicycles and Left-Right Tours in Locally Finite Graphs von Melanie Win Myint, M. S. Dem Department-Right Tours 29 6 LRTs Generate the Bicycle Space 43 7 The ABL Planarity Criterion 53 8 Pedestrian Graphs 69 bicycles and some other concepts they relate to, such as left- right tours and pedestrian graphs

Diestel, Reinhard

113

Design of a novel six-axis metrology system for meso-scale nanopositioners  

E-Print Network (OSTI)

The purpose of this research is to develop the best possible means and methods of building a six axis metrology system given cost and space constraints. Six axis measurements are a crucial part of precision engineering and ...

King, Ryan N. (Ryan Nicholas)

2009-01-01T23:59:59.000Z

114

E-Print Network 3.0 - atlas und axis Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

axis Search Powered by Explorit Topic List Advanced Search Sample search results for: atlas und axis Page: << < 1 2 3 4 5 > >> 1 Mitteilung fr die Medien Mitteilung fr die Medien...

115

A Multi-Axis Seam Tracking sensor for joining applications  

SciTech Connect

This paper describes the development and use of the Multi-Axis Seam Tracking (MAST) sensor for tracking seams or other features in real-time. Four independent, spatially-distributed electric fields are used to sense changes in the relative position of the sensor and the workpiece. The MAST sensor is very inexpensive compared with commercially available seam tracking sensors. It can be used in systems to perform cost-effective small-lot manufacturing operations in a faster, more consistent manner. The MAST sensor is used in an automated system for dispensing braze paste during a rocket nozzle fabrication process.

Novak, J.L.; Schmitt, D.J. [Sandia National Labs., Albuquerque, NM (United States); Maslakowski, J. [Rockwell International Corp., Canoga Park, CA (United States). Rocketdyne Div.

1993-11-01T23:59:59.000Z

116

Multi-Axis Seam Tracking using a noncontact capacitive sensor  

SciTech Connect

This paper describes the development and use of the Multi-Axis Seam racking (MAST) sensor for tracking seams or other features in real-time. Four independent, spatially-distributed electric fields are used to sense changes in the relative position of the sensor and the workpiece. The MAST sensor is very inexpensive compared with commercially available seam tracking sensors. It can be used in systems to perform cost-effective small-lot manufacturing operations in a faster, more consistent manner. The MAST sensor is used in an automated system for dispensing braze paste during a rocket nozzle fabrication process.

Novak, J.L.; Schmitt, D.J. [Sandia National Labs., Albuquerque, NM (United States); Maslakowski, J. [Rockwell International Corp., Canoga Park, CA (United States). Rocketdyne Div.

1993-08-01T23:59:59.000Z

117

Torque ripple in a Darrieus, vertical axis wind turbine  

SciTech Connect

Interaction between a steady wind and a rotating, Darrieus, vertical axis wind turbine produces time periodic aerodynamic loads which cause time dependent torque variations, referred to as torque ripple, to occur in the mechanical link between the turbine and the electrical generator. There is concern for the effect of torque ripple upon fatigue life of drive train components and upon power quality. An analytical solution characterizing the phenomenon of torque ripple has been obtained which is based upon a Fourier expansion of the time dependent features of the problem. Numerical results for torque ripple, some experimental data, determination of acceptable levels and methods of controlling it, are presented and discussed.

Reuter, R.C. Jr.

1980-09-01T23:59:59.000Z

118

Effect of Dynamic Stall on the Aerodynamics of Vertical-Axis Wind Turbines  

E-Print Network (OSTI)

Effect of Dynamic Stall on the Aerodynamics of Vertical-Axis Wind Turbines Frank Scheurich of the aerodynamic performance of vertical-axis wind turbines pose a significant challenge for computational fluid of the aerodynamics of a vertical- axis wind turbine that consists of three curved rotor blades that are twisted

McCalley, James D.

119

Experimental investigation of the performance of a diffuser-augmented vertical axis wind turbine  

E-Print Network (OSTI)

Experimental investigation of the performance of a diffuser- augmented vertical axis wind turbine Experimental investigation of the performance of a diffuser-augmented vertical axis wind turbine by Arash The performance of a vertical axis wind turbine with and without a diffuser was studied using direct force

Victoria, University of

120

Coriolis Effect on Dynamic Stall in a Vertical Axis Wind Turbine at Moderate Reynolds Number  

E-Print Network (OSTI)

axis wind turbines (VAWT) offer several advantages over horizontal axis wind turbines (HAWT), namely to yaw wind direction (because they are omnidirectional), and their increased power output in skewed flowCoriolis Effect on Dynamic Stall in a Vertical Axis Wind Turbine at Moderate Reynolds Number Hsieh

Colonius, Tim

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

RF generation in the DARHT Axis-II beam dump  

SciTech Connect

We have occasionally observed radio-frequency (RF) electromagnetic signals in the downstream transport (DST) of the second axis linear induction accelerator (LIA) at the dual-axis radiographic hydrodynamic testing (DARHT) facility. We have identified and eliminated some of the sources by eliminating the offending cavities. However, we still observe strong RF in the range 1 GHz t0 2 GHz occurring late in the {approx}2-{micro}s pulse that can be excited or prevented by varying the downstream tune. The narrow frequency width (<0.5%) and near exponential growth at the dominant frequency is indicative of a beam-cavity interaction, and electro-magnetic simulations of cavity structure show a spectrum rich in resonances in the observed frequency range. However, the source of beam produced RF in the cavity resonance frequency range has not been identified, and it has been the subject of much speculation, ranging from beam-plasma or beam-ion instabilities to unstable cavity coupling.

Ekdahl, Carl A. Jr. [Los Alamos National Laboratory

2012-05-03T23:59:59.000Z

122

Mutational Analysis of the Wilms' Tumor (WTI) Gene  

Science Journals Connector (OSTI)

Mutations of the Wilms’ tumor (WT1) gene have been shown to underlie a proportion of cases of Wilms’ tumor, an embryonal kidney cancer occurring mainly in childhood. The WTl gene comprtses ten exons spanning a...

Linda King-Underwood; Kathy Pritchard-Jones

1996-01-01T23:59:59.000Z

123

Implications of changing correlations between WTI and other commoditie...  

Gasoline and Diesel Fuel Update (EIA)

if the level of correlation is different from quarter to quarter. A two tailed test of the difference between two correlations drawn from a sample is used to check if the...

124

Template:DivStartLeft | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Template Edit History Facebook icon Twitter icon » Template:DivStartLeft Jump to: navigation, search This is the 'DivStartLeft' template. It is used in conjuction with Template:DivEnd to put surround the "free text" area in the geothermal region template. Usage It should be called in the following format: {{DivStartLeft}} Retrieved from "http://en.openei.org/w/index.php?title=Template:DivStartLeft&oldid=403880" Categories: Templates Formatting Templates What links here Related changes Special pages Printable version Permanent link Browse properties 429 Throttled (bot load) Error 429 Throttled (bot load)

125

Measurement and device design of left-handed metamaterials  

E-Print Network (OSTI)

The properties of a variety of left-handed metamaterial (LHM) structures are analyzed and measured to verify consistent behavior between theory an measurements. The structures are simulated using a commercial software ...

Thomas Zachary M. (Zachary Michael)

2005-01-01T23:59:59.000Z

126

Novel electromagnetic radiation in Left-Handed materials  

E-Print Network (OSTI)

In this thesis, Cerenkov radiation of a moving charged particle inside a Left-Handed material (LHM) is studied through both theory and numerical simulations. A LHM is a material whose permittivity and permeability have ...

Lu, Jie, Ph. D. Massachusetts Institute of Technology

2006-01-01T23:59:59.000Z

127

Left ventricular function in athletes: analysis of relaxation  

Science Journals Connector (OSTI)

Hypertrophy of the left ventricle (LV) is induced by overload and modulated by neurohumoral factors. Different types of overload will induce different adaptational mechanisms at the structural and at the bioch...

T. Gillebert; F. Rademakers; D. Brutsaert

1986-01-01T23:59:59.000Z

128

Left-Ventricular Shape Determines Intramyocardial Stroke Work Distribution  

Science Journals Connector (OSTI)

The left-ventricle often undergoes large shape changes in the remodelling process, which is now considered to be an important indication of disease progression. Therefore, the influence on intramyocardial work...

Hon Fai Choi; Frank E. Rademakers…

2011-01-01T23:59:59.000Z

129

Left-ventricular shape determines intramyocardial stroke work distribution  

Science Journals Connector (OSTI)

The left-ventricle often undergoes large shape changes in the remodelling process, which is now considered to be an important indication of disease progression. Therefore, the influence on intramyocardial work load distribution was examined in a finite-element ...

Hon Fai Choi; Frank E. Rademakers; Piet Claus

2011-05-01T23:59:59.000Z

130

Dual axis translation apparatus and system for translating an optical beam and related method  

DOE Patents (OSTI)

A dual axis translation device and system in accordance with this invention, for translating an optical beam along both an x-axis and a y-axis which are perpendicular to one another, has a beam directing means acting on said optical beam for directing the beam along a particular path transverse to said x and y axes. An arrangement supporting said beam directing means for movement in the x and y direction within a given plane is provided. The arrangement includes a first means for translating said beam directing means along the x-axis in said given plane in order to translate the beam along said x-axis. The arrangement comprises a second means for translating said beam directing means along the y-axis in said given plane in order to translate the beam along said y-axis.

Cassidy, Kelly (Manteca, CA)

1991-01-01T23:59:59.000Z

131

Dynamic behavior analysis for a six axis industrial machining robot  

E-Print Network (OSTI)

The six axis robots are widely used in automotive industry for their good repeatability (as defined in the ISO92983) (painting, welding, mastic deposition, handling etc.). In the aerospace industry, robot starts to be used for complex applications such as drilling, riveting, fiber placement, NDT, etc. Given the positioning performance of serial robots, precision applications require usually external measurement device with complexes calibration procedure in order to reach the precision needed. New applications in the machining field of composite material (aerospace, naval, or wind turbine for example) intend to use off line programming of serial robot without the use of calibration or external measurement device. For those applications, the position, orientation and path trajectory precision of the tool center point of the robot are needed to generate the machining operation. This article presents the different conditions that currently limit the development of robots in robotic machining applications. We ana...

Bisu, Claudiu-Florinel; Gérard, Alain; K'Nevez, Jean-Yves

2012-01-01T23:59:59.000Z

132

Dynamic stall occurrence on a horizontal axis wind turbine blade  

SciTech Connect

Surface pressure data from the National Renewable Energy Laboratory`s ``Combined Experiment`` were analyzed to provide a statistical representation of dynamic stall occurrence on a downwind horizontal axis wind turbine (HAWT). Over twenty thousand blade rotational cycles were each characterized at four span locations by the maximum leading edge suction pressure and by the azimuth, velocity, and yaw at which it occurred. Peak suction values at least twice that seen in static wind tunnel tests were taken to be indicative of dynamic stall. The occurrence of dynamic stall at all but the inboard station (30% span) shows good quantitative agreement with the theoretical limits on inflow velocity and yaw that should yield dynamic stall. Two hypotheses were developed to explain the discrepancy at 30% span. Estimates are also given for the frequency of dynamic stall occurrence on upwind turbines. Operational regimes were identified which minimize the occurrence of dynamic stall events.

Shipley, D.E.; Miller, M.S.; Robinson, M.C. [Colorado Univ., Boulder, CO (United States). Dept. of Aerospace Engineering Sciences

1995-07-01T23:59:59.000Z

133

Dual-axis resonance testing of wind turbine blades  

DOE Patents (OSTI)

An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.

Hughes, Scott; Musial, Walter; White, Darris

2014-01-07T23:59:59.000Z

134

IR Spectrometer Using 90-degree Off-axis Parabolic Mirrors  

SciTech Connect

A gated spectrometer has been designed for real-time, pulsed infrared (IR) studies at the National Synchrotron Light ource at the Brookhaven National Laboratory. A pair of 90-degree, off-axis parabolic mirrors are used to relay the light from an entrance slit to an output IR recording camera. With an initial wavelength range of 1500–4500 nm required, gratings could not be used in the spectrometer because grating orders would overlap. A magnesium oxide prism, placed between these parabolic mirrors, serves as the dispersion element. The spectrometer is doubly telecentric. With proper choice of the air spacing between the prism and the second parabolic mirror, any spectral region of interest within the InSb camera array’s sensitivity region can be recorded. The wavelengths leaving the second parabolic mirror are collimated, thereby relaxing the camera positioning tolerance. To set up the instrument, two different wavelength (visible) lasers are introduced at the entrance slit and made collinear with the optical axis via flip mirrors. After dispersion by the prism, these two laser beams are directed to tick marks located on the outside housing of the gated IR camera. This provides first-order wavelength calibration for the instrument. Light that is reflected off the front prism face is coupled into a high-speed detector to verify steady radiance during the gated spectral imaging. Alignment features include tick marks on the prism and parabolic mirrors. This instrument was designed to complement singlepoint pyrometry, which provides continuous time histories of a small collection of spots from shock-heated targets.

Robert M. Malone, Richard, G. Hacking, Ian J. McKenna, and Daniel H. Dolan

2008-09-02T23:59:59.000Z

135

Automated Classification of Disease Patterns from Echo-cardiography Images Based on Shape Features of the Left Ventricle  

SciTech Connect

Computer assisted diagnosis using analysis of medical images is an area of active research in health informatics. This paper proposes a technique for indication of heart diseases by using information related to shapes of the left ventricle (LV). LV boundaries are tracked from echo-cardiography images taken from LV short axis view, corresponding to two disease conditions viz. dilated cardiomyopathy and hypertrophic cardiomyopathy, and discriminated from the normal condition. The LV shapes are modeled using shape histograms generated by plotting the frequency of normalized radii lengths drawn from the centroid to the periphery, against a specific number of bins. A 3-layer neural network activated by a log-sigmoid function is used to classify the shape histograms into one of the three classes. Experimentations on a dataset of 240 images show recognition accuracies of the order of 80%.

Das, Shaoli; Parekh, Ranjan [School of Education Technology, Jadavpur University, Kolkata 700032 (India)

2010-10-26T23:59:59.000Z

136

E-Print Network 3.0 - ambulatory left ventricular Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

assessed left ventricular hypertrophy... of left ventricular hypertro- phy (Devereux et al., 1983; Drayer, Weber, & DeYoung, 1983; Prisant, Carr... -476. Drayer,...

137

Control system for a vertical-axis windmill  

DOE Patents (OSTI)

A vertical-axis windmill having a rotating structure is provided with a series of articulated vertical blades whose positions are controlled to maintain a constant RPM for the rotating structure, when wind speed is sufficient. A microprocessor controller is used to process information on wind speed, wind direction and RPM of the rotating structure to develop an electrical signal for establishing blade position. The preferred embodiment of the invention, when connected to a utility grid, is designed to generate 40 kilowatts of power when exposed to a 20 mile per hour wind. The control system for the windmill includes electrical blade actuators that modulate the blades of the rotating structure. Blade modulation controls the blade angle of attack, which in turn controls the RPM of the rotor. In the preferred embodiment, the microprocessor controller provides the operation logic and control functions. A wind speed sensor provides inputs to start or stop the windmill, and a wind direction sensor is used to keep the blade flip region at 90 and 270/sup 0/ to the wind. The control system is designed to maintain constant rotor RPM when wind speed is between 10 and 40 miles per hour.

Brulle, R.V.

1981-09-03T23:59:59.000Z

138

Work-piece alignment for a hybrid multi-axis laser-aided manufacturing system .  

E-Print Network (OSTI)

??"The Laser Aided Manufacturing Process (LAMP) is a multi-axis hybrid manufacturing process comprised of both an additive process, laser deposition, and a subtractive process, CNC… (more)

Panackal, Ajay

2006-01-01T23:59:59.000Z

139

Simulation and modeling of flow field around a horizontal axis wind turbine (HAWT) using RANS method.  

E-Print Network (OSTI)

??The principal objective of the proposed CFD analysis is to investigate the flow field around a horizontal axis wind turbine rotor and calculate the turbine's… (more)

Sargsyan, Armen.

2010-01-01T23:59:59.000Z

140

Modeling the Capacity of Left-Turn and Through Movement Considering Left-Turn Blockage and Spillback at Signalized Intersection with Short Left-Turn Bay  

E-Print Network (OSTI)

the vehicles in the queue in the current cycle. ?????? 10ij )c y c l ei n a r r i v a l s(P r o bp im CkPim 2nd situation: Left-turning queue carryover will take place in the next cycle. C ijmPijm ??????? )c y c l ei n a r r i v a l s(Pr o bp ij...

Cho, Kyoung Min

2010-10-12T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

GEODESIC FLOW, LEFT-HANDEDNESS, AND TEMPLATES PIERRE DEHORNOY  

E-Print Network (OSTI)

GEODESIC FLOW, LEFT-HANDEDNESS, AND TEMPLATES PIERRE DEHORNOY Abstract. We establish that, for every hyperbolic orbifolds of type (2, q, ) and for the orbifold of type (2, 3, 7), the geodesic flow orbits (i) bounds a Birkhoff section for the geodesic flow, and (ii) is a fibered link. These results

Paris-Sud XI, Université de

142

GEODESIC FLOW, LEFT-HANDEDNESS, AND TEMPLATES PIERRE DEHORNOY  

E-Print Network (OSTI)

GEODESIC FLOW, LEFT-HANDEDNESS, AND TEMPLATES PIERRE DEHORNOY Abstract. We establish that, for every hyperbolic orbifolds of type (2, q, ) and for every orbifold of type (2, 3, 4g+2), the geodesic of periodic orbits (i) bounds a Birkhoff section for the geodesic flow, and (ii) is a fibered link

Boyer, Edmond

143

LEFT The electron gun at the Diamond Synchrotron in  

E-Print Network (OSTI)

LEFT The electron gun at the Diamond Synchrotron in Didcot, Oxfordshire WWW.HOWITWORKSDAILY.COM026" Electron guns are a very versatile electrical component. They are essential to a number of devices, from 3D currents. When installed in an electrical device's vacuum tube, the gun turns electrons and ions

Crowther, Paul

144

(This page intentionally left blank.) Corrective Action Plan  

E-Print Network (OSTI)

: Radiation Protection....................................................................34 Finding C4#12;(This page intentionally left blank.) #12;#12;#12;Corrective Action Plan to the Independent line from "Develop plan to communicate action D1-3" to "Develop plan to communicate action D1-2" 4

145

WIND-TUNNEL STUDY ON AERODYNAMIC PERFORMANCE OF SMALL VERTICAL-AXIS WIND TURBINES  

E-Print Network (OSTI)

1 WIND-TUNNEL STUDY ON AERODYNAMIC PERFORMANCE OF SMALL VERTICAL-AXIS WIND TURBINES J. J. Miau*1 were carried out to study the aerodynamic performance of three vertical axis wind turbines (VAWTs. On the other hand, the characteristics of unsteady flow around the helical wind turbine were studied with a hot

Leu, Tzong-Shyng "Jeremy"

146

Manufacturing Equipment Modeling For a linear axis actuated by an electric motor complete the following  

E-Print Network (OSTI)

Manufacturing Equipment Modeling QUESTION 1 For a linear axis actuated by an electric motor(t). Include the axis disturbance force, but do not include motor electrical dynamics or Coulomb friction For a spindle actuated by an electric motor complete the following: a. Derive a differential equation

Landers, Robert G.

147

Precise Gouging-free Tool Orientations for 5-Axis CNC Machining Yong-Joon Kima  

E-Print Network (OSTI)

Precise Gouging-free Tool Orientations for 5-Axis CNC Machining Yong-Joon Kima , Gershon Elbera-free tool paths for 5-axis CNC machining of freeform NURBS surfaces using flat-end and rounded-end (bull modeling and have been widely used in a variety of applications. Consequently, CNC machining of NURBS

Pottmann, Helmut

148

Dynamic behavior analysis for a six axis industrial machining BISU Claudiu1,a  

E-Print Network (OSTI)

Dynamic behavior analysis for a six axis industrial machining robot BISU Claudiu1,a , CHERIF Mehdi2-yves.knevez@u-bordeaux1.fr Abstract The six axis robots are widely used in automotive industry for their good repeatability (as defined in the ISO92983) (painting, welding, mastic deposition, handling etc

Paris-Sud XI, Université de

149

Two Oppositely Localised Frizzled RNAs as Axis Determinants in a Cnidarian Embryo  

E-Print Network (OSTI)

ascidian and sea urchin embryos, promoting endoderm/mesoderm fates, and in domains offset from the vegetalTwo Oppositely Localised Frizzled RNAs as Axis Determinants in a Cnidarian Embryo Tsuyoshi Momose) Two oppositely localised Frizzled RNAs as axis determinants in a cnidarian embryo. PLoS Biol 5(4): e70

Villefranche sur mer

150

Near wake properties of horizontal axis marine current L. Myers and A.S. Bahaj  

E-Print Network (OSTI)

1 Near wake properties of horizontal axis marine current turbines L. Myers and A.S. Bahaj wake region of a tidal current turbine is strongly driven by the combined wake of the device support-scale horizontal axis turbine has been have been measured in a large water channel facility. A downstream map

Quartly, Graham

151

Comparison of Different Approaches for the Calculation of Projective Symmetry or the Axis of a SHGC  

E-Print Network (OSTI)

Comparison of Different Approaches for the Calculation of Projective Symmetry or the Axis of a SHGC;Comparison of Different Approaches for the Calculation of Projective Symmetry or the Axis of a SHGC Sven]. And although the projections of straight homogeneous generalised cylinders (SHGC) generally exhibit no symmetry

Hamburg,.Universität

152

CYCLOTRON HEATING NFR THE MULTIPOLE B = 0 AXIS J. C. Sprott  

E-Print Network (OSTI)

CYCLOTRON HEATING NFR THE MULTIPOLE B = 0 AXIS by J. C. Sprott November 1973 PLP 536 Plasma Studies of the author and major professor. #12;Ion and Electron Cyclotron heating rates in multipoles are generally = 0 axis in a multipole. The average cyclotron heating rate is given by d--= dt where TIB G 0 = TI

Sprott, Julien Clinton

153

CTAX: the US/Japan Cold Neutron Triple-Axis Spectromete at HFIR | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

CTAX-US/Japan Cold Neutron Triple-Axis Spectrometer CTAX-US/Japan Cold Neutron Triple-Axis Spectrometer CTAX US/Japan Cold Neutron Triple-Axis Spectrometer (CG-4C). (larger image) The U.S.-Japan Cold Neutron Triple-Axis Spectrometer (CTAX) is a conventional triple-axis spectrometer with variable incident energy and variable monochromator-sample and sample-analyzer distances. The cold guide 4 bender and guide hall shielding reduce background levels at CG-4C, and the 15-cm-tall guide profile is well exploited by CG-4C's vertically focusing monochromator (PG 002). To enhance accommodation of strong magnetic fields at the sample position and to simplify future polarization analysis, the amount of ferromagnetic material has been minimized in the construction of this instrument. CG-4C is a collaboration of Oak Ridge National Laboratory, the Neutron

154

Left-right spin asymmetry in l N ? ? h X  

We consider the inclusive production of hadrons in lepton-nucleon scattering. For a transversely polarized nucleon this reaction shows a left-right azimuthal asymmetry, which we compute in twist-3 collinear factorization at leading order in perturbation theory. All non-perturbative parton correlators of the calculation are fixed through information from other hard processes. Our results for the left-right asymmetry agree in sign with recent data for charged pion production from the HERMES Collaboration and from Jefferson Lab. However, the magnitude of the computed asymmetries tends to be larger than the data. Potential reasons for this outcome are identified. We also give predictions for future experiments and highlight in particular the unique opportunities at an Electron Ion Collider.

Gamberg, Leonard; Kang, Zhong-Bo; Metz, Andreas; Pitonyak, Daniel; Prokudin, Alexei

2014-10-01T23:59:59.000Z

155

Left-Handed W bosons at the LHC  

SciTech Connect

The production of W bosons in association with jets is an important background to new physics at the LHC. Events in which the W carries large transverse momentum and decays leptonically lead to large missing energy and are of particular importance. We show that the left-handed nature of the W coupling, combined with valence quark domination at a pp machine, leads to a large left-handed polarization for both W{sup +} and W{sup -} bosons at large transverse momenta. The polarization fractions are very stable with respect to QCD corrections. The leptonic decay of the W{sup +-} bosons translates the common left-handed polarization into a strong asymmetry in transverse momentum distributions between positrons and electrons, and between neutrinos and anti-neutrinos (missing transverse energy). Such asymmetries may provide an effective experimental handle on separating W +jets from top quark production, which exhibits very little asymmetry due to C invariance, and from various types of new physics.

Bern, Z.; /UCLA; Diana, G.; /Saclay, SPhT; Dixon, L.J.; /CERN /SLAC; Cordero, F.Febres; /Simon Bolivar U.; Forde, D.; /Simon Bolivar U. /NIKHEF, Amsterdam; Gleisberg, T.; Hoeche, S.; /SLAC; Ita, H.; /UCLA; Kosower, D.A.; /Saclay, SPhT; Maitre, D.; /CERN /Durham U.; Ozeren, K.; /UCLA

2011-05-20T23:59:59.000Z

156

Annual performance prediction for off-axis aligned Lugo heliostats at Solar Two  

SciTech Connect

The DELSOL computer code was used to model the annual Performance for numerous off-axis alignments of the Lugo heliostats located at the Solar Two site in Dagget, California. Recommended canting times are presented for the Lugo heliostats based upon their location in the field. Predicted annual performance of an off-axis alignment was actually higher than for on-axis alignment in some cases, and approximately equal if the recommended times are used. The annual performances of Solar One heliostats located nearby were also calculated, and illustrated the poorer performance expected of the Lugo heliostats.

Jones, S.A.

1996-02-01T23:59:59.000Z

157

Promoting electricity from renewable energy sources -- lessons learned from the EU, U.S. and Japan  

E-Print Network (OSTI)

left axis) NJ Solar (right axis) Massachusetts (left axis)Massachusetts Minnesota Yes (Distributed Generation) No Yes (Solar)

Haas, Reinhard

2008-01-01T23:59:59.000Z

158

Design, fabrication, and testing of a three-dimensional monolithic compliant six-axis nanopositioner  

E-Print Network (OSTI)

The purpose of this research was to demonstrate the feasibility for creating a three-dimensional monolithic compliant six-axis nanopositioner. Much of this work was based off of the original two-dimensional HexFlex manipulator ...

Labuz, James (James R.)

2006-01-01T23:59:59.000Z

159

Advanced Technology Solar Telescope 4.2 m Off-axis Primary Mirror Fabrication  

Science Journals Connector (OSTI)

Advanced optical surfacing technologies are applied for the Advanced Technology Solar Telescope 4.2 m off-axis primary mirror fabrication. A newly developed Stressed lap and IR...

Kim, Dae Wook; Oh, Chang Jin; Su, Peng; Burge, James H

160

E-Print Network 3.0 - axis neutron spectrometer Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

results for: axis neutron spectrometer Page: << < 1 2 3 4 5 > >> 1 For more information: Neutron Scattering Science User Office, neutronusers@ornl.gov or (865) 574-4600. Summary:...

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Regulation Of Fshr And SF-1 In The Hypothalamus-Pituitary-Gonadal (HPG) Axis.  

E-Print Network (OSTI)

Mammalian reproduction is highly dependent on the delicate balance of signals within the hypothalamic-pituitary-gonadal (HPG) axis that maintains proper endocrine environment. One of the key signals is the pituitary ...

George, Jitu Wilson

2013-08-31T23:59:59.000Z

162

Analysis and Strategies for Five-Axis Near-Dry EDM Milling.  

E-Print Network (OSTI)

??Strategies for precision five-axis near-dry electric discharge machining (EDM) milling are investigated. By understanding the material removal process behind near-dry EDM milling, its performance can… (more)

Fujiki, Masahiro

2009-01-01T23:59:59.000Z

163

A process planning strategy for multi-axis hybrid manufacturing process  

Science Journals Connector (OSTI)

This paper outlines a process planning strategy for a multi-axis hybrid manufacturing process that includes a metal deposition system and a multi-axis CNC machining system to rapidly manufacture precision metal parts. Different from the current layered manufacturing processes of which build direction is fixed throughout the process, the orientation of the part can affect the non-support buildability in the multi-axis hybrid manufacturing process. However, each orientation that satisfies the buildability and other constraints may not be unique. In this case, the final optimal orientation is determined based on build time. The build time computation algorithm for multi-axis hybrid system is presented in this paper. To speed up the exhaustive search for the optimal orientation, a multi-stage algorithm is developed to reduce the search space. A case study is used as an example to show the process planning strategy.

Jun Zhang; Jianzhong Ruan; Frank Liou

2013-01-01T23:59:59.000Z

164

Modeling of multiple-optical-axis pattern-integrated interference lithography systems.  

E-Print Network (OSTI)

??The image quality and collimation in a multiple-optical-axis pattern-integrated interference lithography system are evaluated for an elementary optical system composed of single-element lenses. Image quality… (more)

Sedivy, Donald E.

2014-01-01T23:59:59.000Z

165

Study of Reflected Shock Wave Perturbations at the Central Axis of Dense Plasma Column in a Plasma Focus  

Science Journals Connector (OSTI)

When the shock front (SF) hits the central axis of plasma focus device, a reflected shock moves radially outwards...

Morteza Habibi

2011-12-01T23:59:59.000Z

166

Ball nose milling cutter radius compensation in Z axis for CNC  

Science Journals Connector (OSTI)

A new AutoCAD/VisualLISP based method to substitute the 3D tool radius compensation in Z axis for CNC milling processes is here described. Specific features of VisualLISP programming language combined with AutoCAD facilities are used to gather the data ... Keywords: AutoCAD VisualLISP, CNC milling, Z axis compensation, complex shaped parts, tool radius compensation

Dragoi Mircea Viorel

2009-02-01T23:59:59.000Z

167

FSI Modeling of Vertical-Axis Wind Turbines Y. Bazilevs, A. Korobenko, X. Deng, and J. Yan  

E-Print Network (OSTI)

FSI Modeling of Vertical-Axis Wind Turbines Y. Bazilevs, A. Korobenko, X. Deng, and J. Yan-dependent aerodynamics and fluid-structure interaction (FSI) simula- tions of a Darrieus-type vertical-axis wind turbine compared to the vertical-axis wind turbine (VAWT) designs. However, smaller-size VAWTs are more suitable

Dabiri, John O.

168

Proto-Model of an Infrared Wide-Field Off-Axis Telescope  

E-Print Network (OSTI)

We develop a proto-model of an off-axis reflective telescope for infrared wide-field observations based on the design of Schwarzschild-Chang type telescope. With only two mirrors, this design achieves an entrance pupil diameter of 50 mm and an effective focal length of 100 mm. We can apply this design to a mid-infrared telescope with a field of view of 8 deg X 8 deg. In spite of the substantial advantages of off-axis telescopes in the infrared compared to refractive or on-axis reflective telescopes, it is known to be difficult to align the mirrors in off-axis systems because of their asymmetric structures. Off-axis mirrors of our telescope are manufactured at the Korea Basic Science Institute (KBSI). We analyze the fabricated mirror surfaces by fitting polynomial functions to the measured data. We accomplish alignment of this two-mirror off-axis system using a ray tracing method. A simple imaging test is performed to compare a pinhole image with a simulated prediction.

Kim, Sanghyuk; Chang, Seunghyuk; Kim, Geon Hee; Yang, Sun Choel; Kim, Myung Sang; Lee, Sungho; Lee, Hanshin; 10.5303/JKAS.2010.43.5.169

2010-01-01T23:59:59.000Z

169

Design and implementation of five-axis transformation function in CNC system  

Science Journals Connector (OSTI)

Abstract To implement five-axis functions in CNC system, based on domestic system Lan Tian series, an improved design method for the system software structure is proposed in this paper. The numerical control kernel of CNC system is divided into the task layer and the motion layer. A five-axis transformation unit is integrated into the motion layer. After classifying five-axis machines into different types and analyzing their geometry information, the five-axis kinematic library is designed according to the abstract factory pattern. Furthermore, by taking CA spindle-tilting machine as an example, the forward and the inverse kinematic transformations are deduced. Based on the new software architecture and the five-axis kinematic library, algorithms of RTCP (rotation tool center point control) and 3D radius compensation for end-milling are designed and realized. The milling results show that, with five-axis functions based on such software structure, the instructions with respect to the cutter’s position and orientation can be directly carried out in the CNC system.

Feng Wang; Hu Lin; Liaomo Zheng; Lei Yang; Jinjin Feng; Han Zhang

2014-01-01T23:59:59.000Z

170

Selective Synthesis of "Left-Handed" or "Right-Handed" Chemicals...  

NLE Websites -- All DOE Office Websites (Extended Search)

Selective Synthesis of "Left-Handed" or "Right-Handed" Chemicals A new series of catalysts is able to selectively make "left-handed" or "right-handed" nitrogen-containing compounds...

171

Examining Associations between Emotional Facial Expressions, Relative Left Frontal Cortical Activity, and Task Persistence  

E-Print Network (OSTI)

in degrees of approach motivation would influence relative left frontal cortical activity measured with electroencephalography (EEG) alpha power and task persistence measured with time working on insolvable geometric puzzles. Furthermore, relative left...

Price, Thomas

2012-10-19T23:59:59.000Z

172

On the three-web associated to the core of a left Bol three-web  

Science Journals Connector (OSTI)

Let B ? be a left Bol three-web given on a 2r-dimensional smooth manifold, CB ? the left Bol three-web associated to the core of B ?, and let CCB ? ...

G. A. Tolstikhina; A. M. Shelekhov

2014-12-01T23:59:59.000Z

173

Endovascular Treatment of Two Pseudoaneurysms Originating From the Left Ventricle  

SciTech Connect

A 67-year-old woman resented with an acute type A aortic dissection, which was treated surgically with aortic valve replacement as a composite graft with reimplantation of the coronary arteries. At the end of surgery, a left-ventricular venting catheter was placed through the apex and closed with a buffered suture. Consecutive computed tomography (CT) examinations verified a growing apex pseudoaneurysm. Communication between the ventricle and the pseudoaneurysm was successfully closed with an Amplatz septal plug by the transfemoral route. Follow-up CT showed an additional pseudoaneurysm, which also was successfully closed using the same method.

Cwikiel, Wojciech, E-mail: wcwikiel@gmail.com; Keussen, Inger [Skane University Hospital, Department of Radiology (Sweden)] [Skane University Hospital, Department of Radiology (Sweden); Gustafsson, Ronny; Mokhtari, Arash [Skane University Hospital, Department of Thoracic Surgery (Sweden)] [Skane University Hospital, Department of Thoracic Surgery (Sweden)

2013-12-15T23:59:59.000Z

174

Phenomenology of The Left-Right Twin Higgs Model  

E-Print Network (OSTI)

The twin Higgs mechanism has recently been proposed to solve the little hierarchy problem. We study the implementation of the twin Higgs mechanism in left-right models. At TeV scale, heavy quark and gauge bosons appear, with rich collider phenomenology. In addition, there are extra Higgses, some of which couple to both the Standard Model fermion sector and the gauge sector, while others couple to the gauge bosons only. We present the particle spectrum, and study the general features of the collider phenomenology of this class of model at the Large Hadron Collider.

Hock-Seng Goh; Shufang Su

2007-04-30T23:59:59.000Z

175

Phenomenology of the left-right twin Higgs model  

SciTech Connect

The twin Higgs mechanism was proposed recently to solve the little hierarchy problem. We study the implementation of the twin Higgs mechanism in left-right models. At the TeV scale, heavy quark and gauge bosonsappear, with rich collider phenomenology. In addition, there are extra Higgs bosons, some of which couple to both the standard model fermion sector and the gauge sector, while others couple to the gauge bosons only. We present the particle spectrum and study the general features of the collider phenomenology of this class of model at the Large Hadron Collider.

Goh, Hock-Seng; Goh, Hock-Seng; Su, Shufang

2006-11-02T23:59:59.000Z

176

Higgs Boson Spectra in Supersymmetric Left-Right Models  

E-Print Network (OSTI)

We present a comprehensive analysis of the Higgs boson spectra in several versions of the supersymmetric left--right model based on the gauge symmetry $SU(3)_c \\times SU(2)_L \\times SU(2)_R \\times U(1)_{B-L}$. A variety of symmetry breaking sectors are studied, with a focus on the constraints placed on model parameters by the lightest neutral CP even Higgs boson mass $M_h$. The breaking of $SU(2)_R$ symmetry is achieved by Higgs fields transforming either as triplets or doublets, and the electroweak symmetry breaking is triggered by either bi--doublets or doublets. The Higgs potential is analyzed with or without a gauge singlet Higgs field present. Seesaw models of Type I and Type II, inverse seesaw models, universal seesaw models and an $E_6$ inspired alternate left--right model are included in our analysis. Several of these models lead to the tree--level relation $M_h \\leq \\sqrt{2}\\,m_W$ (rather than $M_h \\leq m_Z$ that arises in the MSSM), realized when the $SU(2)_R$ symmetry breaking scale is of order TeV...

Babu, K S

2014-01-01T23:59:59.000Z

177

E-Print Network 3.0 - axis lesions relationship Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

was calculated for each lesion in each lung lobe... lesions in only the left lung, the mean (SEM) lesion volume was 97 (13) mm3 ... Source: Illinois at Urbana-Champaign,...

178

Dual-band Composite Right/Left Hand Substrate Integrated Waveguide Leaky Wave Antenna Phased Array Design  

E-Print Network (OSTI)

Itoh and C. Caloz, "Composite right/left-handed transmissionY. Dong and T. Itoh, "Composite Right/Left-Handed SubstrateSubstrate Integrated Composite Right-/Left-Handed Leaky-Wave

Tanabe, Jordan Masao

2013-01-01T23:59:59.000Z

179

Magnetic resonance imaging of the left atrial appendage post pulmonary vein isolation: Implications for percutaneous left atrial appendage occlusion  

Science Journals Connector (OSTI)

AbstractBackground There is increasing interest in performing left atrial appendage (LAA) occlusion at the time of atrial fibrillation (AF) ablation procedures. However, to date there has been no description of the acute changes to the LAA immediately following pulmonary vein (PV) isolation and additional left atrium (LA) substrate modification. This study assessed changes in the size and tissue characteristics of the LAA ostium in patients undergoing PV isolation. Methods This series included 8 patients who underwent cardiovascular magnetic resonance evaluation of the LA with delayed enhancement magnetic resonance imaging and contrast enhanced 3-D magnetic resonance angiography pre-, within 48 h of, and 3 months post ablation. Two independent cardiac radiologists evaluated the ostial LAA diameters and area at each time point in addition to the presence of gadolinium enhancement. Results Compared to pre-ablation values, the respective median differences in oblique diameters and LAA area were +1.8 mm, +1.7 mm, and +0.6 cm2 immediately post ablation (all NS) and ?2.7 mm, ?2.3 mm, and ?0.5 cm2 at 3 months (all NS). No delayed enhancement was detected in the LAA post ablation. Conclusion No significant change to LAA diameter, area, or tissue characteristics was noted after PV isolation. While these findings suggest the safety and feasibility of concomitant PV isolation and LAA device occlusion, the variability in the degree and direction of change of the LAA measurements highlights the need for further study.

Sheldon M. Singh; Laura Jimenez-Juan; Asaf Danon; Gorka Bastarrika; Andriy V. Shmatukha; Graham A. Wright; Eugene Crystal

2014-01-01T23:59:59.000Z

180

AXIS: An instrument for imaging Compton radiographs using the Advanced Radiography Capability on the NIF  

SciTech Connect

Compton radiography is an important diagnostic for Inertial Confinement Fusion (ICF), as it provides a means to measure the density and asymmetries of the DT fuel in an ICF capsule near the time of peak compression. The AXIS instrument (ARC (Advanced Radiography Capability) X-ray Imaging System) is a gated detector in development for the National Ignition Facility (NIF), and will initially be capable of recording two Compton radiographs during a single NIF shot. The principal reason for the development of AXIS is the requirement for significantly improved detection quantum efficiency (DQE) at high x-ray energies. AXIS will be the detector for Compton radiography driven by the ARC laser, which will be used to produce Bremsstrahlung X-ray backlighter sources over the range of 50 keV–200 keV for this purpose. It is expected that AXIS will be capable of recording these high-energy x-rays with a DQE several times greater than other X-ray cameras at NIF, as well as providing a much larger field of view of the imploded capsule. AXIS will therefore provide an image with larger signal-to-noise that will allow the density and distribution of the compressed DT fuel to be measured with significantly greater accuracy as ICF experiments are tuned for ignition.

Hall, G. N., E-mail: hall98@llnl.gov; Izumi, N.; Tommasini, R.; Carpenter, A. C.; Palmer, N. E.; Zacharias, R.; Felker, B.; Holder, J. P.; Allen, F. V.; Bell, P. M.; Bradley, D.; Montesanti, R.; Landen, O. L. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, California 94550 (United States)

2014-11-15T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Inverse kinematics for optimal tool orientation control in 5-axis CNC machining  

Science Journals Connector (OSTI)

Abstract The problem of determining the inputs to the rotary axes of a 5-axis CNC machine is addressed, such that relative variations of orientation between the tool axis and surface normal are minimized subject to the constraint of maintaining a constant cutting speed with a ball-end tool. In the context of an orientable-spindle machine, the results of a prior study are directly applicable to the solution of this inverse-kinematics problem. However, since they are expressed in terms of the integral of the geodesic curvature, a discrete time-step solution is proposed that yields accurate rotary-axis increments at high sampling frequencies. For an orientable-table machine, a closed-form solution that specifies the rotary-axis positions as functions of the surface normal variation along the toolpath is possible. In this context, however, the feasibility of a solution is dependent upon the surface normal along the toolpath satisfying certain orientational constraints. These inverse-kinematics solutions facilitate accurate and efficient 5-axis machining of free-form surfaces without “unnecessary” actuation of the machine rotary axes.

Rida T. Farouki; Chang Yong Han; Shiqiao Li

2014-01-01T23:59:59.000Z

182

Rotational Doppler effect in left-handed materials  

Science Journals Connector (OSTI)

We explain the rotational Doppler effect associated with light beams carrying with orbital angular momentum in left-handed materials (LHMs). We demonstrate that the rotational Doppler effect in LHMs is unreversed, which is significantly different from the axial Doppler effect. The physics underlying this intriguing effect is the combined contributions of negative phase velocity and the inverse screw of the wave front. We find that the additional Doppler effect caused by Gouy phase and wave-front curvature should be reversed, because of the negative index. In the normal dispersion region, the rotational Doppler effect induces an upstream energy flow but a downstream momentum flow. In the anomalous dispersion region, however, the rotational Doppler effect produces a downstream energy flow but an upstream momentum flow. We theoretically predict that the rotational Doppler effect can induce a transfer of angular momentum of the LHM to orbital angular momentum of the beam.

Hailu Luo; Shuangchun Wen; Weixing Shu; Zhixiang Tang; Yanhong Zou; Dianyuan Fan

2008-09-05T23:59:59.000Z

183

Mathematical modeling applied to the left ventricle of heart  

E-Print Network (OSTI)

Background: How can mathematics help us to understand the mechanism of the cardiac motion? The best known approach is to take a mathematical model of the fibered structure, insert it into a more-or-less complex model of cardiac architecture, and then study the resulting fibers of activation that propagate through the myocardium. In our paper, we have attempted to create a novel software capable of demonstrate left ventricular (LV) model in normal hearts. Method: Echocardiography was performed on 70 healthy volunteers. Data evaluated included: velocity (radial, longitudinal, rotational and vector point), displacement (longitudinal and rotational), strain rate (longitudinal and circumferential) and strain (radial, longitudinal and circumferential) of all 16 LV myocardial segments. Using these data, force vectors of myocardial samples were estimated by MATLAB software, interfaced in the echocardiograph system. Dynamic orientation contraction (through the cardiac cycle) of every individual myocardial fiber could ...

Ranjbar, Saeed

2014-01-01T23:59:59.000Z

184

Power performance of canted blades for a vertical axis wind turbine  

Science Journals Connector (OSTI)

Small scale vertical axis wind turbines have a number of advantages for deployment in an urban environment but are subject to highly varying thrust and radial aerodynamic forces. Helical blade shapes for vertical axis wind turbines can reduce load fluctuations during turbine operation; however a helix has complicated three-dimensional geometry that can be difficult to manufacture resulting in expensive blades. A new blade configuration based on twisted straight blades that are mounted at an angle to the vertical a cant has been developed and tested in a wind tunnel in a number of different configurations and conditions. They offer the benefits of distributing the fluctuating aerodynamic loads but incorporate a linear axis so that they can be manufactured at a comparable cost to simple straight blades. The power performance data from the tunnel testing show that canted blades have comparable power output to similar straight blades and that aerodynamic fences can be used to improve power performance.

Shawn Armstrong; Stephen Tullis

2011-01-01T23:59:59.000Z

185

Development and Test Plans for a small Vertical Axis Turbine Designed and  

NLE Websites -- All DOE Office Websites (Extended Search)

Development and Test Plans for a small Vertical Axis Turbine Designed and Development and Test Plans for a small Vertical Axis Turbine Designed and Built by the Russian State Rocket Center under Berkeley Lab auspices Speaker(s): Anthony Radspieler Jr. Glen Dahlbacka Joseph Rasson Date: March 4, 2010 - 12:00pm Location: 90-3122 Berkeley Lab Engineering Division teamed with Empire Magnetics, Rohnert Park and the Makeyev State Rocket Center under a DOE NNSA non-proliferation project to develop and test a series of small wind turbines of vertical axis design. Over the years, about 100 Russian scientists and engineers worked on the project and the hydrodynamic, aerodynamic and mechanical test facilities of the SRC were used. The objective was to create a highly manufacturable Darieus unit with a modest Tip Speed Ratio (quiet and low

186

Atomic resolution electrostatic potential mapping of graphene sheets by off-axis electron holography  

SciTech Connect

Off-axis electron holography has been performed at atomic resolution with the microscope operated at 80?kV to provide electrostatic potential maps from single, double, and triple layer graphene. These electron holograms have been reconstructed in order to obtain information about atomically resolved and mean inner potentials. We propose that off-axis electron holography can now be used to measure the electrical properties in a range of two-dimensional semiconductor materials and three dimensional devices comprising stacked layers of films to provide important information about their electrical properties.

Cooper, David, E-mail: david.cooper@cea.fr [University Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054, Grenoble (France); Pan, Cheng-Ta; Haigh, Sarah [School of Materials, The University of Manchester, Manchester M13 9PL (United Kingdom)

2014-06-21T23:59:59.000Z

187

A two-dimensional matrix correction for off-axis portal dose prediction errors  

SciTech Connect

Purpose: This study presents a follow-up to a modified calibration procedure for portal dosimetry published by Bailey et al. ['An effective correction algorithm for off-axis portal dosimetry errors,' Med. Phys. 36, 4089-4094 (2009)]. A commercial portal dose prediction system exhibits disagreement of up to 15% (calibrated units) between measured and predicted images as off-axis distance increases. The previous modified calibration procedure accounts for these off-axis effects in most regions of the detecting surface, but is limited by the simplistic assumption of radial symmetry. Methods: We find that a two-dimensional (2D) matrix correction, applied to each calibrated image, accounts for off-axis prediction errors in all regions of the detecting surface, including those still problematic after the radial correction is performed. The correction matrix is calculated by quantitative comparison of predicted and measured images that span the entire detecting surface. The correction matrix was verified for dose-linearity, and its effectiveness was verified on a number of test fields. The 2D correction was employed to retrospectively examine 22 off-axis, asymmetric electronic-compensation breast fields, five intensity-modulated brain fields (moderate-high modulation) manipulated for far off-axis delivery, and 29 intensity-modulated clinical fields of varying complexity in the central portion of the detecting surface. Results: Employing the matrix correction to the off-axis test fields and clinical fields, predicted vs measured portal dose agreement improves by up to 15%, producing up to 10% better agreement than the radial correction in some areas of the detecting surface. Gamma evaluation analyses (3 mm, 3% global, 10% dose threshold) of predicted vs measured portal dose images demonstrate pass rate improvement of up to 75% with the matrix correction, producing pass rates that are up to 30% higher than those resulting from the radial correction technique alone. As in the 1D correction case, the 2D algorithm leaves the portal dosimetry process virtually unchanged in the central portion of the detector, and thus these correction algorithms are not needed for centrally located fields of moderate size (at least, in the case of 6 MV beam energy).Conclusion: The 2D correction improves the portal dosimetry results for those fields for which the 1D correction proves insufficient, especially in the inplane, off-axis regions of the detector. This 2D correction neglects the relatively smaller discrepancies that may be caused by backscatter from nonuniform machine components downstream from the detecting layer.

Bailey, Daniel W. [Department of Physics, State University of New York at Buffalo, Buffalo, New York 14260 (United States); Department of Radiation Medicine, Roswell Park Cancer Institute, Buffalo, New York 14263 (United States); Kumaraswamy, Lalith; Bakhtiari, Mohammad [Department of Radiation Medicine, Roswell Park Cancer Institute, Buffalo, New York 14263 (United States); Podgorsak, Matthew B. [Department of Radiation Medicine, Roswell Park Cancer Institute, Buffalo, New York 14263 and Department of Physiology and Biophysics, State University of New York at Buffalo, Buffalo, New York 14214 (United States)

2013-05-15T23:59:59.000Z

188

Reconstruction of the Electron Density of Molecules with Single-Axis Alignment  

SciTech Connect

Diffraction from the individual molecules of a molecular beam, aligned parallel to a single axis by a strong electric field or other means, has been proposed as a means of structure determination of individual molecules. As in fiber diffraction, all the information extractable is contained in a diffraction pattern from incidence of the diffracting beam normal to the molecular alignment axis. We present two methods of structure solution for this case. One is based on the iterative projection algorithms for phase retrieval applied to the coefficients of the cylindrical harmonic expansion of the molecular electron density. Another is the holographic approach utilizing presence of the strongly scattering reference atom for a specific molecule.

Starodub, Dmitri

2011-08-12T23:59:59.000Z

189

Neutron Experiment descriptions: N1: Triple-Axis Spectrometers, HFIR HB1A & HB3  

E-Print Network (OSTI)

Neutron Experiment descriptions: N1: Triple-Axis Spectrometers, HFIR HB1A & HB3 Spin wave2A Magnetic structure of NiO Neutron diffraction measurements will be performed to investigate 600K to 288K, using the Neutron Powder Diffractometer at the HFIR. Rietveld analysis of the crystal

Pennycook, Steve

190

Rotation Angle for the Optimum Tracking of One-Axis Trackers  

SciTech Connect

An equation for the rotation angle for optimum tracking of one-axis trackers is derived along with equations giving the relationships between the rotation angle and the surface tilt and azimuth angles. These equations are useful for improved modeling of the solar radiation available to a collector with tracking constraints and for determining the appropriate motor revolutions for optimum tracking.

Marion, W. F.; Dobos, A. P.

2013-07-01T23:59:59.000Z

191

Tilt display demonstration: a display surface with multi-axis tilt & actuation  

Science Journals Connector (OSTI)

This demonstration accompanies a full paper accepted into MobileHCI '12 [1]. We demonstrate a new type of actuatable display, called a Tilt Display, that provides visual feedback combined with multi-axis tilting and vertical actuation. Its ability to ... Keywords: actuated displays, nonplanar surface interaction, physical actuation, tilt displays

Jason Alexander; Andrés Lucero; Sriram Subramanian

2012-09-01T23:59:59.000Z

192

Tilt displays: designing display surfaces with multi-axis tilting and actuation  

Science Journals Connector (OSTI)

We present a new type of actuatable display, called Tilt Displays, that provide visual feedback combined with multi-axis tilting and vertical actuation. Their ability to physically mutate provides users with an additional information channel that facilitates ... Keywords: actuated displays, non-planar surface interaction, physical actuation, tilt displays

Jason Alexander; Andrés Lucero; Sriram Subramanian

2012-09-01T23:59:59.000Z

193

Maximum Feedrate Interpolator for Multi-axis CNC Machining with Jerk Constraints  

E-Print Network (OSTI)

Maximum Feedrate Interpolator for Multi-axis CNC Machining with Jerk Constraints X. Beudaert, S name@lurpa.ens-cachan.fr Abstract A key role of the CNC is to perform the feedrate interpolation which for the next point along the path is computed. Examples and comparisons with an industrial CNC demonstrate

Paris-Sud XI, Université de

194

Journal of Vegetation Science && (2012) Salinity tolerance and the decoupling of resource axis  

E-Print Network (OSTI)

functional trade-offs are present along a gradient of low to high salinity? Location: New York State, USA and salinity gradients at three sites using principal compo- nents, correlation and fourth-corner analysesJournal of Vegetation Science && (2012) Salinity tolerance and the decoupling of resource axis

Fridley, Jason D.

195

MAGNETIC NEUTRON SCATTERING. And Recent Developments in the Triple Axis Spectroscopy  

E-Print Network (OSTI)

Chapter 1 MAGNETIC NEUTRON SCATTERING. And Recent Developments in the Triple Axis Spectroscopy Igor.................................................................................... 2 2. Neutron interaction with matter and scattering cross-section ........ 6 2.1 Basic scattering theory and differential cross-section................ 7 2.2 Neutron interactions and scattering lengths

Johnson, Peter D.

196

A methodology for process parameter selection in five axis laser cladding  

Science Journals Connector (OSTI)

Laser cladding industrial development is becoming an important target for high added value parts manufacturing sectors. Aeronautical or automotive industries are accomplishing great investments in order to understand the process and minimise tuning step costs now paired with. At the moment, the process is applied to three axis or 3 + 2 axis strategies, being numerous works focused on the obtainment of process parameters. All of them try to minimise the number of experimental tests necessary to optimise the great variable involving the process. These variables increase when using laser cladding on five axis kinematics in order to accomplish new targets of industrial sectors which include complex parts with complex surface to clad. The work presents a methodology which helps to choose optimal parameters for five axis laser cladding. A weighted criterion is used in order to discern between different parameters taking into account process requirements. The methodology has been used on two materials and different objectives have been established for the criterion in each one. Finally, two test parts are presented as methodology validation in industrial applications.

Iván Tabernero; Amaia Calleja; Aitzol Lamikiz; Luis Norberto López de Lacalle

2014-01-01T23:59:59.000Z

197

Hydrothermal synthesis, off-axis electron holography and magnetic properties of Fe3O4 nanoparticles  

E-Print Network (OSTI)

-sized Fe3O4 have been prepared by various methods such as sol­ gel processing, hydrothermal synthesisHydrothermal synthesis, off-axis electron holography and magnetic properties of Fe3O4 nanoparticles Jülich, Germany. Abstract. The hydrothermal synthesis of Fe3O4 nanoparticles (NPs) (

Dunin-Borkowski, Rafal E.

198

First-order design of off-axis reflective ophthalmic adaptive optics systems using afocal  

E-Print Network (OSTI)

First-order design of off-axis reflective ophthalmic adaptive optics systems using afocal for designing laser cavities, spectrographs and adaptive optics retinal imaging systems. The use, range respectively. This is discussed using examples from adaptive optics retinal imaging systems. The performance

199

Microstructure dependence of the c-axis critical current density in second-generation YBCO tapes.  

SciTech Connect

C-axis current flow in high temperature superconductor (HTS) tape-shaped wires arises in configurations where the local wire axis is not perpendicular to the local magnetic field, such as in power cables with helically wound HTS tapes. The c-axis critical current density J{sub c}{sup c} has been recently found to be orders of magnitude lower than the ab-plane critical current density J{sub c}{sup ab}. Here we report on J{sub c}{sup c} (77 K, sf) values of various YBa{sub 2}Cu{sub 3}O{sub 7}-based (YBCO) tapes with different microstructures. Our results show that the value of J{sub c}{sup c} (77 K, sf) decreases significantly with increasing concentration of ab-plane stacking faults in YBCO thin films and that the critical current anisotropy {gamma} = J{sub c}{sup ab}/J{sub c}{sup c} can reach values as high as 2070, implying that in the highest-anisotropy tape, {approx}20% of the tape width carries c-axis current in a helically wound power cable.

Jia, Y.; Welp, U.; Crabtree, G. W.; Kwok, W. K.; Malozemoff, A. P.; Rupich, M. W.; Fleshler, S.; Clem, J. R. (Materials Science Division); (American Superconductor Corp.); (Ames Lab.); (Iowa State Univ.)

2011-10-01T23:59:59.000Z

200

Origin of a magnetic easy axis in pipeline steel L. Clapham,a)  

E-Print Network (OSTI)

Origin of a magnetic easy axis in pipeline steel L. Clapham,a) C. Heald, T. Krause, and D. L December 1998; accepted for publication 27 April 1999 Oil and gas pipelines are generally magnetically overlooked, the magnetic properties of oil and gas pipelines are an important consideration since the most

Clapham, Lynann

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

On the probability of major-axis precession in triaxial ellipsoidal potentials  

E-Print Network (OSTI)

Orbits in triaxial ellipsoidal potentials precess about either the major or minor axis of the ellipsoid. In standard perturbation theory it can be shown that a circular orbit will precess about the minor axis if its angular momentum vector lies in a region bounded by two great circles which pass through the intermediate axis and which are inclined with minimum separation $i_T$ from the minor axis. We test the accuracy of the standard formula for $i_T$ by performing orbit integrations to determine $i_S$, the simulated turnover angle corresponding to $i_T$. We reach two principal conclusions: (i) $i_S$ is usually greater than $i_T$, by as much as 12 degrees even for moderate triaxialities, $A/1.2

P. A. Thomas; S. Vine; F. R. Pearce

1993-08-09T23:59:59.000Z

202

Multi-Fidelity Uncertainty Quantification: Application to a Vertical Axis Wind Turbine Under an  

E-Print Network (OSTI)

. Introduction Quantifying the response of a wind turbine to an extreme wind gust is an important designMulti-Fidelity Uncertainty Quantification: Application to a Vertical Axis Wind Turbine Under an Extreme Gust A. Santiago Padr´on , Juan J. Alonso and Francisco Palacios Stanford University, Stanford, CA

Alonso, Juan J.

203

Multi-Body Unsteady Aerodynamics in 2D Applied to aVertical-Axis Wind Turbine Using a Vortex Method.  

E-Print Network (OSTI)

?? Vertical axis wind turbines (VAWT) have many advantages over traditional Horizontalaxis wind turbines (HAWT).One of the more severe problem of VAWTs are the complicated… (more)

Österberg, David

2010-01-01T23:59:59.000Z

204

E-Print Network 3.0 - acute left subclavian Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

NIH Public Access Summary: was positioned in the mid left carotid artery (LCA), inflated to nominal pressure, and rapidly withdrawn up... of acute atrial septal...

205

Isolation of the Left Innominate Artery in an Elderly Patient Without Congenital Heart Disease  

SciTech Connect

We report a rare anomaly consisting of a right aortic arch with an isolated left innominate artery in an elderly man without congenital heart disease.

Boren, Edwin L. Jr.; Matchett, W. Jean [Department of Radiology, Slot 556, University of Arkansas for Medical Sciences, 4301 West Markham Street, Little Rock, AR 72210 (United States); Gagne, Paul J. [Department of Surgery, University of Arkansas for Medical Sciences, 4301 West Markham Street, Little Rock, AR 72210 (United States); McFarland, David R. [Department of Radiology, Slot 556, University of Arkansas for Medical Sciences, 4301 West Markham Street, Little Rock, AR 72210 (United States)

2000-01-15T23:59:59.000Z

206

4056 IEEE SENSORS JOURNAL, VOL. 13, NO. 10, OCTOBER 2013 Design and Characterization of a Soft Multi-Axis  

E-Print Network (OSTI)

4056 IEEE SENSORS JOURNAL, VOL. 13, NO. 10, OCTOBER 2013 Design and Characterization of a Soft Multi-Axis Force Sensor Using Embedded Microfluidic Channels Daniel M. Vogt, Member, IEEE, Yong-Lae Park system. We describe the design, fabrication, and characterization of a novel soft multi-axis force sensor

Park, Yong-Lae

207

Dielectric and ferroelectric properties of c-axis oriented strontium bismuth tantalate thin films applied transverse electric fields  

E-Print Network (OSTI)

Dielectric and ferroelectric properties of c-axis oriented strontium bismuth tantalate thin films and ferroelectric properties of c-axis oriented epitaxial strontium bismuth tantalate SBT thin films were American Institute of Physics. DOI: 10.1063/1.2205351 I. INTRODUCTION Strontium bismuth tantalate SBT has

Tonouchi, Masayoshi

208

Study on the relationship between left-turn traffic operations and safety at signalized intersections  

E-Print Network (OSTI)

............................................................ 6? FIGURE 3 Regression Lines and Averaged Data for Model B2 ..................................... 21? FIGURE 4 Regression Lines for Model B4 ..................................................................... 21? FIGURE 5 Left-turn Accident... Distribution ..................................................................... 30? FIGURE 6 Box Plot of the Number of Accidents for Left-Turn Type ............................ 35? FIGURE 7 Box Plot of Number of Crashes for Each Phasing Sequence...

Lee, Sunghoon

2009-06-02T23:59:59.000Z

209

Multistability in nonlinear left-handed transmission lines David A. Powell,a  

E-Print Network (OSTI)

Multistability in nonlinear left-handed transmission lines David A. Powell,a Ilya V. Shadrivov; published online 2 July 2008 Employing a nonlinear left-handed transmission line as a model system, we, which at higher power may result in chaotic dynamics of the transmission line. © 2008 American Institute

210

Bicycles and left-right tours in locally finite Henning Bruhn Stefanie Kosuch Melanie Win Myint  

E-Print Network (OSTI)

Bicycles and left-right tours in locally finite graphs Henning Bruhn Stefanie Kosuch Melanie Win Myint Abstract We extend three results involving bicycles and left-right tours to infi- nite, locally-right tours generate the bicycle space and the planarity criterion of Archdeacon, Bonnington and Little

Diestel, Reinhard

211

ANL/APS/TB-32 Test of Horizontal Field Measurements Using Two-Axis Hall  

NLE Websites -- All DOE Office Websites (Extended Search)

2 2 Test of Horizontal Field Measurements Using Two-Axis Hall Probes at the APS Magnetic Measurement Facility I. Vasserman Advanced Photon Source Argonne National Laboratory Argonne, IL 60439 1. Introduction The free-electron laser (FEL) project at the Advanced Photon Source (APS) will use a 400-MeV particle beam from the APS linac with RMS beam transverse size of 100 µm and requires very high performance of the insertion devices in order to achieve high intensity radiation. Averaged over period, the trajectory must deviate from the ideal on-axis trajectory by not more than 10% of the RMS beam size. Meaning that the second field integral should be straight within ±1300 G-cm 2 over the length of the device for both horizontal and vertical directions for the 400-MeV particle

212

Easy axis alignment of chemically partially ordered FePt nanoparticles  

SciTech Connect

Partially ordered Fe{sub 53}Pt{sub 47} nanoparticles with size around 8 nm were prepared by the simultaneous decomposition of iron pentacarbonyl and platinum acetylacetonate. The high boiling point chemical, hexadecylamine, was used as a solvent, and 1-adamantanecarboxylic acid was used as a stabilizer. X-ray diffraction measurements reveal that as-made FePt particles were partially transformed into the ordered L1{sub 0} phase with some weak superlattice peaks. The room-temperature hysteresis loop and remanence curve suggest a broad distribution of anisotropies in the partially ordered particles. By coating the partially ordered FePt nanoparticles with a polyvinylchloride polymer binder, the particles could be re-dispersed in cyclohexanone. Furthermore, the easy axis of the particles coated with the polyvinylchloride polymer binder could be aligned under an external field. Easy axis alignment was confirmed from both alternating gradient magnetometer and x-ray diffraction measurements.

Kang, Shishou; Jia Zhiyong; Shi, Shifan; Nikles, David E.; Harrell, J.W. [Center for Materials for Information Technology, University of Alabama, Tuscaloosa, Alabama 35487-0209 (United States)

2005-02-07T23:59:59.000Z

213

Axi-symmetrical flow reactor for [sup 196]Hg photochemical enrichment  

DOE Patents (OSTI)

The present invention is directed to an improved photochemical reactor useful for the isotopic enrichment of a predetermined isotope of mercury, especially, [sup 196]Hg. Specifically, two axi-symmetrical flow reactors were constructed according to the teachings of the present invention. These reactors improve the mixing of the reactants during the photochemical enrichment process, affording higher yields of the desired [sup 196]Hg product. Measurements of the variation of yield (Y) and enrichment factor (E) along the flow axis of these reactors indicates very substantial improvement in process uniformity compared to previously used photochemical reactor systems. In one preferred embodiment of the present invention, the photoreactor system was built such that the reactor chamber was removable from the system without disturbing the location of either the photochemical lamp or the filter employed therewith. 10 figures.

Grossman, M.W.

1991-04-30T23:59:59.000Z

214

Lattice Boltzmann method for heat diffusion in axis-symmetric geometries  

Science Journals Connector (OSTI)

Lattice Boltzmann Methods (LBM) have been used to solve momentum, heat and mass transport equations mainly in Cartesian coordinate system. In the present work, the LBM is extended to solve transports in axis-symmetric geometries, such as pipes and spheres. Heat diffusion and conduction in solids without and with heat generation were tested. The heat diffusion equation for axis-symmetric problem is reduced to diffusion equation as in Cartesian coordinate with an extra term due to the surface area variation along the radial direction. The extra term is treated as a source term (forcing term) in LBM. The extra term can be approximated by using finite difference or more accurately as a flux term. The results predicted by LBM are well compared with analytical solutions and finite volume method.

A.A. Mohamad

2009-01-01T23:59:59.000Z

215

Virtual machining considering dimensional, geometrical and tool deflection errors in three-axis CNC milling machines  

Science Journals Connector (OSTI)

Abstract Virtual manufacturing systems can provide useful means for products to be manufactured without the need of physical testing on the shop floor. As a result, the time and cost of part production can be decreased. There are different error sources in machine tools such as tool deflection, geometrical deviations of moving axis and thermal distortions of machine tool structures. Some of these errors can be decreased by controlling the machining process and environmental parameters. However other errors like tool deflection and geometrical errors which have a big portion of the total error, need more attention. This paper presents a virtual machining system in order to enforce dimensional, geometrical and tool deflection errors in three-axis milling operations. The system receives 21 dimensional and geometrical errors of a machine tool and machining codes of a specific part as input. The output of the system is the modified codes which will produce actual machined part in the virtual environment.

Mohsen Soori; Behrooz Arezoo; Mohsen Habibi

2014-01-01T23:59:59.000Z

216

An Einstein-Hilbert Action for Axi-Dilaton Gravity in 4-Dimensions  

E-Print Network (OSTI)

We examine the axi-dilatonic sector of low energy string theory and demonstrate how the gravitational interactions involving the axion and dilaton fields may be derived from a geometrical action principle involving the curvature scalar associated with a non-Riemannian connection. In this geometry the antisymmetric tensor 3-form field determines the torsion of the connection on the frame bundle while the gradient of the metric is determined by the dilaton field. By expressing the theory in terms of the Levi-Civita connection associated with the metric in the ``Einstein frame'' we confirm that the field equations derived from the non-Riemannian Einstein-Hilbert action coincide with the axi-dilaton sector of the low energy effective action derived from string theory.

T Dereli; Robin W Tucker

1995-02-08T23:59:59.000Z

217

Magnetic axis safety factor of finite $\\beta$ spheromaks and transition from spheromaks to toroidal magnetic bubbles  

E-Print Network (OSTI)

The value of the safety factor on the magnetic axis of a finite-beta spheromak is shown to be a function of beta in contrast to what was used in P. M. Bellan, Phys. Plasmas 9, 3050 (2002); this dependence on beta substantially reduces the gradient of the safety factor compared to the previous calculation. The method for generating finite-beta spheromak equilibria is extended to generate equilibria describing toroidal magnetic "bubbles" where the hydrodynamic pressure on the magnetic axis is less than on the toroid surface. This "anti-confinement" configuration can be considered an equilibrium with an inverted beta profile and is relevant to interplanetary magnetic clouds as these clouds have lower hydrodynamic pressure in their interior than on their surface.

Bellan, Paul M

2015-01-01T23:59:59.000Z

218

High efficiency off-axis current drive by high frequency fast waves  

SciTech Connect

Modeling work shows that current drive can be done off-axis with high efficiency, as required for FNSF and DEMO, by using very high harmonic fast waves (“helicons” or “whistlers”). The modeling indicates that plasmas with high electron beta are needed in order for the current drive to take place off-axis, making DIII-D a highly suitable test vehicle for this process. The calculations show that the driven current is not very sensitive to the launched value of n{sub ?}, a result that can be understood from examination of the evolution of n{sub ?} as the waves propagate in the plasma. Because of this insensitivity, relatively large values (?3) of n{sub ?} can be launched, thereby avoiding some of the problems with mode conversion in the boundary found in some previous experiments. Use of a traveling wave antenna provides a very narrow n{sub ?} spectrum, which also helps avoid mode conversion.

Prater, R.; Pinsker, R. I.; Moeller, C. P. [General Atomics, PO Box 85608, San Diego, California 92186-5608 (United States); Porkolab, M.; Vdovin, V. [Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, Massachusetts 02139 (United States)

2014-02-12T23:59:59.000Z

219

Contour Charts of SOFAR Speed and Axis Depth in the Pacific Ocean  

Science Journals Connector (OSTI)

Sound speeds calculated from the physical properties of sea water as measured at hydrographic stations were used to construct contour charts of SOFAR?speed and SOFAR?axis depth for the Pacific Ocean. Wilson's formula was used for the calculation of speed. Data were averaged for 1° squares plotted and smooth contours were drawn manually. Speeds averaged along great?circle paths are compared with those measured for explosions. The charts show steep gradients along the Antarctic convergence and at the convergence of the Oyashio and Kuroshio extension. The region of highest speed as well as greatest axis depth was that extending eastward from Australia to about the 150°W. The charts are used in a program for calculating source coordinates of earthquakeT phases.

Rockne H. Johnson; Roger A. Norris

1967-01-01T23:59:59.000Z

220

Tracking formulas and strategies for a receiver oriented dual-axis tracking toroidal heliostat  

SciTech Connect

A 4 m x 4 m toroidal heliostat with receiver oriented dual-axis tracking, also called spinning-elevation tracking, was developed as an auxiliary heat source for a hydrogen production system. A series of spinning-elevation tracking formulas have been derived for this heliostat. This included basic tracking formulas, a formula for the elevation angle for heliostat with a mirror-pivot offset, and a more general formula for the biased elevation angle. This paper presents the new tracking formulas in detail and analyzes the accuracy of applying a simplifying approximation. The numerical results show these receiver oriented dual-axis tracking formula approximations are accurate to within 2.5 x 10{sup -6} m in image plane. Some practical tracking strategies are discussed briefly. Solar images from the toroidal heliostat at selected times are also presented. (author)

Guo, Minghuan; Wang, Zhifeng; Liang, Wenfeng; Zhang, Xiliang; Zang, Chuncheng [Key Laboratory of Solar Thermal Energy and Photovoltaic System of Chinese Academy of Sciences, Institute of Electrical Engineering, Beijing 100190 (China); Lu, Zhenwu; Wei, Xiudong [Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences (CAS), Jilin 130033 (China)

2010-06-15T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Floating axis wind turbines for offshore power generation—a conceptual study  

Science Journals Connector (OSTI)

The cost of energy produced by offshore wind turbines is considered to be higher than land based ones because of the difficulties in construction, operation and maintenance on offshore sites. To solve the problem, we propose a concept of a wind turbine that is specially designed for an offshore environment. In the proposed concept, a floater of revolutionary shape supports the load of the wind turbine axis. The floater rotates with the turbine and the turbine axis tilts to balance the turbine thrust, buoyancy and gravity. The tilt angle is passively adjustable to wind force. The angle is 30° at rated power. The simplicity of the system leads to further cost reduction of offshore power generation.

Hiromichi Akimoto; Kenji Tanaka; Kiyoshi Uzawa

2011-01-01T23:59:59.000Z

222

The experimental and theoretical investigaton of a horizontal-axis wind turbine  

E-Print Network (OSTI)

. Chevalier An experimental and theoretical investigation of a horizontal-axis wind energy conversion device utilizing straight blades as the force- producing surfaces was conducted. The blades were mounted horizontally between two rotating discs and were... positioned with a mechanical cern system to produce the maximum torque at every point around the revolution. The wind turbine was tested in a 7 x 10 ft low speed wind tunnel. The device converted over 20 percent of the energy available in the wind...

Milburn, Robert Terrance

2012-06-07T23:59:59.000Z

223

Method and apparatus for maintaining equilibrium in a helical axis stellarator  

DOE Patents (OSTI)

Apparatus for maintaining three-dimensional MHD equilibrium in a plasma contained in a helical axis stellarator includes a resonant coil system, having a configuration such that current therethrough generates a magnetic field cancelling the resonant magnetic field produced by currents driven by the plasma pressure on any given flux surface resonating with the rotational transform of another flux surface in the plasma. Current through the resonant coil system is adjusted as a function of plasma beta.

Reiman, A.; Boozer, A.

1984-10-31T23:59:59.000Z

224

Method and apparatus for maintaining equilibrium in a helical axis stellarator  

DOE Patents (OSTI)

Apparatus for maintaining three-dimensional MHD equilibrium in a plasma contained in a helical axis stellerator includes a resonant coil system, having a configuration such that current therethrough generates a magnetic field cancelling the resonant magnetic field produced by currents driven by the plasma pressure on any given flux surface resonating with the rotational transform of another flux surface in the plasma. Current through the resonant coil system is adjusted as a function of plasma beta.

Reiman, Allan (Princeton, NJ); Boozer, Allen (Rocky Hill, NJ)

1987-01-01T23:59:59.000Z

225

An operational analysis of protected-permitted lead-lag left-turn phasing  

E-Print Network (OSTI)

Chair of Advisory Committee: Dr. Daniel B. Fambro This thesis documents an operational analysis of a special type of protected- permitted lead-lag left-turn phasing sequence developed and used by traffic engineers in Dallas, Texas. This phasing, known... as the Dallas phasing, does not follow existing standards for left-turn phasing set forth in the Manual for Uniform Trajfic Control Devices (MUTCD). The objective of this research was to determine whether existing left-turn models can be used to analyze...

Gaston, Gilmer D

2012-06-07T23:59:59.000Z

226

Inversion of azimuthally dependent NMO velocity in transversely isotropic media with a tilted axis of symmetry  

SciTech Connect

Just as the transversely isotropic model with a vertical symmetry axis (VTI media) is typical for describing horizontally layered sediments, transverse isotropy with a tilted symmetry axis (TTI) describes dipping TI layers (such as tilted shale beds near salt domes) or crack systems. P-wave kinematic signatures in TTI media are controlled by the velocity V{sub PO} in the symmetry direction, Thomsen's anisotropic coefficients {xi} and {delta}, and the orientation (tilt {nu} and azimuth {beta}) of the symmetry axis. Here, the authors show that all five parameters can be obtained from azimuthally varying P-wave NMO velocities measured for two reflectors with different dips and/or azimuths (one of the reflectors can be horizontal). The shear-wave velocity V{sub SO} in the symmetry direction, which has negligible influence on P-wave kinematic signatures, can be found only from the moveout of shear waves. Using the exact NMO equation, the authors examine the propagation of errors in observed moveout velocities into estimated values of the anisotropic parameters and establish the necessary conditions for a stable inversion procedure. Since the azimuthal variation of the NMO velocity is elliptical, each reflection event provides them with up to three constraints on the model parameters. Generally, the five parameters responsible for P-wave velocity can be obtained from two P-wave ellipses, but the feasibility of the moveout inversion strongly depends on the tilt {nu}. While most of the analysis is carried out for a single layer, the authors also extend the inversion algorithm to vertically heterogeneous TTI media above a dipping reflector using the generalized Dix equation. A synthetic example for a strongly anisotropic, stratified TTI medium demonstrates a high accuracy of the inversion.

Grechka, V.; Tsvankin, I.

2000-02-01T23:59:59.000Z

227

DNA Synthetic Activity of Right and Left Ventricular Biopsy Specimens in Patients with Cardiomyopathy  

Science Journals Connector (OSTI)

This investigation was designed to evaluate the difference in DNA activity between biopsy specimens obtained from right and left ventricles. Nucleic DNA in the myocardial cells of hypertrophied and congestive ...

Y. Yabe; H. Abe; Y. Kashiwakura

1983-01-01T23:59:59.000Z

228

Left invertibility, flatness and identifiability of switched linear dynamical systems: a framework  

E-Print Network (OSTI)

Left invertibility, flatness and identifiability of switched linear dynamical systems: a framework invertibility and flatness, dynamical systems are structurally equivalent to some specific cryptographic invertibility, flatness and identifiability of discrete- time switched linear systems are investigated

Paris-Sud XI, Université de

229

This page intentionally left blank. California Solar Initiative, CPUC Staff Progress Report, April 2008 2  

E-Print Network (OSTI)

.15 California Solar Initiative Supported Strong Statewide Grid-Installed Capacity Progress in 2007#12;This page intentionally left blank. California Solar Initiative, CPUC Staff Progress Report................................................................................................................ 5 2. Go Solar California! Overview

230

Guidelines for left-turn bays at unsignalized access locations on arterial roadways  

E-Print Network (OSTI)

It has long been recognized that effective access management along arterial streets can alleviate traffic congestion. A major goal within access management is to limit the speed differential between turning and through vehicles. Left-turn bays...

Hawley, Patrick Emmett

2012-06-07T23:59:59.000Z

231

E-Print Network 3.0 - acute left ventricular Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

ajpheart.00805.2010 299:H2069-H2075, 2010. First published 8 October 2010;Am J Physiol Heart Circ Physiol Summary: technologies have been used to quantify left ventricular...

232

E-Print Network 3.0 - anomalous left coronary Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

angio-CT images is presented in this paper. Each voxel in the 3D... of the volumetric data with subvoxel accuracy. The geometric model of the left coronary arteries obtained... ....

233

Impact of left atrial appendage ridge ablation on the complex fractionated electrograms in persistent atrial fibrillation  

Science Journals Connector (OSTI)

High-density left atrial mapping identified continuous CFE sites in 50 % and high-DFs ... ablation, LAA ablation significantly increased the mean CFE cycle length from 98?±?29 to...P?

Shiro Nakahara; Yuichi Hori; Akiko Hayashi…

2014-10-01T23:59:59.000Z

234

Measurement of the rotational transform at the axis of a tokamak  

Science Journals Connector (OSTI)

Measurements of the internal magnetic field structure of Texas Experimental Tokamak discharges are made by use of laser-induced fluorescence of an injected Li0 beam. From measurements near the magnetic axis, we obtain the axial safety factor, q0 (or equivalently the rotational transform, ?=2?/q) for various discharge conditions. In particular, for low-qa sawtoothing discharges, we find time-averaged values of q0 significantly less than 1 (?0.7 to 0.8), in contrast with models used to describe the nonlinear internal relaxation process commonly known as sawteeth.

W. P. West; D. M. Thomas; J. S. deGrassie; S. B. Zheng

1987-06-29T23:59:59.000Z

235

A Large Liquid Argon TPC for Off-axis NuMI Neutrino Physics  

SciTech Connect

The ICARUS collaboration has shown the power of the liquid argon time projection chamber (LArTPC) technique to image events with bubble-chamber-like quality. I will describe a proposed long-baseline {nu}e appearance experiment utilizing a large ({>=} 15 kton1) LArTPC placed off-axis of Fermilab's NuMI {nu}{mu} beam. The total LArTPC program as it presently stands, which includes a number of smaller R and D projects designed to examine the key design issues, will be outlined.

Menary, Scott [York University, Toronto (Canada)

2006-07-11T23:59:59.000Z

236

Solutions for Neutral for Axi-Dilaton Gravity in 4-Dimensions  

E-Print Network (OSTI)

We examine a 1 parameter class of actions describing the gravitational interaction between a pair of scalar fields and Einsteinian gravitation. When the parameter is positive the theory corresponds to an axi-dilatonic sector of low energy string theory. We exploit an SL(2,R) symmetry of the theory to construct a family of electromagnetically neutral solutions with non-zero axion and dilaton charge from solutions of the Brans-Dicke theory. We also comment on solutions to the theory with negative coupling parameter.

T Dereli; M Onder; Robin W Tucker

1995-02-08T23:59:59.000Z

237

Seismic reflection images of a near-axis melt sill within the lower crust at the Juan de Fuca ridge  

Science Journals Connector (OSTI)

... -axis seamounts with chemistry distinct from the axial lavas (Fig. 4a). Observations by submersible vehicles have also reported the presence of low-temperature hydrothermal venting ?3.3?km ... ratio is 0.25. Reflection coefficients

J. Pablo Canales; Mladen R. Nedimovi?; Graham M. Kent; Suzanne M. Carbotte; Robert S. Detrick

2009-07-02T23:59:59.000Z

238

Environmental and Performance Analysis of a 5kW Horizontal Axis Wind Turbine in East Central Alberta.  

E-Print Network (OSTI)

??This thesis investigates the environmental and performance results of a 5kW horizontal axis wind turbine installed in east-central Alberta. Life cycle assessment (LCA) methodology was… (more)

Rooke, Braden

2012-01-01T23:59:59.000Z

239

Multi-axis compliant mechanism-based nanopositioner for multi-mode mechanical testing of carbon nanotubes  

E-Print Network (OSTI)

This thesis documents the design of a multi-axis nanopositioner that addresses a need for carbon nanotube (CNT) instrumentation that is capable of multiple modes of mechanical testing. This nanopositioner is a solution to ...

Lin, Kevin, S.M. Massachusetts Institute of Technology

2006-01-01T23:59:59.000Z

240

Dynamics of a horizontal cylinder oscillating as a wave energy converter about an off-centred axis  

E-Print Network (OSTI)

The hydrodynamic properties of a horizontal cylinder which is free to pitch about an off-centred axis are studied and used to derive the equations of motion of a wave energy converter which extracts energy from incoming ...

Lucas, Jorge

2011-11-22T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Simultaneous two-axis vibration measurement of a nonmetallic cylinder by electromagnetic induction and metallic foil loops  

Science Journals Connector (OSTI)

This work presents a method based on electromagnetic induction for the simultaneous non-contact measurement of two-axis lateral vibrations of a nonmetallic cylinder. The suggested method ... pair of loop is induc...

Soon Woo Han; Jin Ki Kim; Yoon Young Kim

2011-08-01T23:59:59.000Z

242

Feed rate calculation algorithm for the homogeneous material deposition of blisk blades by 5-axis laser cladding  

Science Journals Connector (OSTI)

The application of laser cladding technology is becoming widely extended in the ... parts. These complex parts require 5-axis laser cladding deposition processes whose programming demands optimized and ... homoge...

Amaia Calleja; Iván Tabernero…

2014-10-01T23:59:59.000Z

243

A six-axis robotic sample changer for high-throughput neutron powder diffraction and texture measurements  

Science Journals Connector (OSTI)

A new six-axis robotic sample changer for neutron powder diffraction experiments, including texture measurements, has enabled a novel set of experiments to be performed at the High-Pressure Preferred Orientation diffractometer at the Lujan Neutron Scattering Center.

Losko, A.S.

2014-11-18T23:59:59.000Z

244

Latitudinal gradients of coniferous tree species, vegetation, and climate in the Sierran-Cascade axis of Northern California  

Science Journals Connector (OSTI)

Latitudinal gradients of tree species composition along the Sierran/Cascade axis in northern California were explored by comparing forests of Lassen Volcanic and Yosemite National Parks, USA. A calibration pro...

Albert J. Parker

1994-12-01T23:59:59.000Z

245

The influence of the nonverticality of the azimuthal rotation axis of the concentrator (heliostat) on program tracking accuracy  

Science Journals Connector (OSTI)

It is shown that the nonverticality of the azimuthal axis has a significant influence on the accuracy of the program control of the concentrator (heliostat). To eliminate this error, it is...

A. A. Abdurakhmanov; S. A. Orlov; A. S. Saribaev; Kh. K. Fazilov

2010-12-01T23:59:59.000Z

246

Three-dimensional Numerical Analysis on Blade Response of Vertical Axis Tidal Current Turbine Under Operational Condition  

SciTech Connect

Tidal power as a large-scale renewable source of energy has been receiving significant attention recently because of its advantages over the wind and other renewal energy sources. The technology used to harvest energy from tidal current is called a tidal current turbine. Though some of the principles of wind turbine design are applicable to tidal current turbines, the design of latter ones need additional considerations like cavitation damage, corrosion etc. for the long-term reliability of such turbines. Depending up on the orientation of axis, tidal current turbines can be classified as vertical axis turbines or horizontal axis turbines. Existing studies on the vertical axis tidal current turbine focus more on the hydrodynamic aspects of the turbine rather than the structural aspects. This paper summarizes our recent efforts to study the integrated hydrodynamic and structural aspects of the vertical axis tidal current turbines. After reviewing existing methods in modeling tidal current turbines, we developed a hybrid approach that combines discrete vortex method -finite element method that can simulate the integrated hydrodynamic and structural response of a vertical axis turbine. This hybrid method was initially employed to analyze a typical three-blade vertical axis turbine. The power coefficient was used to evaluate the hydrodynamic performance, and critical deflection was considered to evaluate the structural reliability. A sensitivity analysis was also conducted with various turbine height-to-radius ratios. The results indicate that both the power output and failure probability increase with the turbine height, suggesting a necessity for optimal design. An attempt to optimize a 3-blade vertical axis turbine design with hybrid method yielded a ratio of turbine height to radius (H/R) about 3.0 for reliable maximum power output.

Li, Ye; Karri, Naveen K.; Wang, Qi

2014-04-30T23:59:59.000Z

247

Medium-solidity Vertical Axis Wind Turbines for use in Urban Environments S. Tullis, A. Fiedler, K. McLaren, S. Ziada  

E-Print Network (OSTI)

Medium-solidity Vertical Axis Wind Turbines for use in Urban Environments S. Tullis, A. Fiedler, K Vertical axis wind turbines are currently experiencing a renewed interest in small- scale applications: vertical axis wind turbines, vibration, blade aerodynamics #12;Introduction In community wind power

Tullis, Stephen

248

A generalized on-line estimation and control of five-axis contouring errors of CNC machine tools  

Science Journals Connector (OSTI)

Abstract Nonlinear and configuration-dependent five-axis kinematics make contouring errors difficult to estimate and control in real time. This paper proposes a generalized method for the on-line estimation and control of five-axis contouring errors. First, a generalized Jacobian function is derived based on screw theory in order to synchronize the motions of linear and rotary drives. The contouring error components contributed by all active drives are estimated through interpolated position commands and the generalized Jacobian function. The estimated axis components of contouring errors are fed back to the position commands of each closed loop servo drive with a proportional gain. The proposed contouring error estimation and control methods are general, and applicable to arbitrary five-axis tool paths and any kinematically admissible five-axis machine tools. The proposed algorithms are verified experimentally on a five-axis machine controlled by a modular research CNC system built in-house. The contouring errors are shown to be reduced by half with the proposed method, which is simple to implement in existing CNC systems.

Jixiang Yang; Yusuf Altintas

2015-01-01T23:59:59.000Z

249

Simulation of winds as seen by a rotating vertical axis wind turbine blade  

SciTech Connect

The objective of this report is to provide turbulent wind analyses relevant to the design and testing of Vertical Axis Wind Turbines (VAWT). A technique was developed for utilizing high-speed turbulence wind data from a line of seven anemometers at a single level to simulate the wind seen by a rotating VAWT blade. Twelve data cases, representing a range of wind speeds and stability classes, were selected from the large volume of data available from the Clayton, New Mexico, Vertical Plane Array (VPA) project. Simulations were run of the rotationally sampled wind speed relative to the earth, as well as the tangential and radial wind speeds, which are relative to the rotating wind turbine blade. Spectral analysis is used to compare and assess wind simulations from the different wind regimes, as well as from alternate wind measurement techniques. The variance in the wind speed at frequencies at or above the blade rotation rate is computed for all cases, and is used to quantitatively compare the VAWT simulations with Horizontal Axis Wind Turbine (HAWT) simulations. Qualitative comparisons are also made with direct wind measurements from a VAWT blade.

George, R.L.

1984-02-01T23:59:59.000Z

250

String dynamics and ejection along the axis of a spinning black hole  

Science Journals Connector (OSTI)

Relativistic current carrying strings moving axisymmetrically on the background of a Kerr black hole are studied. The boundaries and possible types of motion of a string with a given energy and current are found. Regions of parameters for which the string falls into the black hole, is trapped in a toroidal volume, or can escape to infinity, are identified, and representative trajectories are examined by numerical integration, illustrating various interesting behaviors. In particular, we find that a string can start out at rest near the equatorial plane and, after bouncing around, be ejected out along the axis, some of its internal (elastic or rotational kinetic) energy having been transformed into translational kinetic energy. The resulting velocity can be an order unity fraction of the speed of light. This process results from the presence of an outer tension barrier and an inner angular momentum barrier that are deformed by the gravitational field. We speculatively discuss the possible astrophysical significance of this mechanism as a means of launching a collimated jet of magnetohydrodynamics plasma flux tubes along the spin axis of a gravitating system fed by an accretion disk.

Ted Jacobson and Thomas P. Sotiriou

2009-03-26T23:59:59.000Z

251

Eucentric four-axis ultrahigh vacuum goniometer for reflection high-energy electron diffraction applications  

SciTech Connect

The design and performance of a four-axis low-profile eucentric UHV goniometer for in situ reflection high-energy electron diffraction (RHEED) studies during film deposition is reported. The design provides one translational and three rotational degrees of freedom that are fully independent. Although developed to facilitate high-pressure RHEED during the growth of oxide thin films by pulsed laser deposition, this goniometer design is applicable to other UHV techniques including molecular beam epitaxy. The goniometer requires only a single DN 100 CF flange (6 in. o.d., 100 mm i.d.), making it suitable for small deposition systems, too. Samples, attached to a resistively heated holder, can be easily transferred on and off of the goniometer without breaking vacuum. The holder accommodates samples up to 10 mmx10 mm in size and allows them to be heated to 900 deg. C in pure oxygen while being attached to the goniometer. Full eucentric motion of the hot sample is possible with a typical axis precision of <0.1 deg. Most of the mechanism is located in air, allowing the use of standard materials and lubricants, substantially reducing the in-vacuum mechanics, and increasing the precision, reliability, and robustness of the system.

Schmehl, A.; Schulz, R.R.; Mannhart, J. [Experimentalphysik VI, Elektronische Korrelationen und Magnetismus, Institut fuer Physik, Universitaet Augsburg, Universitaetsstrasse 1, D-86135 Augsburg (Germany)

2005-12-15T23:59:59.000Z

252

Offshore floating vertical axis wind turbines, dynamics modelling state of the art. part I: Aerodynamics  

Science Journals Connector (OSTI)

Abstract The need to further exploit offshore wind resources has pushed offshore wind farms into deeper waters, requiring the use of floating support structures to be economically sustainable. The use of conventional wind turbines may not continue to be the optimal design for floating applications. Therefore it is important to assess other alternative concepts in this context. Vertical axis wind turbines (VAWTs) are one promising concept, and it is important to first understand the coupled and relatively complex dynamics of floating \\{VAWTs\\} to assess their technical feasibility. A comprehensive review detailing the areas of engineering expertise utilised in developing an understanding of the coupled dynamics of floating \\{VAWTs\\} has been developed through a series of articles. This first article details the aerodynamic modelling of VAWTs, providing a review of available models, discussing their applicability to floating \\{VAWTs\\} and current implementations by researchers in this field. A concise comparison between conventional horizontal axis wind turbines and \\{VAWTs\\} is also presented, outlining the advantages and disadvantages of these technologies for the floating wind industry. This article has been written both for researchers new to this research area, outlining underlying theory whilst providing a comprehensive review of the latest work, and for experts in this area, providing a comprehensive list of the relevant references where the details of modelling approaches may be found.

Michael Borg; Andrew Shires; Maurizio Collu

2014-01-01T23:59:59.000Z

253

On-Axis Brilliance and Power of In-Vacuum Undulators for The Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

4 4 On-Axis Brilliance and Power of In-Vacuum Undulators for the Advanced Photon Source (formerly MD-TN-2009-004) R. Dejus, M. Jaski, and S.H. Kim - MD Group/ASD Rev. 1, November 25, 2009: Updated the fitted B eff in Tables 1 - 3, and 5 to use two decimals in the fitted equation. Explained chosen gaps. Added clarifications in the text and added additional references. Edited by C. Eyberger for release as cleared document ANL/APS/LS-314; updated in ICMS. Rev. 0a, June 17, 2009: ICMS Initial Release (minor clarifications and corrections of typographical errors, added footnote "d" to Table 4). Rev. 0, June 16, 2009: First Release as Technical Note MD-TN-2009-004. Table of Contents Introduction ......................................................................................................................... 2

254

Combined Experiment Phase 1. [Horizontal axis wind turbines: wind tunnel testing versus field testing  

SciTech Connect

How does wind tunnel airfoil data differ from the airfoil performance on an operating horizontal axis wind turbine (HAWT) The National Renewable Energy laboratory has been conducting a comprehensive test program focused on answering this question and understanding the basic fluid mechanics of rotating HAWT stall aerodynamics. The basic approach was to instrument a wind rotor, using an airfoil that was well documented by wind tunnel tests, and measure operating pressure distributions on the rotating blade. Based an the integrated values of the pressure data, airfoil performance coefficients were obtained, and comparisons were made between the rotating data and the wind tunnel data. Care was taken to the aerodynamic and geometric differences between the rotating and the wind tunnel models. This is the first of two reports describing the Combined Experiment Program and its results. This Phase I report covers background information such as test setup and instrumentation. It also includes wind tunnel test results and roughness testing.

Butterfield, C.P.; Musial, W.P.; Simms, D.A.

1992-10-01T23:59:59.000Z

255

The determination of stochastic loads on horizontal axis wind turbine blades  

SciTech Connect

The FAST Code which is capable of determining structural loads of a flexible, teetering, horizontal axis wind turbine is described and comparisons of calculated loads with test data are given at two wind speeds for the ESI-80. The FAST Code models a two-bladed HAWT with degrees-of-freedom for blade bending, teeter, drive train flexibility, yaw, and windwise and crosswind tower motion. The code allows blade dimensions, stiffnesses, and weights to differ and the code models tower shadow, wind shear, and turbulence. Additionally, dynamic stall is included as are delta-3 and an underslung rotor. Load comparisons are made with ESI-80 test data in the form of power spectral density, rainflow counting occurrence histograms, and azimuth averaged bin plots. It is concluded that agreement between the FAST Code and test results is good.

Freeman, L.N.; Wilson, R.E. [Oregon State Univ., Corvallis, OR (United States). Dept. of Mechanical Engineering

1998-05-01T23:59:59.000Z

256

Design of a Thermal Imaging Diagnostic Using 90-Degree, Off-Axis, Parabolic Mirrors  

SciTech Connect

Thermal imaging is an important, though challenging, diagnostic for shockwave experiments. Shock-compressed materials undergo transient temperature changes that cannot be recorded with standard (greater than ms response time) infrared detectors. A further complication arises when optical elements near the experiment are destroyed. We have designed a thermal-imaging system for studying shock temperatures produced inside a gas gun at Sandia National Laboratories. Inexpensive, diamond-turned, parabolic mirrors relay an image of the shocked target to the exterior of the gas gun chamber through a sapphire vacuum port. The 3000–5000-nm portion of this image is directed to an infrared camera which acquires a snapshot of the target with a minimum exposure time of 150 ns. A special mask is inserted at the last intermediate image plane, to provide dynamic thermal background recording during the event. Other wavelength bands of this image are split into high-speed detectors operating at 900–1700 nm, and at 1700–3000 nm for timeresolved pyrometry measurements. This system incorporates 90-degree, off-axis parabolic mirrors, which can collect low f/# light over a broad spectral range, for high-speed imaging. Matched mirror pairs must be used so that aberrations cancel. To eliminate image plane tilt, proper tip-to-tip orientation of the parabolic mirrors is required. If one parabolic mirror is rotated 180 degrees about the optical axis connecting the pair of parabolic mirrors, the resulting image is tilted by 60 degrees. Different focal-length mirrors cannot be used to magnify the image without substantially sacrificing image quality. This paper analyzes performance and aberrations of this imaging diagnostic.

Malone, Robert M.; Becker, Steven A.; Dolan, Daniel H.; Hacking, Richard G.; Hickman, Randy J.; Kaufman, Morris I.; Stevens, Gerald D.; Turley, William D.

2006-09-01T23:59:59.000Z

257

Electron cyclotron resonance near the axis of the gas-dynamic trap  

SciTech Connect

Propagation of an extraordinary electromagnetic wave in the vicinity of electron cyclotron resonance surface in an open linear trap is studied analytically, taking into account inhomogeneity of the magnetic field in paraxial approximation. Ray trajectories are derived from a reduced dispersion equation that makes it possible to avoid the difficulty associated with a transition from large propagation angles to the case of strictly longitudinal propagation. Our approach is based on the theory, originally developed by Zvonkov and Timofeev [Sov. J. Plasma Phys. 14, 743 (1988)], who used the paraxial approximation for the magnetic field strength, but did not consider the slope of the magnetic field lines, which led to considerable error, as has been recently noted by Gospodchikov and Smolyakova [Plasma Phys. Rep. 37, 768-774 (2011)]. We have found ray trajectories in analytic form and demonstrated that the inhomogeneity of both the magnetic field strength and the field direction can qualitatively change the picture of wave propagation and significantly affect the efficiency of electron cyclotron heating of a plasma in a linear magnetic trap. Analysis of the ray trajectories has revealed a criterion for the resonance point on the axis of the trap to be an attractor for the ray trajectories. It is also shown that a family of ray trajectories can still reach the resonance point on the axis if the latter generally repels the ray trajectories. As an example, results of general theory are applied to the electron cyclotron resonance heating experiment which is under preparation on the gas dynamic trap in the Budker Institute of Nuclear Physics [Shalashov et al., Phys. Plasmas 19, 052503 (2012)].

Bagulov, D. S. [Novosibirsk State University, Pirogova Street 2, Novosibirsk (Russian Federation); Kotelnikov, I. A. [Novosibirsk State University, Pirogova Street 2, Novosibirsk (Russian Federation); Budker Institute of Nuclear Physics of the Siberian Branch of the Russian Academy of Sciences, Akademika Lavrentyeva Prospect 11, 630090 Novosibirsk (Russian Federation)

2012-08-15T23:59:59.000Z

258

Turkey Hill Dairy: Where Energy is Not Left Flapping in the Wind |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Turkey Hill Dairy: Where Energy is Not Left Flapping in the Wind Turkey Hill Dairy: Where Energy is Not Left Flapping in the Wind Turkey Hill Dairy: Where Energy is Not Left Flapping in the Wind December 21, 2011 - 11:26am Addthis These two General Electric wind turbines, erected in January 2011 on the Frey Farm landfill adjacent to Turkey Hill Dairy's ice cream and sweet iced tea plant in Lancaster County, Penn., are expected to produce 7.5 million kWh of electricity annually. | Photo courtesy of Lancaster County Solid Waste Management Authority. These two General Electric wind turbines, erected in January 2011 on the Frey Farm landfill adjacent to Turkey Hill Dairy's ice cream and sweet iced tea plant in Lancaster County, Penn., are expected to produce 7.5 million kWh of electricity annually. | Photo courtesy of Lancaster County Solid

259

The signing of the 19th Meeting Record. Seated are Alexandre Jakovsky, left, of  

NLE Websites -- All DOE Office Websites (Extended Search)

signing of the 19th Meeting Record. Seated are Alexandre Jakovsky, left, of the Russian Federation signing of the 19th Meeting Record. Seated are Alexandre Jakovsky, left, of the Russian Federation Ministry of Atomic Energy, and John O'Fallon, of the U.S. Department of Energy. Behind them are Fermilab Director John Peoples (far left), U.S. and Russian delegates and Fermilab Directorate staff. Photos by Reidar Hahn by Leila Belkora, Office of Public Affairs When Russian delegates to the Joint Coordinating Committee for Research on the Fundamental Properties of Matter came to Fermilab November 13 and 14 to discuss U.S.- Russian collaboration on high-energy physics research, they had every reason to feel at home. The first high-energy physics experiment ever carried out at Fermilab was a joint Soviet-U.S. collaboration that began taking data "as soon as

260

Determining the neutrino mass hierarchy and CP violation in NoVA with a second off-axis detector  

SciTech Connect

We consider a Super-NOVA-like experimental configuration based on the use of two detectors in a long-baseline experiment as NOVA. We take the far detector as in the present NOVA proposal and add a second detector at a shorter baseline. The location of the second off-axis detector is chosen such that the ratio L/E is the same for both detectors, being L the baseline and E the neutrino energy. We consider liquid argon and water- Cerenkov techniques for the second off-axis detector and study, for different experimental setups, the detector mass required for the determination of the neutrino mass hierarchy, for different values of {theta}{sub 13}. We also study the capabilities of such an experimental setup for determining CP-violation in the neutrino sector. Our results show that by adding a second off-axis detector a remarkable enhancement on the capabilities of the current NOVA experiment could be achieved.

Mena, Olga; /Fermilab; Palomares-Ruiz, Sergio; /Vanderbilt U.; Pascoli, Silvia; /CERN /Durham U., IPPP

2005-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Speculation and Return Volatility: Evidence from the WTI Crude Oil Market.  

E-Print Network (OSTI)

??Based on the data of the Commitments of Traders reports from 2000 to 2013, this paper investigates the impact of speculative futures trading on the… (more)

Wang, Rui

2013-01-01T23:59:59.000Z

262

Explaining the convenience yield in the WTI crude oil market using realized volatility and jumps  

Science Journals Connector (OSTI)

Abstract In this paper, we first provide an empirical evidence of the existence of intraday jumps in the crude oil price series. We then show that these jumps, in conjunction with realized volatility measures, are important in modeling the convenience yield over the 2001–2010 period. Our empirical results indicate that lagged jump mean only explains around 16% of the weekly convenience yield. Our best specification, including variation in inventories, 8-week realized variance and the 250-day jump mean is able to explain around 61% of the weekly convenience yield. Importantly, our results are not driven by the simultaneous determination of the various variables at work as we only use lagged variables in all regressions.

Benoît Sévi

2015-01-01T23:59:59.000Z

263

The role of trader positions in spot and futures prices for WTI  

Science Journals Connector (OSTI)

Abstract We extend the analysis of causal relations between trader positions and oil prices and the process of price discovery by estimating a cointegrating vector autoregression (CVAR) model that expands the cash-and-carry relation between spot and futures prices to quantify long- and short-run relations among oil prices, trader positions, interest rates, and oil inventories. Results indicate that oil inventories and trader positions are needed to generate cointegration between spot and futures prices. The presence of trader positions and oil inventories suggest that both play a role in price discovery. Furthermore, the cointegrating relation for price loads into the equation for both oil prices and trader positions. This suggests a bi-directional simultaneous adjustment process between oil prices and trader positions. This expands the unidirectional causal relation from oil prices to trader positions that is generated by previous studies. Additional results suggest that price discovery occurs in the market for heavily traded near-month futures contracts, but discovery for thin far-month futures markets occurs in the spot market. Together, these results suggest mechanisms by which speculation could affect oil prices but the results presented here are moot regarding their effects.

Marek Kolodziej; Robert K. Kaufmann

2013-01-01T23:59:59.000Z

264

Single Higgs boson production at the ILC in the left-right twin Higgs model  

E-Print Network (OSTI)

In this work, we analyse three dominant single SM-like Higgs boson production processes in the left-right twin Higgs model (LRTHM): the Higgs-strahlung (HS) process $e^{+}e^{-}\\rightarrow Zh$, the vector boson fusion (VBF) process $e^{+}e^{-}\\rightarrow \

Liu, Yao-Bei

2014-01-01T23:59:59.000Z

265

Left–right asymmetry: cilia stir up new surprises in the node  

Science Journals Connector (OSTI)

...80197-5 ) 14 Supp, DM , DP Witte, SS Potter, and M Brueckner. 1997 Mutation of an axonemal dynein affects left-right...1038/40140 ( doi:10.1038/40140 ) 15 Supp, DM , M Brueckner, MR Kuehn, DP Witte, LA Lowe, J McGrath, J Corrales...

2013-01-01T23:59:59.000Z

266

Fluid-dynamical basis of the embryonic development of left-right asymmetry in vertebrates  

Science Journals Connector (OSTI)

...tracers (submicrometer-sized spherical particles) are introduced into the nodal fluid above...always laminar flow, and the complex particle paths observed in low-Reynolds-number...as Wolfgang Pauli famously put it, God is weakly left-handed (3). But...

Julyan H. E. Cartwright; Oreste Piro; Idan Tuval

2004-01-01T23:59:59.000Z

267

Middle East, revolt and its reactions Syria divides the Arab left  

E-Print Network (OSTI)

. Yet unlike Egypt and Tunisia, the Syrian revolt has not had unanimous support from the Arab left. There is a split between those who sympathise with the protestors' demands and those who fear foreign interference daily, Al-Akhbar, went through its first crisis since its launch in the summer of 2006 (1). Managing

Paris-Sud XI, Université de

268

Doppler effects in a left-handed material: a first-principle theoretical study  

E-Print Network (OSTI)

The Doppler effects for the reflected wave from a moving media are systemically analyzed in this paper. The theoretical formula for the Doppler shift in the left-handed material, which is described by Drude's dispersion model, is presented. This formula is examined by first-principles numerical experiments, which are in agreement with the theoretical results.

Sanshui Xiao; Min Qiu

2004-11-16T23:59:59.000Z

269

Misplacement of the Left Foot ECG Electrode Detected by Artificial Neural Networks  

E-Print Network (OSTI)

Misplacement of the Left Foot ECG Electrode Detected by Artificial Neural Networks B HedCn', M to be of value in pattern recognition tasks e.g. classiJcation of electrocardiograms (ECGs). Electrocardiographic lead reversals are often overlooked by ECG readers, and may cause incorrectECG interpretation

Ohlsson, Mattias

270

Radiological Habits Survey: Torness, 2006 This page has been intentionally left blank  

E-Print Network (OSTI)

intentionally left blank #12;3 SUMMARY 5 1. INTRODUCTION 6 1.1 Regulation of radioactive waste discharges 6 1 vegetables in the Torness area (kg/y) Table 20. Adults' consumption rates of potato in the Torness area (kg

271

Direct synthesis and easy axis alignment of L1{sub 0}-FePt nanoparticles  

SciTech Connect

Partially ordered Fe{sub 53}Pt{sub 47} nanoparticles with size around 8 nm were prepared by the simultaneous decomposition of iron pentacarbonyl and platinum acetylacetonate. The high boiling point chemical, hexadecylamine, was used as a solvent, and 1-adamantanecarboxylic acid was used as a stabilizer. The reflux temperature of the solution could exceed 360 deg. C, where disordered FePt particles could be partially transformed into the ordered L1{sub 0} phase. A nonmagnetic mechanical stirrer was used in order to avoid agglomeration of the fct-FePt particles during synthesis. The particles were dispersed in toluene and films of the particles were cast onto silicon wafers from the solution. X-ray diffraction patterns of as-made samples showed weak superlattice peaks, indicating partial chemical ordering of the Fe{sub 53}Pt{sub 47} particles. The room-temperature hysteresis loop of the as-made sample reveals a small coercivity ({approx}600 Oe) because of thermal fluctuations; however, the loop is wide open and hard to saturate. The remanence coercivity from the dcd curve is about 2.5 kOe, which is four times larger than the hysteresis coercivity. The large remanent to hysteresis coercivity ratio and the shapes of the hysteresis loop and dcd curve suggest a broad distribution of anisotropies in the partially ordered particles. By coating the ordered nanoparticles with a polymer binder, the easy axis of the particles could be aligned under an external field.

Kang Shishou; Jia Zhiyong; Shi Shifan; Nikles, David E.; Harrell, J.W. [Center for Materials for Information Technology, University of Alabama, Tuscaloosa, Alabama 35487-0209 (United States)

2005-05-15T23:59:59.000Z

272

A study of the abundance distributions along the minor axis of the Galactic bulge  

Science Journals Connector (OSTI)

I report the preliminary results of a project in collaboration with R. Michael Rich (Columbia) where we derive heavy element abundances for hundreds of K?giants in seven windows of low extinction along or near the minor axis of the Galactic bulge. By using the recently?calibrated Washington photometric filter system the distribution function in [Fe/H] is determined for each field. Within 8° of the Galactic center (?1 kpc) our data are consistent with no gradient in the distribution of [Fe/H] which may hint to a dissipationless collapse and/or sufficient mixing during the star?forming epoch when Fe was produced in the bulge. The mean abundance over this region is between two and five times solar. The form of these distributions is well?fitted by the simple (closed box) model of chemical evolution where the bulge is self?enriched by processing its original gas content to completion. Beyond 8° from the Galactic center our data show that the mean of the abundance distributions drops precipitously. This is consistent with the notion that the inner bulge is chemically distinct from the halo. It may be possible to use kinematics to disentangle the two populations via a radial velocity survey.

Neil D. Tyson

1992-01-01T23:59:59.000Z

273

Thermodynamic study of c-axis-oriented epitaxial Pb(Zr,Ti)O3 thin films  

Science Journals Connector (OSTI)

Thermodynamic characteristics of single crystalline Pb(Zr0.52Ti0.48)O3 (PZT) were investigated using c-axis oriented PZT films. The PZT films were epitaxially grown on Pt/MgO substrate and dielectric and ferroelectric properties were measured as a function of one-dimensional stress. The stress dependence of dielectric and ferroelectric properties was examined on the basis of the Landau-Devonshire’s phenomenological theory and the free energy coefficients of single crystalline PZT films were obtained. The dielectric stiffness coefficients and electrostrictive coefficient of epitaxial PZT films were obtained to be ?1=-1.30×108 (m/F), ?11=3.07×108 (m5/C2F), ?111=-3.11×107 (m9/C2F), and Q12=-5.70×10-2 (m4/C2), which are different from the values derived from the analysis of polycrystalline PZT. The temperature dependence of dielectric constant of the PZT films showed clear Curie-Weiss law and the dielectric stiffness coefficient ?1 derived from this measurement was almost same value from the analysis of stress dependence of the dielectricity of the epitaxial PZT films.

Isaku Kanno; Yu Yokoyama; Hidetoshi Kotera; Kiyotaka Wasa

2004-02-12T23:59:59.000Z

274

Horizontal-axis wind-system rotor performance model comparison: a compendium  

SciTech Connect

This compendium consists of four reports, the purpose of which is to evaluate performance prediction methods for horizontal-axis wind turbines. The reports were prepared by four separate contractors. Oregon State University, AeroVironment, Inc., Aerospace Systems, Inc., and United Technologies Research Center (UTRC). Three of the four contractors used a blade-element/momentum analysis, while the fourth (UTRC) utilized a lifting line/prescribed wake analysis. These contractors were to apply their prediction methods to two rotors, that of the Enertech 1500 and that of the 1/3-scale UTRC 8 kW turbines. Results from the four prediction methods are compared with actual test data gathered via Controlled Velocity Testing (CVT), carried out by the Rocky Flats Wind Energy Research Center, operated by Rockwell International for the US Department of Energy. The conclusions of the four reports are reviewed in an introduction prepared by Rockwell International. For the Enertech 1500, rotor performance predictions closely agreed with CVT data. Yet, because of the lack of high tip speed ratio data, verification of the Glauert momentum theory was not possible. Predictions regarding the UTRC 1/3 scale 8 kW rotor did not agree well with test results. The reasons cited for the discrepancies center on inadequate airfoil section data and the varying blade pitch angles of the unique UTRC flexbeam rotor.

Not Available

1983-02-01T23:59:59.000Z

275

A numerical method for calculation of power output from ducted vertical axis hydro-current turbines  

Science Journals Connector (OSTI)

Abstract This paper investigates effects of ducting on power output from vertical axis hydro-current turbines. A numerical two-dimensional method based on the potential flow theory is developed for calculation of non-dimensional power output from these turbines. In this method, the blades are represented by vortex filaments. The vortex shedding from the blades is modeled by discrete vortices. A boundary element method is used to incorporate the duct shape which is represented by a series of panels with constant distributions of sources and doublets. The aerodynamic loading on the blades are calculated using a quasi-steady modeling. A time-marching scheme is used for implementation of the numerical method. The results of this method are compared with experimental results for a turbine model. A good correlation between the numerical and experimental results is obtained for tip speed ratios equal and higher than 2.25. However due to a lack of dynamic stall modeling, the numerical method is not able to predict power output accurately at lower tip speed ratios wherein effects of dynamic stall are significant. Both numerical and experimental results also showed that the power output from a turbine can increase significantly when it is enclosed within a well-designed duct. The maximum power output of the turbine model investigated in this paper showed a 74% increase when the turbine is operating within the duct relative to the case it is in free-stream conditions.

Mahmoud Alidadi; Sander Calisal

2014-01-01T23:59:59.000Z

276

Evaluation of servo, geometric and dynamic error sources on five axis high-speed machine tool  

E-Print Network (OSTI)

Many sources of errors exist in the manufacturing process of complex shapes. Some approximations occur at each step from the design geometry to the machined part. The aim of the paper is to present a method to evaluate the effect of high speed and high dynamic load on volumetric errors at the tool center point. The interpolator output signals and the machine encoder signals are recorded and compared to evaluate the contouring errors resulting from each axis follow-up error. The machine encoder signals are also compared to the actual tool center point position as recorded with a non-contact measuring instrument called CapBall to evaluate the total geometric errors. The novelty of the work lies in the method that is proposed to decompose the geometric errors in two categories: the quasi-static geometric errors independent from the speed of the trajectory and the dynamic geometric errors, dependent on the programmed feed rate and resulting from the machine structure deflection during the acceleration of its axes...

Andolfatto, Loïc; Mayer, René

2011-01-01T23:59:59.000Z

277

Darrieus vertical axis wind turbine for power generation I: Assessment of Darrieus VAWT configurations  

Science Journals Connector (OSTI)

Abstract This paper aims to assess the Darrieus vertical axis wind turbine (VAWT) configurations, including the drawbacks of each variation that hindered the development into large scale rotor. A comprehensive timeline is given as a lineage chart. The variations are assessed on the performance, components and operational reliability. In addition, current development and future prospects of Darrieus VAWT are presented. The Darrieus VAWT patented in France in 1925 and in the US in 1931 had two configurations: (i) curved blades and (ii) straight blades configurations. Curved blades configuration (egg-beater or phi-rotor) has evolved from the conventional guy-wires support into fixed-on-tower and cantilevered versions. Straight blades configuration used to have variable-geometry (Musgrove-rotor), variable-pitch (Giromill), Diamond, Delta and V/Y rotor variations. They were stopped due to low economical value, i.e. high specific cost of energy (COE). Musgrove-rotor has evolved into fixed-pitch straight-bladed H-rotor (referred as H-rotor in this paper for simplicity). H-rotor, in turn, has evolved into several variations: Articulating, Tilted and Helical H-rotors.

Willy Tjiu; Tjukup Marnoto; Sohif Mat; Mohd Hafidz Ruslan; Kamaruzzaman Sopian

2015-01-01T23:59:59.000Z

278

Experimental research on tidal current vertical axis turbine with variable-pitch blades  

Science Journals Connector (OSTI)

Abstract Due to the limited storage and ever-increasing dependence on fossil fuel, the world is in the phase of shifting toward renewable energy. Tidal current energy is one of the most predictable forms of renewable energy, which is harnessed by utilizing a tidal current turbine. To study the performance of the tidal current turbine relating to the ability of energy absorption and exchanging, experimental tests play an important role which can not only validate the numerical results but also provide a reference for the prototype design. In this study, a series of experiments related to vertical-axis turbines (VAT) were carried out at Harbin Engineering University and a large quantity of experimental data to study the hydrodynamic performance of turbines was presented. Based on the different techniques used to control the pitch mechanism, the experiments can be classified as the cycloid type controllable-pitch, spring-control pitch and passive variable-pitch VAT experiment. The influences of the different parameters on the hydrodynamic performance of turbines were discussed. Finally, some control strategies for the blade for different turbines were given.

Fengmei Jing; Qihu Sheng; Liang Zhang

2014-01-01T23:59:59.000Z

279

Applying micro scales of horizontal axis wind turbines for operation in low wind speed regions  

Science Journals Connector (OSTI)

Abstract Utilizing the micro scales of wind turbines could noticeably supply the demand for the electricity in low wind speed regions. Aerodynamic design and optimization of the blade, as a main part of a wind turbine, were addressed in the study. Three micro scales of horizontal axis wind turbines with output power of 0.5, 0.75 and 1 kW were considered and the geometric optimization of the blades in terms of the two involved parameters, chord and twist, was undertaken. In order to improve the performance of the turbines at low wind speeds, starting time was included in an objective function in addition to the output power – the main and desirable goal of the wind turbine blade design. A purpose-built genetic algorithm was employed to maximize both the output power and the starting performance which were calculated by the blade-element momentum theory. The results emphasize that the larger values of the chord and twist at the root part of the blades are indispensable for the better performance when the wind speed is low. However, the noticeable value of the generator resistive torque could largely delay the starting of the micro-turbines especially for the considered smaller size, 0.5 kW, where the starting aerodynamic torque could not overcome the generator resistive torque. For that size, an increase in the number of blades improved both the starting performance and also output power.

Abolfazl Pourrajabian; Reza Ebrahimi; Masoud Mirzaei

2014-01-01T23:59:59.000Z

280

Turbulence effects on the wake flow and power production of a horizontal-axis wind turbine  

Science Journals Connector (OSTI)

Abstract This study experimentally investigated the effects of ambient turbulence on the wake flows and power production of a horizontal-axis wind turbine. The approaching flows included low-turbulence smooth flow and grid-generated turbulent flow. The profiles of time-averaged velocity, turbulence intensity and Reynolds stress from the intermediate to the far-wake regions were measured and compared for smooth and turbulent flows. Based on the measured data, prediction models for the centerline velocity deficit, turbulence intensity, wake radius and velocity profile were proposed. In addition, the experimental results showed that the power productions in the grid-generated turbulent flows were slightly higher than that in the smooth flow. But the power loss due to the velocity deficit in the wake flow was larger than 50% when the downwind distance was less than 12D (D is the rotor diameter). An empirical relation between the power production and the downwind distance x and lateral distance y was proposed.

Chia-Ren Chu; Pei-Hung Chiang

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Potential order-of-magnitude enhancement of wind farm power density via counter-rotating vertical-axis wind  

E-Print Network (OSTI)

Potential order-of-magnitude enhancement of wind farm power density via counter-rotating vertical constraint limits the amount of power that can be extracted from a given wind farm footprint. The resulting-axis wind turbines (VAWTs) in order to achieve higher power output per unit land area than existing wind

Dabiri, John O.

282

Precision tool holder with flexure-adjustable, three degrees of freedom for a four-axis lathe  

DOE Patents (OSTI)

A precision tool holder for precisely positioning a single point cutting tool on 4-axis lathe, such that the center of the radius of the tool nose is aligned with the B-axis of the machine tool, so as to facilitate the machining of precision meso-scale components with complex three-dimensional shapes with sub-.mu.m accuracy on a four-axis lathe. The device is designed to fit on a commercial diamond turning machine and can adjust the cutting tool position in three orthogonal directions with sub-micrometer resolution. In particular, the tool holder adjusts the tool position using three flexure-based mechanisms, with two flexure mechanisms adjusting the lateral position of the tool to align the tool with the B-axis, and a third flexure mechanism adjusting the height of the tool. Preferably, the flexures are driven by manual micrometer adjusters. In this manner, this tool holder simplifies the process of setting a tool with sub-.mu.m accuracy, to substantially reduce the time required to set the tool.

Bono, Matthew J. (Pleasanton, CA); Hibbard, Robin L. (Livermore, CA)

2008-03-04T23:59:59.000Z

283

Possibility of c-axis voltage steps for a cuprate superconductor in a resonant cavity I. Tornes* and D. Stroud  

E-Print Network (OSTI)

, when driven by currents parallel to the c axis, behave like stacks of underdamped Josephson junctions's in stacks of artificial Josephson junctions. We conclude that such steps might be observable with a suitably, 74.25.Nf I. INTRODUCTION Barbara et al.1 have recently shown that underdamped Josephson-junction

Stroud, David

284

First Light of the 1.6 meter off-axis New Solar Telescope at Big Bear Solar Observatory  

E-Print Network (OSTI)

First Light of the 1.6 meter off-axis New Solar Telescope at Big Bear Solar Observatory Wenda Caoab, Nicolas Gorceixb, Roy Coulterb, Aaron Coulterb, Philip R. Goodeab aCenter for Solar-Terrestrial Research, New Jersey Institute of Technology, 323 Martin Luther King Blvd., Newark, NJ 07102; bBig Bear Solar

285

Thematic Week: The Role of Market Instruments in Integrated Water Management Thematic Axis: 7. Water Economics and Financing  

E-Print Network (OSTI)

Thematic Week: The Role of Market Instruments in Integrated Water Management Thematic Axis: 7. Water Economics and Financing Title: Beyond Water Marketing Myths Author: Griffin, Ronald C. Department://ron-griffin.tamu.edu, 979-845-7049. Summary: The challenge in isolating the opportunities and pitfalls of water marketing

Griffin, Ronald

286

ATCA/AXIe compatible board for fast control and data acquisition in nuclear fusion experiments  

Science Journals Connector (OSTI)

An in-house development of an Advanced Telecommunications Computing Architecture (ATCA) board for fast control and data acquisition, with Input/Output (IO) processing capability, is presented. The architecture, compatible with the ATCA (PICMG 3.4) and ATCA eXtensions for Instrumentation (AXIe) specifications, comprises a passive Rear Transition Module (RTM) for IO connectivity to ease hot-swap maintenance and simultaneously to increase cabling life cycle. The board complies with ITER Fast Plant System Controller (FPSC) guidelines for rear IO connectivity and redundancy, in order to provide high levels of reliability and availability to the control and data acquisition systems of nuclear fusion devices with long duration plasma discharges. Simultaneously digitized data from all Analog to Digital Converters (ADC) of the board can be filtered/decimated in a Field Programmable Gate Array (FPGA), decreasing data throughput, increasing resolution, and sent through Peripheral Component Interconnect (PCI) Express to multi-core processors in the ATCA shelf hub slots. Concurrently the multi-core processors can update the board Digital to Analog Converters (DAC) in real-time. Full-duplex point-to-point communication links between all FPGAs, of peer boards inside the shelf, allow the implementation of distributed algorithms and Multi-Input Multi-Output (MIMO) systems. Support for several timing and synchronization solutions is also provided. Some key features are onboard ADC or DAC modules with galvanic isolation, Xilinx Virtex 6 FPGA, standard Dual Data Rate (DDR) 3 SODIMM memory, standard CompactFLASH memory card, Intelligent Platform Management Controller (IPMC), two PCI Express x4 (generation 2) ATCA Fabric channels (dual-star topology), eleven Xilinx Aurora x1 (or other ATCA compatible communications protocol) ATCA fabric channels (full-mesh topology) and two Fast Ethernet (Precision Time Protocol – PTP IEEE1588-V2 and Lan eXtensions for Instrumentation – LXI compatible) ATCA base channels (dual-star topology).

A.J.N. Batista; C. Leong; V. Bexiga; A.P. Rodrigues; A. Combo; B.B. Carvalho; J. Fortunato; M. Correia; J.P. Teixeira; I.C. Teixeira; J. Sousa; B. Gonçalves; C.A.F. Varandas

2012-01-01T23:59:59.000Z

287

Structural Design of a Horizontal-Axis Tidal Current Turbine Composite Blade  

SciTech Connect

This paper describes the structural design of a tidal composite blade. The structural design is preceded by two steps: hydrodynamic design and determination of extreme loads. The hydrodynamic design provides the chord and twist distributions along the blade length that result in optimal performance of the tidal turbine over its lifetime. The extreme loads, i.e. the extreme flap and edgewise loads that the blade would likely encounter over its lifetime, are associated with extreme tidal flow conditions and are obtained using a computational fluid dynamics (CFD) software. Given the blade external shape and the extreme loads, we use a laminate-theory-based structural design to determine the optimal layout of composite laminas such that the ultimate-strength and buckling-resistance criteria are satisfied at all points in the blade. The structural design approach allows for arbitrary specification of the chord, twist, and airfoil geometry along the blade and an arbitrary number of shear webs. In addition, certain fabrication criteria are imposed, for example, each composite laminate must be an integral multiple of its constituent ply thickness. In the present effort, the structural design uses only static extreme loads; dynamic-loads-based fatigue design will be addressed in the future. Following the blade design, we compute the distributed structural properties, i.e. flap stiffness, edgewise stiffness, torsion stiffness, mass, moments of inertia, elastic-axis offset, and center-of-mass offset along the blade. Such properties are required by hydro-elastic codes to model the tidal current turbine and to perform modal, stability, loads, and response analyses.

Bir, G. S.; Lawson, M. J.; Li, Y.

2011-10-01T23:59:59.000Z

288

TeV scale left-right symmetry with spontaneous D-parity breaking  

SciTech Connect

The different scenarios of spontaneous breaking of D parity have been studied in both the nonsupersymmetric and the supersymmetric version of the left-right symmetric models (LRSM). We explore the possibility of a TeV scale SU(2){sub R} breaking scale M{sub R} and hence TeV scale right-handed neutrinos from both minimization of the scalar potential as well as the coupling constant unification point of view. We show that, although minimization of the scalar potential allows the possibility of a TeV scale M{sub R} and tiny neutrino masses in LRSM with spontaneous D-parity breaking, the gauge coupling unification at a high scale {approx}10{sup 16} GeV does not favor a TeV scale symmetry breaking except in the supersymmetric left-right model with Higgs doublet and bidoublet. The phenomenology of neutrino mass is also discussed.

Borah, Debasish [Indian Institute of Technology Bombay, Mumbai-400076 (India); Patra, Sudhanwa; Sarkar, Utpal [Physical Research Laboratory, Ahmedabad-380009 (India)

2011-02-01T23:59:59.000Z

289

Experimental investigation of left-right asymmetry in photon-atom interaction  

E-Print Network (OSTI)

Single ionization of noble gas atoms by linearly polarized synchrotron radiation has been studied by employing angle- and energy-resolved photoelectron spectroscopy. The measurements were carried out in the plane defined by the momentum and polarization vectors of the photon. Parameters describing the left-right asymmetry (LRA) (relative to the photon propagation direction) of the photoelectron angular distribution were determined experimentally for the $s$-shells of He, Ne, Ar, Kr and Xe atoms and H$_2$ molecules and for the $p$-shells of Ne, Ar, Kr and Xe atoms. The values of the left-right asymmetry differ significantly from zero for both subshells. The photon and photoelectron energy dependence of the LRA parameters are presented also. Possible experimental and instrumental sources that could generate asymmetry are discussed and excluded as well.

Ricz, S; Kövér, Á; Holste, K; Borovik,, A; Schippers, S; Varga, D; Müller, A

2015-01-01T23:59:59.000Z

290

Left-right models with light neutrino mass prediction and dominant neutrinoless double beta decay rate  

E-Print Network (OSTI)

In TeV scale left-right symmetric models, new dominant predictions to neutrinoless double beta decay and light neutrino masses are in mutual contradiction because of large contribution to the latter through popular seesaw mechanisms. We show that in a class of left-right models with high-scale parity restoration, these results coexist without any contravention with neutrino oscillation data and the relevant formula for light neutrino masses is obtained via gauged inverse seesaw mechanism. The most dominant contribution to the double beta decay is shown to be via $W^-_L- W^-_R$ mediation involving both light and heavy neutrino exchanges, and the model predictions are found to discriminate whether the Dirac neutrino mass is of quark-lepton symmetric origin or without it. We also discuss associated lepton flavor violating decays.

M. K. Parida; Sudhanwa Patra

2013-01-14T23:59:59.000Z

291

ATLAS Sensitivity to Left-Right Symmetry at 7 TeV Kirill Skovpen  

E-Print Network (OSTI)

ATLAS Sensitivity to Left-Right Symmetry at 7 TeV Kirill Skovpen 13th ISTC SAC Seminar "New of Nuclear Physics (BINP) on behalf of the LRSM analysis group of ATLAS Exotics/Lepton+X: #12;Messengers;ATLAS detector layout 8Kirill Skovpen - ISTC SAC Seminar 20102010-09-03 #12;¯Q ¯Q q q WR e, µ e, µ Nl W

292

Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! December 28, 2009 - 7:30am Addthis Allison Casey Senior Communicator, NREL Black Friday sales have never been enough to entice me to brave the crowds after Thanksgiving. I'm just not that dedicated to shopping. After-Christmas sales, however, are another story. Sometimes those sales are just too good to pass up. If you're planning to take advantage of some of those great sales, you may want to see if there are any deals out there for energy-efficient purchases-but time is running out if you want to get a tax credit when you file your 2009 taxes in April. You have just four days to make your purchase for this year's tax credit. See the products that are eligible for

293

Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! Four Days Left to Buy Energy-Efficient Products for a 2009 Tax Credit! December 28, 2009 - 7:30am Addthis Allison Casey Senior Communicator, NREL Black Friday sales have never been enough to entice me to brave the crowds after Thanksgiving. I'm just not that dedicated to shopping. After-Christmas sales, however, are another story. Sometimes those sales are just too good to pass up. If you're planning to take advantage of some of those great sales, you may want to see if there are any deals out there for energy-efficient purchases-but time is running out if you want to get a tax credit when you file your 2009 taxes in April. You have just four days to make your purchase for this year's tax credit. See the products that are eligible for

294

Ubiquitous CP violation in a top-inspired left-right model  

Science Journals Connector (OSTI)

We explore CP violation in a left-right-model that reproduces the quark mass and CKM rotation angle hierarchies in a relatively natural way by fixing the bidoublet Higgs VEVs to be in the ratio mb:mt. Our model is quite general and allows for CP to be broken by both the Higgs VEVs and the Yukawa couplings. Despite this generality, CP violation may be parametrized in terms of two basic phases. A very interesting feature of the model is that the mixing angles in the right-handed sector are found to be equal to their left-handed counterparts to a very good approximation. Furthermore, the right-handed analogue of the usual CKM phase ?L is found to satisfy the relation ?R??L. The parameter space of the model is explored by using an adaptive Monte Carlo algorithm and the allowed regions in parameter space are determined by enforcing experimental constraints from the K and B systems. This method of solution allows us to evaluate the left-and right-handed CKM matrices numerically for various combinations of the two fundamental CP-odd phases in the model. We find that all experimental constraints may be satisfied with right-handed W and flavor changing neutral Higgs boson masses as low as about 2 TeV and 7 TeV, respectively.

Ken Kiers; Jeff Kolb; John Lee; Amarjit Soni; Guo-Hong Wu

2002-11-08T23:59:59.000Z

295

Hybrid versus Norwood procedure for hypoplastic left heart syndrome: Contemporary series from a single center  

Science Journals Connector (OSTI)

Objective Two different strategies have emerged in the initial palliation for hypoplastic left heart syndrome, the conventional Norwood operation and the so-called hybrid procedure. We have used each of these at our center. The purpose of the present study was to compare the outcomes of both procedures. Methods From 2007 to 2012, 40 patients presented to the Cardinal Glennon Children's Medical Center with hypoplastic left heart syndrome or 1 of its variants. Of the 40 patients, 24 underwent a hybrid procedure and 16 a Norwood procedure for initial palliation. The medical records, echocardiograms, and cardiac catheterization data were retrospectively reviewed. Standard statistical analysis was performed. Results The patients who underwent the hybrid procedure weighed less than those who underwent the Norwood procedure. Overall unadjusted survival was better in the Norwood group, although this did not reach statistical significance. Overall hospital resource usage was similar in both cohorts, taking into account both first and second palliation stages. Conclusions In our review, we found no statistically significant difference in survival or resource usage between those patients undergoing the Norwood procedure and those undergoing a hybrid procedure as initial palliation for hypoplastic left heart syndrome.

Alexander A. Brescia; Saadeh Jureidini; Saar Danon; Eric Armbrecht; Andrew C. Fiore; Charles B. Huddleston

2014-01-01T23:59:59.000Z

296

CP violation in the two-generation version of left-right models  

Science Journals Connector (OSTI)

Recent measurements of ?’/??3×10-3 and Dn, the neutron electric dipole moment, of the order 10-25 e cm if confirmed may be used to place useful constraints on different CP-violation models. In this paper, we study their implications on a class of two-generation versions of minimal left-right models. We find that, if all these observations are to be explained by these models, the CP-violation phases of the model must fall into an interesting fine-tuned hierarchical pattern. A realization of such a pattern is illustrated in a minimal spontaneous CP-violation model.

Jiang Liu; C. Q. Geng; John N. Ng

1989-06-01T23:59:59.000Z

297

Visualization of Fiber Structurein the Left and Right Ventricleof a Human Heart  

SciTech Connect

The human heart is composed of a helical network of musclefibers. Anisotropic least squares filtering followed by fiber trackingtechniques were applied to Diffusion Tensor Magnetic Resonance Imaging(DTMRI) data of the excised human heart. The fiber configuration wasvisualized by using thin tubes to increase 3-dimensional visualperception of the complex structure. All visualizations were performedusing the high-quality ray-tracing software POV-Ray. The fibers are shownwithin the left and right ventricles. Both ventricles exhibit similarfiber architecture and some bundles of fibers are shown linking right andleft ventricles on the posterior region of the heart.

Rohmer, Damien; Sitek, Arkadiusz; Gullberg, Grant T.

2006-07-12T23:59:59.000Z

298

Valsartan, Captopril, or Both in Myocardial Infarction Complicated by Heart Failure, Left Ventricular Dysfunction, or Both  

Science Journals Connector (OSTI)

Multiple randomized, placebo-controlled trials involving a total of more than 100,000 patients have demonstrated that angiotensin-converting–enzyme (ACE) inhibitors reduce the risk of death as well as the risk of major nonfatal cardiovascular events after myocardial infarction.– The greatest... It is known that the angiotensin-converting–enzyme inhibitor captopril is beneficial in patients with myocardial infarction complicated by left ventricular dysfunction or heart failure. This study compared captopril with valsartan, an angiotensin-receptor blocker, and the combination of the two drugs in such patients. Mortality was the same in the three groups, but there were more side effects with the combination therapy.

Pfeffer M.A.; McMurray J.J.V.; Velazquez E.J.

2003-11-13T23:59:59.000Z

299

Bull. Soc. gol. Fr., 2008, no The Rio Bravo fault, a major late Oligocene left-lateral shear zone  

E-Print Network (OSTI)

Upper Cretaceous sequence, are both tightly folded before 30 Ma. We think this folding is associated by gravimetric data and the offsets the Palaeocene-Eocene oil fields that are displaced left laterally. We

Husson, Laurent

300

Treatment of an Iatrogenic Left Internal Mammary Artery to Pulmonary Artery Fistula with a Bovine Pericardium Covered Stent  

SciTech Connect

We report a case with an acquired fistula between the left internal mammary artery and the pulmonary artery following coronary bypass surgery treated with a bovine pericardium covered stent. We also reviewed similar cases reported previously.

Heper, Gulumser [SSK Ihtisas Hospital, Department of Cardiology (Turkey)], E-mail: heperg@hotmail.com; Barcin, Cem; Iyisoy, Atila; Tore, Hasan F. [Gulhane Military Medical Academy, Department of Cardiology (Turkey)

2006-10-15T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Automatic Regulation of Output of an Electrohydraulic Left Ventricular Assist Device Using the Polymer Bellows Water Pressure and Motor Current  

Science Journals Connector (OSTI)

An electrohydraulically driven left ventricular assist device (LVAD) has been developed in our laboratory. Over years of in vitro and in vivo testing, a “suction” problem has been pointed out as one of the major ...

Jae-Soon Choi; Yung-Ho Jo; Won-Woo Choi; Seong-Keun Park; Kyong-Sik Om…

1998-01-01T23:59:59.000Z

302

Universitt Tbingen Mathematisches Institut  

E-Print Network (OSTI)

Approximation S() := m-1 i=0 [(1 - )Wti + Wti+1 ](Wti+1 - Wti ) des Integrals t 0 WsdWs. Zeigen Sie lim ||||0 S

Tübingen, Universität

303

Method and device for determining the position of a cutting tool relative to the rotational axis of a spindle-mounted workpiece  

DOE Patents (OSTI)

The present invention is directed to a method and device for determining the location of a cutting tool with respect to the rotational axis of a spindle-mounted workpiece. A vacuum cup supporting a machinable sacrificial pin is secured to the workpiece at a location where the pin will project along and encompass the rotational axis of the workpiece. The pin is then machined into a cylinder. The position of the surface of the cutting tool contacting the machine cylinder is spaced from the rotational axis of the workpiece a distance equal to the radius of the cylinder.

Williams, R.R.

1980-09-03T23:59:59.000Z

304

Interstudy reproducibility of dimensional and functional measurements between cine magnetic resonance studies in the morphologically abnormal left ventricle  

Science Journals Connector (OSTI)

The validity of geometric formulas to derive mass and volumes in the morphologically abnormal left ventricule is problematic. Imaging techniques that are tomographic and therefore inherently three-dimensional should be more reliable and reproducible between studies in such ventricles. Determination of reproducibility between studies is essential to define the limits of an imaging technique for evaluating the response to therapy. Sequential cine magnetic resonance (MR) studies were performed on patients with dilated cardiomyopathy (n=11) and left ventricular hypertrophy (n=8) within a short interval in order to assess interstudy reproducbility. Left ventricular mass, volumes, ejection fraction, and end-systolic wall stress were determined by two independent observers. Between studies, left ventricular mass was highly reproducible for hypertrophied and dilated ventricles, with percent variability less than 6%. Ejection fraction and end-diastolic volume showed close reproducibility between studies, with percent variability less than 5%. End-systolic volume varied by 4.3% and 4.5% in dilated cardiomyopathy and 8.4% and 7.2% in left ventricular hypertrophy for the two observers. End-systolic wall stress, which is derived from multiple measurements, varied the greatest, with percent variability of 17.2% and 15.7% in dilated cardiomyopathy and 14.8% and 13% in left ventricular hypertrophy, respectively. The results of this study demonstrate that mass, volume, and functional measurements are reproducible in morphologically abnormal ventricles.

Richard C. Semelka; Ernesto Tomei; Stefan Wagner; John Mayo; Gary Caputo; Margaret O'Sullivan; William W. Parmley; Kanu Chatterjee; Christopher Wolfe; Charles B. Higgins

1990-01-01T23:59:59.000Z

305

Lepton-Flavor Violation in the Left-handed Slepton Production at Future Lepton Colliders  

E-Print Network (OSTI)

The Super-Kamiokande atmospheric neutrino data suggest existence of the large lepton-flavor violating (LFV) interaction in the higher energy scale. If the minimal supersymmetric standard model is extended to have right-handed neutrinos, the left-handed sleptons in the second and third generations are expected to have the LFV masses in the minimal supergravity scenario. In this article we study the LFV signals in the left-handed slepton production at $\\mu^+\\mu^-$ colliders and $\\e^+\\e^-$ linear colliders (LC's), $\\mu^+\\mu^-(\\e^+\\e^-)\\to\\tau\\mu +4jets + \\E$ and $\\mu^+\\mu^-(\\e^+\\e^-)\\to\\tau\\mu l+ 2jets+ \\E$. The main background comes from decay of a tau lepton into a muon in the lepton-flavor conserving slepton pair production. They are significantly reduced by the energy and the impact parameter cuts for the muon. At $\\mu^+\\mu^-$ colliders (LC's) it may be possible to reach the mixing angle $\\sin 2\\theta_{\\tilde{\

Junji Hisano; Mihoko M. Nojiri; Yasuhiro Shimizu; Minoru Tanaka

1998-08-25T23:59:59.000Z

306

Nonlinear coupling of left and right handed circularly polarized dispersive Alfvén wave  

SciTech Connect

The nonlinear phenomena are of prominent interests in understanding the particle acceleration and transportation in the interplanetary space. The ponderomotive nonlinearity causing the filamentation of the parallel propagating circularly polarized dispersive Alfvén wave having a finite frequency may be one of the mechanisms that contribute to the heating of the plasmas. The contribution will be different of the left (L) handed mode, the right (R) handed mode, and the mix mode. The contribution also depends upon the finite frequency of the circularly polarized waves. In the present paper, we have investigated the effect of the nonlinear coupling of the L and R circularly polarized dispersive Alfvén wave on the localized structures formation and the respective power spectra. The dynamical equations are derived in the presence of the ponderomotive nonlinearity of the L and R pumps and then studied semi-analytically as well as numerically. The ponderomotive nonlinearity accounts for the nonlinear coupling between both the modes. In the presence of the adiabatic response of the density fluctuations, the nonlinear dynamical equations satisfy the modified nonlinear Schrödinger equation. The equations thus obtained are solved in solar wind regime to study the coupling effect on localization and the power spectra. The effect of coupling is also studied on Faraday rotation and ellipticity of the wave caused due to the difference in the localization of the left and the right modes with the distance of propagation.

Sharma, R. P., E-mail: rpsharma@ces.iitd.ac.in; Sharma, Swati, E-mail: swati.sharma704@gmail.com; Gaur, Nidhi, E-mail: nidhiphysics@gmail.com [Centre for Energy Studies, Indian Institute of Technology Delhi, New Delhi 110016 (India)

2014-07-15T23:59:59.000Z

307

Three-dimensional structure of the flow inside the left ventricle of the human heart  

E-Print Network (OSTI)

The laboratory models of the human heart left ventricle developed in the last decades gave a valuable contribution to the comprehension of the role of the fluid dynamics in the cardiac function and to support the interpretation of the data obtained in vivo. Nevertheless, some questions are still open and new ones stem from the continuous improvements in the diagnostic imaging techniques. Many of these unresolved issues are related to the three-dimensional structure of the left-ventricular flow during the cardiac cycle. In this paper we investigated in detail this aspect using a laboratory model. The ventricle was simulated by a flexible sack varying its volume in time according to a physiologically shaped law. Velocities measured during several cycles on series of parallel planes, taken from two orthogonal points of view, were combined together in order to reconstruct the phase averaged, three-dimensional velocity field. During the diastole, three main steps are recognized in the evolution of the vortical str...

Fortini, S; Espa, S; Cenedese, A

2014-01-01T23:59:59.000Z

308

Prenatal Food Restriction Induces a Hypothalamic-Pituitary-Adrenocortical Axis-associated Neuroendocrine Metabolic Programmed Alteration in Adult Offspring Rats  

Science Journals Connector (OSTI)

Background and Aims Intrauterine growth restriction produces susceptibility to adult metabolic syndrome, which may be caused by the permanent alteration of the hypothalamic-pituitary-adrenocortical (HPA) axis. We aimed to verify that HPA axis-associated neuroendocrine metabolic programming is altered in food-restricted (FR) offspring. Methods Maternal rats were fed a restricted diet from gestational day 11 until full-term delivery, all pups were fed a high-fat diet after weaning and exposed to unpredictable chronic stress (UCS) during postnatal weeks 17–20. Results Serum levels of adrenocorticotrophic hormone and corticosterone in adult offspring of the prenatal FR group were lower than the control (CN) rats before UCS but increased significantly after UCS. Serum glucose levels in the FR group were normal before UCS but increased after UCS. Serum insulin levels were significantly decreased in FR males but showed a slight increase in FR females before UCS; however, insulin levels decreased significantly in the FR male and female rats after UCS. Before UCS, serum lipid levels were higher in the FR males but were normal in the FR females; after UCS, FR males had a slight decrease and FR females had an increasing trend in serum lipids levels. Lipid droplets in the hypothalamus, pituitary gland, and livers of the FR group indicated steatosis. Conclusions These results suggest that prenatal food restriction alters HPA axis-associated neuroendocrine metabolism in adult offspring fed a high-fat diet, which may originate from the intrauterine programming and increase the susceptibility to adult metabolic diseases.

Li Zhang; Dan Xu; Benjian Zhang; Yansong Liu; Fenglong Chu; Yuming Guo; Jun Gong; Xun Zheng; Liaobin Chen; Hui Wang

2013-01-01T23:59:59.000Z

309

Raindrop axis ratios, fall velocities and size distribution over Sumatra from 2D-Video Disdrometer measurement  

Science Journals Connector (OSTI)

Raindrop axis ratio, falling velocity and size distribution are important in broad list of applications. However, they are not frequently observed in the equatorial region. This paper elucidated the characteristics of raindrop axis ratio, falling velocity and size distribution based on 2D-Video Disdrometer (2DVD) data that have been collected in the equatorial Indonesia, particularly at Kototabang (hereafter called KT), west Sumatra, Indonesia (0.20°S, 100.32°E, 864 m above sea level). A comprehensive follow-up of the previous study on the natural variability of raindrop size distributions (DSDs) is presented. Precipitation was classified through 1.3-GHz wind profiler observation. The dependence of raindrop falling velocity and axis ratio on rainfall type was not clearly observed. Overall, measured raindrop fall velocities were in good agreement with Gunn–Kinzer's data. Raindrop axis ratio at KT was more spherical than that of artificial rain and equilibrium model, and close to the values reported in the turbulent high shear zone of surface layer which can be partially due to the effect of the instrument errors (e.g., location and container shape). Of some natural variations of DSD investigated, the dependence of DSD on rainfall rate and rainfall type as well as diurnal variation was clearly visible. A striking contrast between the stratiform and convective rains is that the size distributions from the stratiform (convective) rains tend to narrow (broaden) with increasing rainfall rates. For rainfall rate R < 10 mm/h, the size distribution of stratiform was broader than that of convective. On the other hand, at higher rainfall rate more large-sized drops were found in convective rain. During the convective rain, very large-sized drops were found mainly at the very start of rain event while for the stratiform they were found to be associated with a strong bright band. In diurnal basis, the \\{DSDs\\} in the morning hours were narrower than those in the evening which was indicated by smaller Dm values in the morning hours than their counterparts in the evening. Rainfall type dependence and diurnal variation of DSD lead to significant variation of Z–R relations so that they must be considered to increase the accuracy of Z–R conversion from weather radar in this region. Consistent with the previous study, lack of seasonal DSD variability was also found in this work that would be due to significant local convective and orographic effect at this region throughout the year. However, Dm values in our result were larger than the typical orographic DSD.

Marzuki; Walter L. Randeu; Toshiaki Kozu; Toyoshi Shimomai; Hiroyuki Hashiguchi; Michael Schönhuber

2013-01-01T23:59:59.000Z

310

Mechanisms for left ventricular systolic dysfunction in aortic regurgitation: Importance for predicting the functional response to aortic valve replacement  

Science Journals Connector (OSTI)

To test the hypothesis that the combined use of the time-varying distance concept and conventional circumferential stress-shortening relations would elucidate differential mechanisms for left ventricular systolic dysfunction in severe, chronic aortic regurgitation and therefore predict the functional responses to aortic valve replacement, 31 control patients and 37 patients with aortic regurgitation were studied. The studies included micromanometer left ventricular pressure determinations, biplane contrast cineangiograms under control conditions and radionuclide angiograms under control conditions and during methoxamine or nitroprusside infusions with right atrial pacing. The patients with aortic regurgitation were classified into three groups: Group I had normal Emax and stress-shortening relations, Group II had abnormal Emax but normal stress-shortening relations and Group III had abnormal Emax and stress-shortening relations. The left ventricular end-diastolic and end-systolic volumes showed a progressive increase and the ejection fraction showed a progressive decrease from Group I to III; these values differed from those in the control patients (p < 0.001). In Group I, then was a decrease in left ventricular volumes (p < 0.05) but no significant change in ejection fraction (61 ± 7% versus 63 ± 4%) after aortic valve replacement. In contrast, in Group II, reduction in left ventricular volumes (p < 0.01) was associated with an increase in ejection fraction from 50 ± 8% to 64 ± 11% (p < 0.01). Finally, in Group III, reduction in left ventricular volumes (p < 0.05) was associated with a further decrement in ejection fraction from 35 ± 13% to 30 ± 13%. Group I patients had compensated adequately for chronic volume overload. However, Group II had left ventricular dysfunction that was associated with an increase in the left ventricular volume/mass ratio compared with that in the control patients and Group I (p < 0.05 for both), suggesting inadequate hypertrophy and assumption of spherical geometry. Finally, irreversible myocardial dysfunction had supervened in Group III. In conclusion, a combined analysis of left ventricular chamber performance using the time-varying elastance concept and myocardial performance using conventional circumferential stress-shortening relations provides complementary information that elucidates differential mechanisms for left ventricular systolic dysfunction and therefore predicts the functional response to aortic valve replacement.

Mark R. Starling; Marvin M. Kirsh; Daniel G. Montgomery; Milton D. Gross

1991-01-01T23:59:59.000Z

311

Respiration Induced Heart Motion and Indications of Gated Delivery for Left-Sided Breast Irradiation  

SciTech Connect

Purpose: To investigate respiration-induced heart motion for left-sided breast irradiation using a four-dimensional computed tomography (4DCT) technique and to determine novel indications to assess heart motion and identify breast patients who may benefit from a gated treatment. Methods and Materials: Images of 4DCT acquired during free breathing for 20 left-sided breast cancer patients, who underwent whole breast irradiation with or without regional nodal irradiation, were analyzed retrospectively. Dose distributions were reconstructed in the phases of 0%, 20%, and 50%. The intrafractional heart displacement was measured in three selected transverse CT slices using D{sub LAD} (the distance from left ascending aorta to a fixed line [connecting middle point of sternum and the body] drawn on each slice) and maximum heart depth (MHD, the distance of the forefront of the heart to the line). Linear regression analysis was used to correlate these indices with mean heart dose and heart dose volume at different breathing phases. Results: Respiration-induced heart displacement resulted in observable variations in dose delivered to the heart. During a normal free-breathing cycle, heart-induced motion D{sub LAD} and MHD changed up to 9 and 11 mm respectively, resulting in up to 38% and 39% increases of mean doses and V{sub 25.2} for the heart. MHD and D{sub LAD} were positively correlated with mean heart dose and heart dose volume. Respiratory-adapted gated treatment may better spare heart and ipsilateral-lung compared with the conventional non-gated plan in a subset of patients with large D{sub LAD} or MHD variations. Conclusion: Proposed indices offer novel assessment of heart displacement based on 4DCT images. MHD and D{sub LAD} can be used independently or jointly as selection criteria for respiratory gating procedure before treatment planning. Patients with great intrafractional MHD variations or tumor(s) close to the diaphragm may particularly benefit from the gated treatment.

Qi, X. Sharon, E-mail: xiangrong.qi@ucdenver.edu [Department of Radiation Oncology, University of Colorado Denver, Aurora, CO (United States); Hu, Angela [Department of Radiation Oncology, University of Colorado Denver, Aurora, CO (United States); Wang Kai [Department of Radiation Oncology, Medical College of Wisconsin, Milwaukee, WI (United States); Newman, Francis [Department of Radiation Oncology, University of Colorado Denver, Aurora, CO (United States); Crosby, Marcus; Hu Bin; White, Julia; Li, X. Allen [Department of Radiation Oncology, Medical College of Wisconsin, Milwaukee, WI (United States)

2012-04-01T23:59:59.000Z

312

Order-of-magnitude enhancement of wind farm power density via counter-rotating vertical-axis wind turbine arrays  

E-Print Network (OSTI)

Modern wind farms require significant land resources to separate each wind turbine from the adjacent turbine wakes. These aerodynamic constraints limit the amount of power that can be extracted from a given wind farm footprint. We conducted full-scale field tests of vertical-axis wind turbines in counter-rotating configurations under natural wind conditions. Whereas wind farms consisting of propeller-style turbines produce 2 to 3 watts of power per square meter of land area, these field tests indicate that power densities approaching 100 W m^-2 can be achieved by arranging vertical-axis wind turbines in layouts that enable them to extract energy from adjacent wakes. In addition, we calculated that the global wind resource available to 10-m tall turbines based on the present approach is approximately 225 trillion watts (TW), which significantly exceeds the global wind resource available to 80-m tall, propeller-style wind turbines, approximately 75 TW. This improvement is due to the closer spacing that can be a...

Dabiri, John O

2010-01-01T23:59:59.000Z

313

Offshore floating vertical axis wind turbines, dynamics modelling state of the art. Part II: Mooring line and structural dynamics  

Science Journals Connector (OSTI)

Abstract The need to exploit enhanced wind resources far offshore as well as in deep waters requires the use of floating support structures to become economically viable. The conventional three-bladed horizontal axis wind turbine may not continue to be the optimal design for floating applications. Therefore it is important to assess alternative concepts in this context that may be more suitable. Vertical axis wind turbines (VAWTs) are a promising concept, and it is important to first understand the coupled and relatively complex dynamics of floating \\{VAWTs\\} to assess their technical feasibility. As part of this task, a series of articles have been developed to present a comprehensive literature review covering the various areas of engineering expertise required to understand the coupled dynamics involved in floating VAWTs. This second article focuses on the modelling of mooring systems and structural behaviour of floating VAWTs, discussing various mathematical models and their suitability within the context of developing a model of coupled dynamics. Emphasis is placed on computational aspects of model selection and development as computational efficiency is an important aspect during preliminary design stages. This paper has been written both for researchers new to this research area, outlining underlying theory whilst providing a comprehensive review of the latest work, and for experts in this area, providing a comprehensive list of the relevant references where the details of modelling approaches may be found.

Michael Borg; Maurizio Collu; Athanasios Kolios

2014-01-01T23:59:59.000Z

314

Low-energy phenomenology of trinification: an effective left-right-symmetric model  

E-Print Network (OSTI)

The trinification model is an interesting extension of the Standard Model (SM) based on the gauge group $SU(3)_C\\times SU(3)_L\\times SU(3)_R$. We study its low-energy phenomenology by constructing a low-energy effective field theory, thereby reducing the number of particles and free parameters that need to be studied. The resulting model predicts that several new scalar particles have masses in the $\\mathcal{O}\\left(100\\text{ GeV}\\right)$ range. We study a few of the interesting phenomenological scenarios, such as the presence of a light fermiophobic scalar in addition to a SM-like Higgs, or a degenerate (twin) Higgs state at 126 GeV. We point out regions of the parameter space that lead to measurable deviations from SM predictions of the Higgs couplings. Hence the trinification model awaits crucial tests at the Large Hadron Collider in the coming years.

Hetzel, Jamil

2015-01-01T23:59:59.000Z

315

Neutrinoless double-$?$ decay in TeV scale Left-Right symmetric models  

E-Print Network (OSTI)

In this paper we study in detail the neutrinoless double beta decay in left-right symmetric models with right-handed gauge bosons at TeV scale which is within the presently accessible reach of colliders. We discuss the different diagrams that can contribute to this process and identify the dominant ones for the case where the right-handed neutrino is also at the TeV scale. We calculate the contribution to the effective mass governing neutrinoless double beta decay assuming type-I, and type-II dominance and discuss what are the changes in the effective mass due to the additional contributions. We also discuss the effect of the recent Daya-Bay and RENO measurements on $\\sin^2\\theta_{13}$ on the effective mass in different scenarios.

Joydeep Chakrabortty; H. Zeen Devi; Srubabati Goswami; Sudhanwa Patra

2012-04-11T23:59:59.000Z

316

Development and Verification of a Computational Fluid Dynamics Model of a Horizontal-Axis Tidal Current Turbine  

NLE Websites -- All DOE Office Websites (Extended Search)

Development and Verification of Development and Verification of a Computational Fluid Dynamics Model of a Horizontal-Axis Tidal Current Turbine M.J. Lawson and Y. Li. National Renewable Energy Laboratory D.C. Sale University of Washington Presented at the 30 th International Conference on Ocean, Offshore, and Arctic Engineering Rotterdam, The Netherlands June 19-24, 2011 NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. Conference Paper NREL/CP-5000-50981 October 2011 Contract No. DE-AC36-08GO28308 NOTICE The submitted manuscript has been offered by an employee of the Alliance for Sustainable Energy, LLC (Alliance), a contractor of the US Government under Contract No. DE-AC36-08GO28308. Accordingly, the US

317

Early time implosion symmetry from two-axis shock-timing measurements on indirect drive NIF experiments  

SciTech Connect

An innovative technique has been developed and used to measure the shock propagation speed along two orthogonal axes in an inertial confinement fusion indirect drive implosion target. This development builds on an existing target and diagnostic platform for measuring the shock propagation along a single axis. A 0.4?mm square aluminum mirror is installed in the ablator capsule which adds a second orthogonal view of the x-ray-driven shock speeds. The new technique adds capability for symmetry control along two directions of the shocks launched in the ablator by the laser-generated hohlraum x-ray flux. Laser power adjustments in four different azimuthal cones based on the results of this measurement can reduce time-dependent symmetry swings during the implosion. Analysis of a large data set provides experimental sensitivities of the shock parameters to the overall laser delivery and in some cases shows the effects of laser asymmetries on the pole and equator shock measurements.

Moody, J. D., E-mail: moody4@llnl.gov; Robey, H. F.; Celliers, P. M.; Munro, D. H.; Barker, D. A.; Baker, K. L.; Döppner, T.; Hash, N. L.; Berzak Hopkins, L.; LaFortune, K.; Landen, O. L.; LePape, S.; MacGowan, B. J.; Ralph, J. E.; Ross, J. S.; Widmayer, C. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States); Nikroo, A.; Giraldez, E. [General Atomics, San Diego, California 92186-5608 (United States); Boehly, T. [Laboratory for Laser Energetics, Rochester, New York 14623-1299 (United States)

2014-09-15T23:59:59.000Z

318

Development and Verification of a Computational Fluid Dynamics Model of a Horizontal-Axis Tidal Current Turbine  

SciTech Connect

This paper describes the development of a computational fluid dynamics (CFD) methodology to simulate the hydrodynamics of horizontal-axis tidal current turbines. Qualitative measures of the CFD solutions were independent of the grid resolution. Conversely, quantitative comparisons of the results indicated that the use of coarse computational grids results in an under prediction of the hydrodynamic forces on the turbine blade in comparison to the forces predicted using more resolved grids. For the turbine operating conditions considered in this study, the effect of the computational timestep on the CFD solution was found to be minimal, and the results from steady and transient simulations were in good agreement. Additionally, the CFD results were compared to corresponding blade element momentum method calculations and reasonable agreement was shown. Nevertheless, we expect that for other turbine operating conditions, where the flow over the blade is separated, transient simulations will be required.

Lawson, M. J.; Li, Y.; Sale, D. C.

2011-10-01T23:59:59.000Z

319

Image-Guided Radiotherapy for Left-Sided Breast Cancer Patients: Geometrical Uncertainty of the Heart  

SciTech Connect

Purpose: To quantify the geometrical uncertainties for the heart during radiotherapy treatment of left-sided breast cancer patients and to determine and validate planning organ at risk volume (PRV) margins. Methods and Materials: Twenty-two patients treated in supine position in 28 fractions with regularly acquired cone-beam computed tomography (CBCT) scans for offline setup correction were included. Retrospectively, the CBCT scans were reconstructed into 10-phase respiration correlated four-dimensional scans. The heart was registered in each breathing phase to the planning CT scan to establish the respiratory heart motion during the CBCT scan ({sigma}{sub resp}). The average of the respiratory motion was calculated as the heart displacement error for a fraction. Subsequently, the systematic ({Sigma}), random ({sigma}), and total random ({sigma}{sub tot}={radical}({sigma}{sup 2}+{sigma}{sub resp}{sup 2})) errors of the heart position were calculated. Based on the errors a PRV margin for the heart was calculated to ensure that the maximum heart dose (D{sub max}) is not underestimated in at least 90% of the cases (M{sub heart} = 1.3{Sigma}-0.5{sigma}{sub tot}). All analysis were performed in left-right (LR), craniocaudal (CC), and anteroposterior (AP) directions with respect to both online and offline bony anatomy setup corrections. The PRV margin was validated by accumulating the dose to the heart based on the heart registrations and comparing the planned PRV D{sub max} to the accumulated heart D{sub max}. Results: For online setup correction, the cardiac geometrical uncertainties and PRV margins were N-Ary-Summation = 2.2/3.2/2.1 mm, {sigma} = 2.1/2.9/1.4 mm, and M{sub heart} = 1.6/2.3/1.3 mm for LR/CC/AP, respectively. For offline setup correction these were N-Ary-Summation = 2.4/3.7/2.2 mm, {sigma} = 2.9/4.1/2.7 mm, and M{sub heart} = 1.6/2.1/1.4 mm. Cardiac motion induced by breathing was {sigma}{sub resp} = 1.4/2.9/1.4 mm for LR/CC/AP. The PRV D{sub max} underestimated the accumulated heart D{sub max} for 9.1% patients using online and 13.6% patients using offline bony anatomy setup correction, which validated that PRV margin size was adequate. Conclusion: Considerable cardiac position variability relative to the bony anatomy was observed in breast cancer patients. A PRV margin can be used during treatment planning to take these uncertainties into account.

Topolnjak, Rajko; Borst, Gerben R.; Nijkamp, Jasper [Radiotherapy Department, Netherlands Cancer Institute/Antoni van Leeuwenhoek Huis, Amsterdam (Netherlands); Sonke, Jan-Jakob, E-mail: j.sonke@nki.nl [Radiotherapy Department, Netherlands Cancer Institute/Antoni van Leeuwenhoek Huis, Amsterdam (Netherlands)

2012-03-15T23:59:59.000Z

320

Measurement of {nu}{sub {mu}} and {nu}{sub e} Events in an Off-Axis Horn-Focused Neutrino Beam  

SciTech Connect

We report the first observation of off-axis neutrino interactions in the MiniBooNE detector from the NuMI beam line at Fermilab. The MiniBooNE detector is located 745 m from the NuMI production target, at 110 mrad angle (6.3 deg.) with respect to the NuMI beam axis. Samples of charged-current quasielastic {nu}{sub {mu}} and {nu}{sub e} interactions are analyzed and found to be in agreement with expectation. This provides a direct verification of the expected pion and kaon contributions to the neutrino flux and validates the modeling of the NuMI off-axis beam.

Adamson, P.; Brice, S. J.; Brown, B. C.; Choudhary, B. C.; Finley, D. A.; Ford, R.; Garcia, F. G.; Harris, D.; Hylen, J.; Kasper, P.; Kobilarcik, T.; Kourbanis, I.; Marchionni, A.; Marsh, W.; Mills, F.; Moore, C. D.; Prebys, E.; Russell, A. D.; Smart, W.; Spentzouris, P. [Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States)] (and others)

2009-05-29T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Decision tree for adjuvant right ventricular support in patients receiving a left ventricular assist device  

Science Journals Connector (OSTI)

Background Right ventricular (RV) failure is a significant complication after implantation of a left ventricular assist device (LVAD). It is therefore important to identify patients at risk a priori. However, prognostic models derived from multivariate analyses have had limited predictive power. Methods This study retrospectively analyzed the records of 183 LVAD recipients between May 1996 and October 2009; of these, 27 later required a RVAD (RVAD+) and 156 remained on LVAD only (RVAD?) until transplant or death. A decision tree model was constructed to represent combinatorial non-linear relationships of the pre-operative data that are predictive of the need for RVAD support. Results An optimal set of 8 pre-operative variables were identified: transpulmonary gradient, age, right atrial pressure, international normalized ratio, heart rate, white blood cell count, alanine aminotransferase, and the number of inotropic agents. The resultant decision tree, which consisted of 28 branches and 15 leaves, identified RVAD+ patients with 85% sensitivity, RVAD? patients with 83% specificity, and exhibited an area under the receiver operating characteristic curve of 0.87. Conclusions The decision tree model developed in this study exhibited several advantages compared with existing risk scores. Quantitatively, it provided improved prognosis of RV support by encoding the non-linear, synergic interactions among pre-operative variables. Because of its intuitive structure, it more closely mimics clinical reasoning and therefore can be more readily interpreted. Further development with additional multicenter, longitudinal data may provide a valuable prognostic tool for triage of LVAD therapy and, potentially, improve outcomes.

Yajuan Wang; Marc A. Simon; Pramod Bonde; Bronwyn U. Harris; Jeffrey J. Teuteberg; Robert L. Kormos; James F. Antaki

2012-01-01T23:59:59.000Z

322

Right-left asymmetry of radiation from fission induced by polarised neutrons  

E-Print Network (OSTI)

The effect of the right-left asymmetry is considered in the angular distribution of gamma quanta from fission of U-235 by polarised thermal neutrons, which depends on the polarisation of the neutrons with respect to the gamma-fission plane. Electric dipole radiation from fission fragments arising due to the Strutinsky-Denisov induced polarisation mechanism may give rise to such an effect. Earlier, this mechanism was shown to fit the non-statistical part observed in the gamma spectrum from spontaneous fission of Cf-252. The calculated value of the magnitude of the asymmetry parameter is on the level of 10$^{-4}$. That is in agreement with the current experimental data. A crucial experiment to give a more definite picture of the concrete mechanism would be determination of the energy of the quanta responsible for the asymmetry. Detection of the quanta with the energy of ~5 MeV approaching the giant dipole resonance is needed in order to identify prompt gamma rays emitted at the stage of fissioning.

F. F. Karpeshin

2009-02-09T23:59:59.000Z

323

Right-left asymmetry of radiation from fission induced by polarised neutrons  

E-Print Network (OSTI)

The effect of the right-left asymmetry is considered in the angular distribution of gamma quanta from fission of U-235 by polarised thermal neutrons, which depends on the polarisation of the neutrons with respect to the gamma-fission plane. Electric dipole radiation from fission fragments arising due to the Strutinsky-Denisov induced polarisation mechanism may give rise to such an effect. Earlier, this mechanism was shown to fit the non-statistical part observed in the gamma spectrum from spontaneous fission of Cf-252. The calculated value of the magnitude of the asymmetry parameter is on the level of 10$^{-4}$. That is in agreement with the current experimental data. A crucial experiment to give a more definite picture of the concrete mechanism would be determination of the energy of the quanta responsible for the asymmetry. Detection of the quanta with the energy of ~5 MeV approaching the giant dipole resonance is needed in order to identify prompt gamma rays emitted at the stage of fissioning.

Karpeshin, F F

2009-01-01T23:59:59.000Z

324

Mid-term follow up of thromboembolic complications in left ventricular endocardial cardiac resynchronization therapy  

Science Journals Connector (OSTI)

Background Endocardial left ventricular (LV) pacing for cardiac resynchronization therapy (CRT) has been proposed as an alternative to traditional LV transvenous epicardial pacing with equal or superior cardiac performance. The risks of cerebral thromboembolism and possible interference with mitral valve function moderate its clinical application. Objective The purpose of this study was to investigate cerebral thromboembolic complications after LV endocardial lead placement. Mitral regurgitation (MR) was the secondary outcome measure. Methods CRT candidates with a failed coronary sinus approach or nonresponders to conventional CRT underwent endocardial LV lead implantation (45 atrial transseptal, 6 transapical). Coumarin was prescribed with a targeted international normalized ratio between 3.5 and 4.5. Patient records were checked and general practitioners were contacted regarding cerebral thromboembolic complications. MR was evaluated by echocardiography at baseline and after 6 months. Results In 7 patients, 6 ischemic strokes and 2 transient ischemic attacks occurred, corresponding to 6.1 thromboembolic events per 100 patient-years (95% confidence interval 3.4–15.8). One patient refused hospital admission; all other patients had a subtherapeutic anticoagulation level at the time of the event. No major bleeding complications occurred. There was no change in the grade of MR (grade 2, P = .727) after 6 months. Conclusion Endocardial LV lead placement in patients with advanced heart failure is associated with thromboembolic risk. However, all but 1 patient had a subtherapeutic level of anticoagulation. Endocardial LV lead placement is not associated with aggravation of MR.

Leonard M. Rademakers; Berry M. van Gelder; Mike G. Scheffer; Frank A. Bracke

2014-01-01T23:59:59.000Z

325

Bound on Z{sup '} mass from CDMS II in the dark left-right gauge model II  

SciTech Connect

With the recent possible signal of dark matter from the CDMS II experiment, the Z{sup '} mass of a new version of the dark left-right gauge model (DLRM II) is predicted to be at around a TeV. As such, it has an excellent discovery prognosis at the operating Large Hadron Collider.

Khalil, Shaaban [Centre for Theoretical Physics, British University in Egypt, El Sherouk City, Postal No. 11837, P.O. Box 43 (Egypt); Department of Mathematics, Ain Shams University, Faculty of Science, Cairo 11566 (Egypt); Lee, Hye-Sung [Department of Physics, Brookhaven National Laboratory, Upton, New York 11973 (United States); Ma, Ernest [Department of Physics and Astronomy, University of California, Riverside, California 92521 (United States)

2010-03-01T23:59:59.000Z

326

Left handed DNA in synthetic and topologically constrained form V DNA and its implications in protein recognition  

Science Journals Connector (OSTI)

We have investigated structural transitions in Poly(dG-dC) and Poly(dG-Me5dC) in order to understand the exact role of cations in stabilizing left-handed helical structures in specific sequences andthe biological...

Y. S. Shouche; P. K. Latha; N. Ramesh; K. Majumder; V. Mandyan…

1985-08-01T23:59:59.000Z

327

Flow Visualization Studies in the Novacor Left Ventricular Assist System CRADA PC91-002, Final Report  

SciTech Connect

This paper discusses a series of experiments to visualize and measure flow fields in the Novacor left ventricular assist system (LVAS). The experiments utilize a multiple exposure, optical imaging technique called fluorescent image tracking velocimetry (FITV) to hack the motion of small, neutrally-buoyant particles in a flowing fluid.

Borovetz, H.S.; Shaffer, F.; Schaub, R.; Lund, L.; Woodard, J.

1999-01-01T23:59:59.000Z

328

From the Milwaukee/Waukesha Area: Take I-94 West. As you approach Madison, watch for Exit 4A LEFT  

E-Print Network (OSTI)

directions at right. From the Wausau/Stevens Point Area: Take I-39/Hwy. 51 South. At Portage, I-39 mergesFrom the Milwaukee/Waukesha Area: Take I-94 West. As you approach Madison, watch for Exit 4A LEFT. From Hwy 12/18, follow directions at right. From the Fond du Lac/Oshkosh/Appleton/Green Bay Area: Take

Wisconsin at Madison, University of

329

High-aperture binary axicons for the formation of the longitudinal electric field component on the optical axis for linear and circular polarizations of the illuminating beam  

SciTech Connect

Diffraction of uniformly polarized laser beams with vortex phase singularity is theoretically analyzed using the plane wave expansion. It is shown that for a high numerical aperture, an intense longitudinal electric field component is formed on the optical axis in this case. It is numerically demonstrated that an analogous effect is ensured for diffraction of a conventional Gaussian beam from asymmetric binary axicons. The field intensity on the optical axis can be varied either by rotating the optical element or by changing the direction of polarization of radiation.

Khonina, S. N., E-mail: khonina@smr.ru; Savelyev, D. A., E-mail: dmitrey.savelyev@yandex.ru [Russian Academy of Sciences, Institute for Image Processing Systems (Russian Federation)

2013-10-15T23:59:59.000Z

330

Left-Right Symmetry and the Charged Higgs Bosons at the LHC  

E-Print Network (OSTI)

The charged Higgs boson sector of the Minimal Manifest Left-Right Symmetric model (MLRSM) is investigated in the context of LHC discovery search for new physics beyond Standard Model. We discuss and summarise the main processes within MLRSM where heavy charged Higgs bosons can be produced at the LHC. We explore the scenarios where the amplified signals due to relatively light charged scalars dominate against heavy neutral $Z_2$ and charged gauge $W_2$ as well as heavy neutral Higgs bosons signals which are dumped due to large vacuum expectation value $v_R$ of the right-handed scalar triplet. In particular, production processes with one and two doubly charged Higgs bosons are considered. We further incorporate the decays of those scalars leading to multi lepton signals at the LHC. Branching ratios for heavy neutrino $N_R$, $W_2$ and $Z_2$ decay into charged Higgs bosons are calculated. These effects are substantial enough and cannot be neglected. The tri- and four-lepton final states for different benchmark points are analysed. Kinematic cuts are chosen in order to strength the leptonic signals and decrease the Standard Model (SM) background. The results are presented using di-lepton invariant mass and lepton-lepton separation distributions for the same sign (SSDL) and opposite sign (OSDL) di-leptons as well as the charge asymmetry are also discussed. We have found that for considered MLRSM processes tri-lepton and four-lepton signals are most important for their detection when compared to the SM background. Both of the signals can be detected at 14 TeV collisions at the LHC with integrated luminosity at the level of $300 fb^{-1}$ with doubly charged Higgs bosons up to approximately 600 GeV. Finally, possible extra contribution of the charged MLRSM scalar particles to the measured Higgs to di-photon ($H_0^0 \\to \\gamma \\gamma$) decay is computed and pointed out.

G. Bambhaniya; J. Chakrabortty; J. Gluza; M. Kordiaczynska; R. Szafron

2014-04-15T23:59:59.000Z

331

Risk Factors Predictive of Right Ventricular Failure After Left Ventricular Assist Device Implantation  

Science Journals Connector (OSTI)

Right ventricular failure (RVF) after left ventricular assist device (LVAD) implantation appears to be associated with increased mortality. However, the determination of which patients are at greater risk of developing postoperative RVF remains controversial and relatively unknown. We sought to determine the preoperative risk factors for the development of RVF after LVAD implantation. The data were obtained for 175 consecutive patients who had received an LVAD. RVF was defined by the need for inhaled nitric oxide for ?48 hours or intravenous inotropes for >14 days and/or right ventricular assist device implantation. An RVF risk score was developed from the ? coefficients of the independent variables from a multivariate logistic regression model predicting RVF. Destination therapy (DT) was identified as the indication for LVAD implantation in 42% of our patients. RVF after LVAD occurred in 44% of patients (n = 77). The mortality rates for patients with RVF were significantly greater at 30, 180, and 365 days after implantation compared to patients with no RVF. By multivariate logistic regression analysis, 3 preoperative factors were significantly associated with RVF after LVAD implantation: (1) a preoperative need for intra-aortic balloon counterpulsation, (2) increased pulmonary vascular resistance, and (3) DT. The developed RVF risk score effectively stratified the risk of RV failure and death after LVAD implantation. In conclusion, given the progressively growing need for DT, the developed RVF risk score, derived from a population with a large percentage of DT patients, might lead to improved patient selection and help stratify patients who could potentially benefit from early right ventricular assist device implantation.

Stavros G. Drakos; Lindsay Janicki; Benjamin D. Horne; Abdallah G. Kfoury; Bruce B. Reid; Stephen Clayson; Kenneth Horton; Francois Haddad; Dean Y. Li; Dale G. Renlund; Patrick W. Fisher

2010-01-01T23:59:59.000Z

332

Features of Muon Arrival Time Distributions of High Energy EAS at Large Distances From the Shower Axis  

E-Print Network (OSTI)

In view of the current efforts to extend the KASCADE experiment (KASCADE-Grande) for observations of Extensive Air Showers (EAS) of primary energies up to 1 EeV, the features of muon arrival time distributions and their correlations with other observable EAS quantities have been scrutinised on basis of high-energy EAS, simulated with the Monte Carlo code CORSIKA and using in general the QGSJET model as generator. Methodically various correlations of adequately defined arrival time parameters with other EAS parameters have been investigated by invoking non-parametric methods for the analysis of multivariate distributions, studying the classification and misclassification probabilities of various observable sets. It turns out that adding the arrival time information and the multiplicity of muons spanning the observed time distributions has distinct effects improving the mass discrimination. A further outcome of the studies is the feature that for the considered ranges of primary energies and of distances from the shower axis the discrimination power of global arrival time distributions referring to the arrival time of the shower core is only marginally enhanced as compared to local distributions referring to the arrival of the locally first muon.

I. M. Brancus; H. Rebel; A. F. Badea; A. Haungs; C. D. Aiftimiei; J. Oehlschlaeger; M. Duma

2002-12-20T23:59:59.000Z

333

Integral-Field Spectroscopy of the Post Red Supergiant IRC +10420: evidence for an axi-symmetric wind  

E-Print Network (OSTI)

We present NAOMI/OASIS adaptive-optics assisted integral-field spectroscopy of the transitional massive hypergiant IRC +10420, an extreme mass-losing star apparently in the process of evolving from a Red Supergiant toward the Wolf-Rayet phase. To investigate the present-day mass-loss geometry of the star, we study the appearance of the line-emission from the inner wind as viewed when reflected off the surrounding nebula. We find that, contrary to previous work, there is strong evidence for wind axi-symmetry, based on the equivalent-width and velocity variations of H$\\alpha$ and Fe {\\sc ii} $\\lambda$6516. We attribute this behaviour to the appearance of the complex line-profiles when viewed from different angles. We also speculate that the Ti {\\sc ii} emission originates in the outer nebula in a region analogous to the Strontium Filament of $\\eta$ Carinae, based on the morphology of the line-emission. Finally, we suggest that the present-day axisymmetric wind of IRC +10420, combined with its continued blueward evolution, is evidence that the star is evolving toward the B[e] supergiant phase.

Ben Davies; René D. Oudmaijer; Kailash C. Sahu

2007-08-16T23:59:59.000Z

334

Status of Advanced Tokamak Scenario Modeling with Off-Axis Electron Cyclotron Current Drive in DIII-D  

SciTech Connect

The status of modeling work focused on developing the advanced tokamak scenarios in DIII-D is discussed. The objectives of the work are two-fold: (1) to develop AT scenarios with ECCD using time-dependent transport simulations, coupled with heating and current drive models, consistent with MHD equilibrium and stability; and (2) to use time-dependent simulations to help plan experiments and to understand the key physics involved. Time-dependent simulations based on transport coefficients derived from experimentally achieved target discharges are used to perform AT scenario modeling. The modeling indicates off-axis ECCD with approximately 3 MW absorbed power can maintain high-performance discharges with q{sub min} > 1 for 5 to 10 s. The resultant equilibria are calculated to be stable to n = 1 pressure driven modes. The plasma is well into the second stability regime for high-n ballooning modes over a large part of the plasma volume. The role of continuous localized ECCD is studied for stabilizing m/n = 2/1 tearing modes. The progress towards validating current drive and transport models, consistent with experimental results, and developing self-consistent, integrated high performance AT scenarios is discussed.

M. Murakami; H.E. St.John; T.A. Casper; M.S. Chu; J.C. DeBoo; C.M. Greenfield; J.E. Kinsey; L.L. Lao; R.J. La Haye; Y.R. Lin-Liu; T.C. Luce; P.A. Politzer; B.W. Rice; G.M. Staebler; T.S. Taylor; M.R. Wade

1999-12-01T23:59:59.000Z

335

The detection efficiency of on-axis short gamma ray burst optical afterglows triggered by aLIGO/Virgo  

E-Print Network (OSTI)

Assuming neutron star (NS) or neutron star/stellar-mass black hole (BH) mergers as progenitors of the short gamma ray bursts, we derive and demonstrate a simple analysis tool for modelling the efficiency of recovering on-axis optical afterglows triggered by a candidate gravitational wave event detected by the Advanced LIGO and Virgo network. The coincident detection effiency has been evaluated for different classes of operating telescopes using observations of gamma ray bursts. We show how the efficiency depends on the luminosity distribution of the optical afterglows, the telescope features, and the sky localisation of gravitational wave triggers. We estimate a plausible optical afterglow and gravitational wave coincidence rate of $1$ yr$^{-1}$ ($0.1$ yr$^{-1}$) for NS-NS (NS-BH), and how this rate is scaled down in detection efficiency by the time it takes to image the gravitational wave sky localization and the limiting magnitude of the telescopes. For NS-NS (NS-BH) we find maximum detection efficiencies o...

Coward, David; Howell, Eric; Lasky, Paul; Boer, Michel

2014-01-01T23:59:59.000Z

336

Three mirror off axis integrated cavity output spectroscopy for the detection of ethylene using a quantum cascade laser  

Science Journals Connector (OSTI)

Abstract We demonstrate the performance of a compact and robust gas sensor based on a pulsed distributed feedback quantum cascade laser (QCL, laser pulses 30 ns, repetition rate 1 MHz) in combination with off-axis integrated cavity output spectroscopy (OA-ICOS) in an improved 3 mirror configuration. The room temperature laser (wavelength 915 cm?1) was wavelength tuned over ?0.25 cm?1 with a 4 kHz repetition frequency. A detection limit of 10 ppbv (part-per-billion volume) for regular OA-ICOS is demonstrated for ethylene in 2 min averaging time, which is equal to a noise equivalent absorption sensitivity (NEAS) of 1 × 10?8 cm?1 Hz?1/2. An improved three mirror configuration OA-ICOS scheme showed a four times increase in sensitivity as compared to standard OA-ICOS, resulting in a NEAS of 2.5 × 10?9 cm?1 Hz?1/2. The sensor was used for ethylene detection from apples, stored under controlled atmosphere conditions.

R. Centeno; J. Mandon; S.M. Cristescu; F.J.M. Harren

2014-01-01T23:59:59.000Z

337

Fast In Situ Airborne Measurement of Ammonia Using a Mid-Infrared Off-Axis ICOS Spectrometer  

SciTech Connect

A new ammonia (NH3) spectrometer was developed based on off-axis integrated cavity output spectroscopy. Its feasibility was demonstrated in airborne test flights in the troposphere on board of the Department of Energy (DOE) Gulfstream-1 (G-1) aircraft. This ammonia gas analyzer consists of an optical cell, a quantum-cascade laser, gas sampling system, electronics for control and data acquisition, and data-analysis software. The NH3 mixing ratio is determined from high-resolution NH3 absorption line shapes by tuning the laser wavelength over the sR(3,K) transition of the fundamental vibration band near 9.67 ?m. Excellent linearity is obtained in a wide range (0- 101 ppb) during calibration. The instrument is capable of collecting data at 2 Hz. Two research flights were conducted over Sunnyside, Washington. In the first test flight, the ammonia gas sensor was used to identify signatures of feedstock from local dairy farms with high vertical spatial resolution under low wind and stable atmospheric conditions. In the second flight, the NH3 spectrometer showed high sensitivity in capturing feedstock emission signals under windy and less stable conditions. Our results demonstrate that this new ammonia spectrometer is airborne feasible and that it has the capability to provide fast in situ observations of ammonia to advance our understanding of atmospheric compositions and aerosol formation.

Leen, Brian; Yu, Xiao-Ying; Gupta, Manish; Baer, Douglas S.; Hubbe, John M.; Kluzek, Celine D.; Tomlinson, Jason M.; Hubbell, Michael R.

2013-09-17T23:59:59.000Z

338

One-Axis Trackers -- Improved Reliability, Durability, Performance, and Cost Reduction; Final Subcontract Technical Status Report, 2 May 2006 - 31 August 2007  

SciTech Connect

The overall objective of this subcontract is to reduce the total cost of electricity generated by single-axis tracking solar energy systems for utility and other large-scale commercial applications by improving performance and reliability and by reducing installation time, cost, and environmental impact.

Shingleton, J.

2008-02-01T23:59:59.000Z

339

Cheliensisin A Inhibits EGF-Induced Cell Transformation with Stabilization of p53 Protein Via a Hydrogen Peroxide/Chk1-Dependent Axis  

Science Journals Connector (OSTI)

...activation of p53 by hydrogen peroxide/Chk1-dependent axis. Materials and Methods Chemicals Chel A [6...Chel A using the same method as was used for the...used to monitor the production of hydrogen peroxide, with the...

Jingjie Zhang; Guangxun Gao; Liang Chen; Xu Deng; Jingxia Li; Yonghui Yu; Dongyun Zhang; Fei Li; Min Zhang; Qinshi Zhao; and Chuanshu Huang

2013-09-01T23:59:59.000Z

340

Small molecules activators of the Nrf2-HO-1 antioxidant axis modulate heme metabolism and inflammation in BV2 microglia cells  

E-Print Network (OSTI)

1 Small molecules activators of the Nrf2-HO-1 antioxidant axis modulate heme metabolism, 16163 Genova, Italy d Department of Clinical and Molecular Biomedicine, Section of Pharmacology-associated protein-1; INF- , interferon- ISL, isoliquiritigenin; LPS, lipopolysaccharide; Nrf2, HF-E2 p45-related

Boyer, Edmond

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

A Configurable Single-Axis, Multi-Parameter Lens Camera Morgan McGuire John F. Hughes Wojciech Matusik Hanspeter Pfister Frdo Durand Shree Nayar  

E-Print Network (OSTI)

for the increased light. One of the f /1.4 sensors is focussed on the background and one on the actor. An optimizer. This allows multiple video sensors to share an optical center. At each sensor, we vary the imaging parameters a small number of single-axis sensors for a specific application. We believe SAMPL is the first to support

Durand, Frédo

342

he defining element of modern wind farms is the pro-peller-like structure known as a horizontal-axis wind  

E-Print Network (OSTI)

T he defining element of modern wind farms is the pro- peller-like structure known as a horizontal-axis wind turbine.Amarvel of engineering, the HAWT typically comprises more than 8000 parts, and its blades it converts wind energy into electricity. In 1920 Albert Betz derived a theoretical limit on that efficiency

Dabiri, John O.

343

A conceptual study of floating axis water current turbine for low-cost energy capturing from river, tide and ocean currents  

Science Journals Connector (OSTI)

The cost of utilizing kinetic energy of river stream, tidal and ocean current is considered to be higher than that of wind power generation because of difficulties in construction and maintenance of devices installed in seawater. As a solution to the problem, the authors propose a new concept of water stream turbine. The main idea is in the manner of supporting turbine. Although it is similar to a vertical axis turbine, the direction of turbine axis is not firmly fixed and its tilt angle is passively adjustable to the stream velocity. Since it does not have to keep the turbine axis in upright position, required structural strength and weight of the device will be reduced significantly. This paper describes the application ranging from the small hydro power in river streams to large application of tidal and ocean current turbine. In the large capacity plant for tidal stream and ocean current, the main mechanism of turbine axis support is the same as that of the wind turbine authors proposed in the previous paper. It leads to the further opportunity of cost reduction. The sample design of a multi-megawatt ocean current turbine shows the possibility of high economic performance of the concept. The results show that the cost of energy in the concept can be comparable to a land based wind turbine.

Hiromichi Akimoto; Kenji Tanaka; Kiyoshi Uzawa

2013-01-01T23:59:59.000Z

344

Three-Dimensional Descriptions Based on the Analysis of the Invariant and Quasi-Invariant Properties of Some Curved-Axis Generalized Cylinders  

Science Journals Connector (OSTI)

Abstract¿We address the recovery of object-level 3-D descriptions of some classes of curved-axis generalized cylinders. For this, the first part of the paper analyzes the projective properties of two common generic shapes, planar right constant generalized ... Keywords: Shape description, generalized cylinders, invariants, quasi-invariants, segmentation, grouping.

Mourad Zerroug; Ramakant Nevatia

1996-03-01T23:59:59.000Z

345

Disruption of Laminin-Integrin-CD151-Focal Adhesion Kinase Axis Sensitizes Breast Cancer Cells to ErbB2 Antagonists  

Science Journals Connector (OSTI)

...Adhesion Kinase Axis Sensitizes Breast Cancer Cells to ErbB2 Antagonists Xiuwei H. Yang 1 Ludmila M. Flores 2 4 Qinglin Li 1 Pengcheng Zhou 3 Fenghui Xu 1 Ian E. Krop 2 Martin E. Hemler 1 Corresponding Author: Martin E. Hemler, Dana-Farber Cancer Institute...

Xiuwei H. Yang; Ludmila M. Flores; Qinglin Li; Pengcheng Zhou; Fenghui Xu; Ian E. Krop; Martin E. Hemler

2010-03-15T23:59:59.000Z

346

West Bound I-90: Take Missoula's first exit onto Van Buren Street, turn left at the stop sign and merge into the right lane.  

E-Print Network (OSTI)

and merge into the right lane. 1. At the stop light, turn right onto Broadway Street. 2. Move down Arthur Street after the light. Watch the 25 mph speed limit. Turn left at the light on BeckwithWest Bound I-90: Take Missoula's first exit onto Van Buren Street, turn left at the stop sign

Vonessen, Nikolaus

347

CIS 262 Fall 2013: Solutions to Homework 6 One direction is easy; Left Reset Turing machine can obviously be simulated by a regular Turing machine  

E-Print Network (OSTI)

machine can obviously be simulated by a regular Turing machine: Moving the head to right is the same. A regular Turing machine can simulate Reset by moving its head to the left-hand end of the tape denoted by a dotted character. Now we will show that Left Reset machine can simulate regular TM. Again moving the head

Plotkin, Joshua B.

348

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 1. Executive summary  

SciTech Connect

Contents: Introduction and Summary of Results; Facility Background; Facility Emissions; Atmospheric Dispersion and Deposition Modeling of Emissions; Human Health Risk Assessment; Screening Ecological Risk Assessment; Accident Analysis; Additional Analysis in Response to Peer Review Recommendations; References.

NONE

1997-05-01T23:59:59.000Z

349

Volatility regimes, asymmetric basis effects and forecasting performance: An empirical investigation of the WTI crude oil futures market  

Science Journals Connector (OSTI)

This study employs a flexible regime-switching EGARCH model with Student-t distributed error terms to investigate whether volatility regimes and basis affect the behavior of crude oil futures returns, including the conditional mean, variance, skewness, kurtosis as well as the extent of heavy-tailedness. The study also examines whether volatility regimes and asymmetric basis effects can improve the forecasting accuracy. The main merit of the empirical model is that the basis effect is allowed to be asymmetric and to vary across volatility regimes. Empirical results suggest that the conditional mean and variance respond to the basis asymmetrically and nonlinearly, and that the responses of transition probabilities to the basis are symmetric. Furthermore, the conditional higher moments are sensitive to the absolute value of basis, and the heavy tailed characteristic can be greatly alleviated by taking into account the asymmetric basis effects and regime switches. Finally, the regime switches and asymmetric basis effects play decisive roles in forecasting return, volatility and tail distribution.

Kuang-Liang Chang

2012-01-01T23:59:59.000Z

350

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 2. Introduction. Draft report  

SciTech Connect

This volume provides a description of the facility, and its location and setting in the three-state area of Ohio, Pennsylvania, and West Virginia; an overview of previous risk assessments conducted by U.S. EPA for this site, including the preliminary assessment of inhalation exposure and the screening-level risk analyses of indirect exposure; and a summary of comments provided by the Peer Review Panel on the Project Plan.

NONE

1995-11-01T23:59:59.000Z

351

-1 -0.5 0 0.5 1 Left system with Double-Geodesic control law  

E-Print Network (OSTI)

;#12;#12;#12;#12;#12;#12;#12;#12;-1 -0.5 0 0.5 1 -1 -0.5 0 0.5 1 x (cm) y(cm) Left system with Double-Geodesic control law -1 -0.5 0 0 (cm) y(cm) Right system with Double-Geodesic control law -1 -0.5 0 0.5 1 -1 -0.5 0 0.5 1 x (cm) y with Double-Geodesic control law -1 -0.5 0 0.5 1 -1 -0.5 0 0.5 1 x (cm) y(cm) Left system with Log control law

Murray, Richard M.

352

Hadron structure and left-right asymmetry in inclusive production in single-spin hadron-hadron collisions  

Science Journals Connector (OSTI)

Theoretical arguments and experimental facts are presented which show the following. Left-right asymmetries are expected to exist in a number of single-spin inclusive production processes. Measuring such asymmetries by using different types of projectile-target combinations, one can obtain useful information on the spin structure of hadrons in general, and determine the spin-dependent quark distribution functions in particular. Quantitative predictions for these asymmetries in various reactions are presented.

C. Boros; Liang Zuo-tang; Meng Ta-chung

1995-05-01T23:59:59.000Z

353

Double Beta Decay, Lepton Flavour Violation and Collider Signatures of Left-Right Symmetric Models with Spontaneous D Parity Breaking  

E-Print Network (OSTI)

We propose a class of left-right symmetric models (LRSMs) with spontaneous D parity breaking, where SU(2)_R breaks at the TeV scale while discrete left-right symmetry breaks around 10^9 GeV. By embedding this framework in a non-supersymmetric SO(10) Grand Unified Theory (GUT) with Pati-Salam symmetry as the highest intermediate breaking step, we obtain g_R / g_L ~ 0.6 between the right- and left-handed gauge couplings at the TeV scale. This leads to a suppression of beyond the Standard Model phenomena induced by the right-handed gauge coupling. Here we focus specifically on the consequences for neutrinoless double beta decay, low energy lepton flavour violation and LHC signatures due to the suppressed right handed currents. Interestingly, the reduced g_R allows us to interpret an excess of events observed recently in the range of 1.9 TeV to 2.4 TeV by the CMS group at the LHC as the signature of a right handed gauge boson in LRSMs with spontaneous D parity breaking. Moreover, the reduced right-handed gauge co...

Deppisch, Frank F; Patra, Sudhanwa; Sahu, Narendra; Sarkar, Utpal

2014-01-01T23:59:59.000Z

354

Mixed convection flow and heat transfer in entrance region of rectangular ducts rotating about a parallel axis  

SciTech Connect

The objective of the present work is to investigate the laminar mixed convection flow and heat transfer in the entrance region of heated rectangular ducts rotating about a parallel axis. Heating conditions of isothermal and iso-flux are both considered. Boussinesq approximation is invoked to take into account buoyancy effect induced by centrifugal force. Navier-Stokes/Boussinesq system can be cast into a dimensionless form, in which five governing parameters, the Prandtl number Pr, rotational Reynolds number J, rotational Grashof number Gr{sub {Omega}}, aspect ratio {gamma} and the eccentricity E, are involved. Mechanisms of secondary vortex development in the ducts are explored by a theoretical analysis on vorticity transport equation. The values of Pr and E are fixed as 0.7 and 10, respectively. For various combinations of the other thee parameters, a vorticity-velocity method implemented with a marching technique is employed to solve the resultant three-dimensional system for simultaneously developing flow and temperature fields. The emphasis is placed on the rotational effects, including both coriolis force and centrifugal buoyancy; on the non-isothermal flow and the related heat transfer. The results reveal that the friction factors and heat transfer rates can be enhanced by Coriolis and rotation-induced buoyancy effects; and the variations of the local values are closely related to the evolution of the secondary vortices in ducts. The differences in flow behaviors and thermal characteristics for UWT and UHF are also investigated by the present theoretical analysis on secondary flow mechanism as well as the computational results.

Soong, C.Y. [Chung Cheng Inst. of Tech., Taoyuan (Taiwan, Province of China). Dept. of Aeronautical Engineering; Yan, W.M. [Hua Fan Coll. of Humanities and Technology, Taipei (Taiwan, Province of China). Dept. of Mechanical Engineering

1995-12-31T23:59:59.000Z

355

Offshore floating vertical axis wind turbines, dynamics modelling state of the art. Part III: Hydrodynamics and coupled modelling approaches  

Science Journals Connector (OSTI)

Abstract The need to further exploit offshore wind resources has pushed offshore wind farms into deeper waters, requiring the use of floating support structures to be economically sustainable. The use of conventional wind turbines may not continue to be the optimal design for floating applications. Therefore it is important to assess other alternative configurations in this context. Vertical axis wind turbines (VAWTs) are one promising configuration, and it is important to first understand the coupled and relatively complex dynamics of floating \\{VAWTs\\} to assess the technical feasibility. As part of this task, a series of articles have been developed to present a comprehensive literature review covering the various areas of engineering expertise required to understand the coupled dynamics involved in floating VAWTs. This third article focuses on approaches to develop an efficient coupled model of dynamics (considering aerodynamics, hydrodynamics, structural and mooring line dynamics, and control dynamics) for floating VAWTs, as well as suitable ‘semi-analytical’ hydrodynamic models for this type of coupled dynamics models. Emphasis is also placed on utilising computationally efficient models and programming strategies. A comparison of the various forces acting on a floating VAWT with the three main floating support structure (spar, semi-submersible and tension-leg-platform) is also presented to highlight the relative dominant forces and hence importance of model accuracy representing these forces. Lastly a concise summary covering this series of articles is presented to give the reader an overview of this interdisciplinary research area. This article has been written both for researchers new to this research area, outlining underlying theory whilst providing a comprehensive review of the latest work, and for experts in this area, providing a comprehensive list of the relevant references where the details of modelling approaches may be found.

Michael Borg; Maurizio Collu

2014-01-01T23:59:59.000Z

356

We have completed installing our upgraded Multi-Technique Spectrometer/Diffractometer (Slides 3-6), together with a newly completed five-axis variable-temperature sample manipulator (Slides 7-9), other  

E-Print Network (OSTI)

We have completed installing our upgraded Multi-Technique Spectrometer/Diffractometer (Slides 3-6), together with a newly completed five-axis variable-temperature sample manipulator (Slides 7-9), other mechanical upgrades to improve spectrometer rotation and provide a sixth axis of sample rotation (Slide 10

Fadley, Charles

357

Accessibility in 5-Axis G. Elber 13 12] I. D. Faux and M. J. Pratt. Computational Geometry for Design and Man-  

E-Print Network (OSTI)

;; ; vPPPi 6 Figure 9: Using the MS mapping imposed by the teapot body, the spout and the handle from, the hidden portion of the body of the teapot from Figure 9 is trimmed away. Left is the domain of the body

Utah, University of

358

Influence of compensator thickness, field size, and off-axis distance on the effective attenuation coefficient of a cerrobend compensator for intensity-modulated radiation therapy  

SciTech Connect

Intensity-modulated radiation therapy (IMRT) can be performed by using compensators. To make a compensator for an IMRT practice, it is required to calculate the effective attenuation coefficient (?{sub eff}) of its material, which is affected by various factors. We studied the effect of the variation of the most important factors on the calculation of the ?{sub eff} of the cerrobend compensator for 6-MV photon beams, including the field size, compensator thickness, and off-axis distance. Experimental measurements were carried out at 100 cm source-to-surface distance and 10 cm depth for the 6-MV photon beams of an Elekta linac using various field size, compensator thickness, and off-axis settings. The field sizes investigated ranged from 4 × 4 to 25 × 25 cm{sup 2} and the cerrobend compensator thicknesses from 0.5–6 cm. For a fixed compensator thickness, variation of the ?{sub eff} with the field size ranged from 3.7–6.8%, with the highest value attributed to the largest compensator thickness. At the reference field size of 10 × 10 cm{sup 2}, the ?{sub eff} varied by 16.5% when the compensator thickness was increased from 0.5–6 cm. However, the variation of the ?{sub eff} with the off-axis distance was only 0.99% at this field size, whereas for the largest field size, it was more significant. Our results indicated that the compensator thickness and field size have the most significant effect on the calculation of the compensator ?{sub eff} for the 6-MV photon beam. Therefore, it is recommended to consider these parameters when calculating the compensator thickness for an IMRT practice designed for these beams. The off-axis distance had a significant effect on the calculation of the ?{sub eff} only for the largest field size. Hence, it is recommended to consider the effect of this parameter only for field sizes larger than 25 × 25 cm{sup 2}.

Haghparast, Abbas [Department of Medical Physics, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Hashemi, Bijan, E-mail: bhashemi@modares.ac.ir [Department of Medical Physics, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Eivazi, Mohammad Taghi [Department of Medical Physics, Faculty of Medicine, Kermanshah University of Medical Sciences, Kermanshah, Islamic Republic of Iran (Iran, Islamic Republic of)

2013-04-01T23:59:59.000Z

359

Measurement of \\boldmath $R = {\\mathcal{B}\\left(t \\rightarrow Wb \\right)/\\mathcal{B}\\left(t \\rightarrow Wq \\right)} $ in Top--Quark--Pair Decays using Dilepton Events and the Full CDF Run II Data Set  

E-Print Network (OSTI)

We present a measurement of the ratio of the top-quark branching fractions $R=\\mathcal{B}(t\\rightarrow Wb)/\\mathcal{B}(t\\rightarrow $ $q$ represents quarks of flavors $b$, $s$, or $d$, in the final state, in events with two charged leptons, missing transverse energy and at least two jets. The measurement uses $\\sqrt{s}$ = 1.96 TeV proton--antiproton collision data corresponding to an integrated luminosity of 8.7 fb$^{-1}$ and collected with the Collider Detector at Fermilab during Run II of the Tevatron. We measure $R=0.87 \\pm 0.07$ (stat+syst), and extract the magnitude of the Cabibbo-Kobayashi-Maskawa matrix element, $\\left|V_{tb}\\right| = 0.93 \\pm 0.04$ (stat+syst) assuming three generations of quarks. Under these assumptions, a lower limit of $|V_{tb}|>0.85$ at 95% credibility level is set.

CDF Collaboration; T. Aaltonen; S. Amerio; D. Amidei; A. Anastassov; A. Annovi; J. Antos; G. Apollinari; J. A. Appel; T. Arisawa; A. Artikov; J. Asaadi; W. Ashmanskas; B. Auerbach; A. Aurisano; F. Azfar; W. Badgett; T. Bae; A. Barbaro-Galtieri; V. E. Barnes; B. A. Barnett; P. Barria; P. Bartos; M. Bauce; F. Bedeschi; S. Behari; G. Bellettini; J. Bellinger; D. Benjamin; A. Beretvas; A. Bhatti; K. R. Bland; B. Blumenfeld; A. Bocci; A. Bodek; D. Bortoletto; J. Boudreau; A. Boveia; L. Brigliadori; C. Bromberg; E. Brucken; J. Budagov; H. S. Budd; K. Burkett; G. Busetto; P. Bussey; P. Butti; A. Buzatu; A. Calamba; S. Camarda; M. Campanelli; F. Canelli; B. Carls; D. Carlsmith; R. Carosi; S. Carrillo; B. Casal; M. Casarsa; A. Castro; P. Catastini; D. Cauz; V. Cavaliere; M. Cavalli-Sforza; A. Cerri; L. Cerrito; Y. C. Chen; M. Chertok; G. Chiarelli; G. Chlachidze; K. Cho; D. Chokheli; A. Clark; C. Clarke; M. E. Convery; J. Conway; M. Corbo; M. Cordelli; C. A. Cox; D. J. Cox; M. Cremonesi; D. Cruz; J. Cuevas; R. Culbertson; N. d'Ascenzo; M. Datta; P. de Barbaro; L. Demortier; L. Marchese; M. Deninno; F. Devoto; M. D'Errico; A. Di Canto; B. Di Ruzza; J. R. Dittmann; M. D'Onofrio; S. Donati; M. Dorigo; A. Driutti; K. Ebina; R. Edgar; A. Elagin; R. Erbacher; S. Errede; B. Esham; S. Farrington; J. P. Fernández Ramos; R. Field; G. Flanagan; R. Forrest; M. Franklin; J. C. Freeman; H. Frisch; Y. Funakoshi; C. Galloni; A. F. Garfinkel; P. Garosi; H. Gerberich; E. Gerchtein; S. Giagu; V. Giakoumopoulou; K. Gibson; C. M. Ginsburg; N. Giokaris; P. Giromini; G. Giurgiu; V. Glagolev; D. Glenzinski; M. Gold; D. Goldin; A. Golossanov; G. Gomez; G. Gomez-Ceballos; M. Goncharov; O. González López; I. Gorelov; A. T. Goshaw; K. Goulianos; E. Gramellini; S. Grinstein; C. Grosso-Pilcher; R. C. Group; J. Guimaraes da Costa; S. R. Hahn; J. Y. Han; F. Happacher; K. Hara; M. Hare; R. F. Harr; T. Harrington-Taber; K. Hatakeyama; C. Hays; J. Heinrich; M. Herndon; A. Hocker; Z. Hong; W. Hopkins; S. Hou; R. E. Hughes; U. Husemann; M. Hussein; J. Huston; G. Introzzi; M. Iori; A. Ivanov; E. James; D. Jang; B. Jayatilaka; E. J. Jeon; S. Jindariani; M. Jones; K. K. Joo; S. Y. Jun; T. R. Junk; M. Kambeitz; T. Kamon; P. E. Karchin; A. Kasmi; Y. Kato; W. Ketchum; J. Keung; B. Kilminster; D. H. Kim; H. S. Kim; J. E. Kim; M. J. Kim; S. B. Kim; S. H. Kim; Y. K. Kim; Y. J. Kim; N. Kimura; M. Kirby; K. Knoepfel; K. Kondo; D. J. Kong; J. Konigsberg; A. V. Kotwal; M. Kreps; J. Kroll; M. Kruse; T. Kuhr; M. Kurata; A. T. Laasanen; S. Lammel; M. Lancaster; K. Lannon; G. Latino; H. S. Lee; J. S. Lee; S. Leo; S. Leone; J. D. Lewis; A. Limosani; E. Lipeles; A. Lister; H. Liu; Q. Liu; T. Liu; S. Lockwitz; A. Loginov; A. Lucà; D. Lucchesi; J. Lueck; P. Lujan; P. Lukens; G. Lungu; J. Lys; R. Lysak; R. Madrak; P. Maestro; S. Malik; G. Manca; A. Manousakis-Katsikakis; F. Margaroli; P. Marino; M. Martínez; K. Matera; M. E. Mattson; A. Mazzacane; P. Mazzanti; R. McNulty; A. Mehta; P. Mehtala; C. Mesropian; T. Miao; D. Mietlicki; A. Mitra; H. Miyake; S. Moed; N. Moggi; C. S. Moon; R. Moore; M. J. Morello; A. Mukherjee; Th. Muller; P. Murat; M. Mussini; J. Nachtman; Y. Nagai; J. Naganoma; I. Nakano; A. Napier; J. Nett; C. Neu; T. Nigmanov; L. Nodulman; S. Y. Noh; O. Norniella; L. Oakes; S. H. Oh; Y. D. Oh; I. Oksuzian; T. Okusawa; R. Orava; L. Ortolan; C. Pagliarone; E. Palencia; P. Palni; V. Papadimitriou; W. Parker; G. Pauletta; M. Paulini; C. Paus; T. J. Phillips; G. Piacentino; E. Pianori; J. Pilot; K. Pitts; C. Plager; L. Pondrom; S. Poprocki; K. Potamianos; F. Prokoshin; A. Pranko; F. Ptohos; G. Punzi; N. Ranjan; I. Redondo Fernández; P. Renton; M. Rescigno; F. Rimondi; L. Ristori; A. Robson; T. Rodriguez; S. Rolli; M. Ronzani; R. Roser; J. L. Rosner; F. Ruffini; A. Ruiz; J. Russ; V. Rusu; W. K. Sakumoto; Y. Sakurai; L. Santi; K. Sato; V. Saveliev; A. Savoy-Navarro; P. Schlabach; E. E. Schmidt; T. Schwarz; L. Scodellaro; F. Scuri; S. Seidel; Y. Seiya; A. Semenov; F. Sforza; S. Z. Shalhout; T. Shears; P. F. Shepard; M. Shimojima; M. Shochet; I. Shreyber-Tecker; A. Simonenko; K. Sliwa; J. R. Smith; F. D. Snider; V. Sorin; H. Song; M. Stancari; R. St. Denis; D. Stentz; J. Strologas; Y. Sudo; A. Sukhanov; I. Suslov; K. Takemasa; Y. Takeuchi; J. Tang; M. Tecchio; P. K. Teng; J. Thom; E. Thomson; V. Thukral; D. Toback; S. Tokar; K. Tollefson; T. Tomura; D. Tonelli; S. Torre; D. Torretta; P. Totaro; M. Trovato; F. Ukegawa; S. Uozumi; F. Vázquez; G. Velev; C. Vellidis; C. Vernieri; M. Vidal; R. Vilar; J. Vizán; M. Vogel; G. Volpi; P. Wagner; R. Wallny; S. M. Wang; D. Waters; W. C. Wester III; D. Whiteson; A. B. Wicklund; S. Wilbur; H. H. Williams; J. S. Wilson; P. Wilson; B. L. Winer; P. Wittich; S. Wolbers; H. Wolfe; T. Wright; X. Wu; Z. Wu; K. Yamamoto; D. Yamato; T. Yang; U. K. Yang; Y. C. Yang; W. -M. Yao; G. P. Yeh; K. Yi; J. Yoh; K. Yorita; T. Yoshida; G. B. Yu

2014-04-13T23:59:59.000Z

360

Dosimetric Comparison of Intensity-Modulated Radiotherapy Plans, With or Without Anterior Myocardial Territory and Left Ventricle as Organs at Risk, in Early-Stage Left-Sided Breast Cancer Patients  

SciTech Connect

Purpose: We evaluated heart sparing using an intensity-modulated radiotherapy (IMRT) plan with the left ventricle (LV) and/or the anterior myocardial territory (AMT) as additional organs at risk (OARs). Methods and Materials: A total of 10 patients with left-sided breast cancer were selected for dosimetric planning. Both lungs, the right breast, heart, LV, and AMT were defined as OARs. We generated one tangential field plan and four IMRT plans for each patient. We examined the dose-volume histogram parameters of the planning target volume and OARs. Results: Compared with the tangential field plan, the mean dose to the heart in the IMRT plans did not show significant differences; however, the dose to the AMT and LV decreased by 18.7-45.4% and 10.8-37.4%, respectively. The maximal dose to the heart decreased by 18.6-35.3%, to the AMT by 22.0-45.1%, and to the LV by 23.5-45.0%, And the relative volumes of the heart (V{sub {>=}12}), AMT (V{sub >11}) and LV (V{sub >10}) decreased significantly with different levels, respectively. The volume of the heart, AMT, LV, both lungs, and right breast receiving {>=}5 Gy showed a significant increase. Compared with the IMRT (H) plan, the mean dose to the heart, AMT, and LV decreased by 17.5-21.5%, 25.2-29.8%, and 22.8-29.8% and the maximal dose by 13.6-20.6%, 23.1-29.6%, and 17.3-29.1%, respectively. The IMRT plans for both lungs and the right breast showed no significant differences. Conclusions: The IMRT plans with the addition of the AMT and/or LV as OARs considerably increased heart sparing. We recommend including the LV as an additional OAR in such plans.

Tan Wenyong [Key Laboratory of Molecular Biophysics of the Ministry of Education, Huazhong University of Science and Technology College of Life Science and Technology, Wuhan (China); Wang Xiaohong; Qiu Dasheng [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Liu Dong [Department of Radiology, Hubei Cancer Hospital, Wuhan (China); Jia Shaohui; Zeng Fanyu [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Chen Zhengwang [Key Laboratory of Molecular Biophysics of the Ministry of Education, Huazhong University of Science and Technology College of Life Science and Technology, Wuhan (China); Li Beihui; Xu Jiaozhen; Wei Lai [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Hu Desheng, E-mail: tanwyym@yahoo.com.cn [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China)

2011-12-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

A Voluntary Breath-Hold Treatment Technique for the Left Breast With Unfavorable Cardiac Anatomy Using Surface Imaging  

SciTech Connect

Purpose: Breath-hold (BH) treatments can be used to reduce cardiac dose for patients with left-sided breast cancer and unfavorable cardiac anatomy. A surface imaging technique was developed for accurate patient setup and reproducible real-time BH positioning. Methods and Materials: Three-dimensional surface images were obtained for 20 patients. Surface imaging was used to correct the daily setup for each patient. Initial setup data were recorded for 443 fractions and were analyzed to assess random and systematic errors. Real time monitoring was used to verify surface placement during BH. The radiation beam was not turned on if the BH position difference was greater than 5 mm. Real-time surface data were analyzed for 2398 BHs and 363 treatment fractions. The mean and maximum differences were calculated. The percentage of BHs greater than tolerance was calculated. Results: The mean shifts for initial patient setup were 2.0 mm, 1.2 mm, and 0.3 mm in the vertical, longitudinal, and lateral directions, respectively. The mean 3-dimensional vector shift was 7.8 mm. Random and systematic errors were less than 4 mm. Real-time surface monitoring data indicated that 22% of the BHs were outside the 5-mm tolerance (range, 7%-41%), and there was a correlation with breast volume. The mean difference between the treated and reference BH positions was 2 mm in each direction. For out-of-tolerance BHs, the average difference in the BH position was 6.3 mm, and the average maximum difference was 8.8 mm. Conclusions: Daily real-time surface imaging ensures accurate and reproducible positioning for BH treatment of left-sided breast cancer patients with unfavorable cardiac anatomy.

Gierga, David P., E-mail: dgierga@partners.org [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Harvard Medical School, Boston, Massachusetts (United States); Turcotte, Julie C. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)] [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Sharp, Gregory C. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States) [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Harvard Medical School, Boston, Massachusetts (United States); Sedlacek, Daniel E.; Cotter, Christopher R. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)] [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Taghian, Alphonse G. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States) [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Harvard Medical School, Boston, Massachusetts (United States)

2012-12-01T23:59:59.000Z

362

Variability assessment and mitigation in advanced VLSI manufacturing through design-manufacturing co-optimization  

E-Print Network (OSTI)

related to read stability; WTI (WTV) is write trip current (SINM increases and WTI decreases, as the transistor widthread ability and smaller WTI represents worse writeability.

Jeong, Kwangok

2011-01-01T23:59:59.000Z

363

Theory of Topological Phenomena in Condensed Matter Systems  

E-Print Network (OSTI)

topological insulators (WTI). However, a more surprisingBurgers vector and three WTI indices[144] is nonzero - whichin the case of the WTI. Thus far, the characterization of

Zhang, Yi

2012-01-01T23:59:59.000Z

364

The Smell of Petroleum: Health, Insecurity, and Citizenship in "Revolutionary" Ecuador  

E-Print Network (OSTI)

in relation to the international WTI price benchmark. 3 Inproducts, and can The WTI index is one of two internationalfor crude petroleum. WTI, the West Texas Intermediate, is

Welcome, Nicholas Scott

2013-01-01T23:59:59.000Z

365

Go Global Newsletter, Winter/Spring 2006  

E-Print Network (OSTI)

The World Tribunal on Iraq (WTI) held its final session inits inception and conduct. The WTI is one expression of themoral globalization. ” The WTI generated intense interest in

Global & International Studies

2006-01-01T23:59:59.000Z

366

Synergy of short gamma ray burst and gravitational wave observations: Constraining the inclination angle of the binary and possible implications for off-axis gamma ray bursts  

E-Print Network (OSTI)

Compact binary mergers are the strongest candidates for the progenitors of Short Gamma Ray Bursts (SGRBs). If a gravitational wave (GW) signal from the compact binary merger is observed in association with a SGRB, such a synergy can help us understand many interesting aspects of these bursts. We examine the accuracies with which a world wide network of gravitational wave interferometers would measure the inclination angle (the angle between the angular momentum axis of the binary and the observer's line of sight) of the binary. We compare the projected accuracies of GW detectors to measure the inclination angle of double neutron star (DNS) and neutron star-black hole (NS-BH) binaries for different astrophysical scenarios. We find that a 5 detector network can measure the inclination angle to an accuracy of $\\sim 5.1 (2.2)$ degrees for a DNS(NS-BH) system at 200 Mpc if the direction of the source as well as the redshift is known electromagnetically. We argue as to how an accurate estimation of the inclination angle of the binary can prove to be crucial in understanding off-axis GRBs, the dynamics and the energetics of their jets, and help the searches for (possible) orphan afterglows of the SGRBs.

K. G. Arun; Hideyuki Tagoshi; Chandra Kant Mishra; Archana Pai

2014-12-15T23:59:59.000Z

367

Synergy of short gamma ray burst and gravitational wave observations: Constraining the inclination angle of the binary and possible implications for off-axis gamma ray bursts  

Science Journals Connector (OSTI)

Compact binary mergers are the strongest candidates for the progenitors of short gamma ray bursts (SGRBs). If a gravitational wave signal from the compact binary merger is observed in association with a SGRB, such a synergy can help us understand many interesting aspects of these bursts. We examine the accuracies with which a worldwide network of gravitational wave interferometers would measure the inclination angle (the angle between the angular momentum axis of the binary and the observer’s line of sight) of the binary. We compare the projected accuracies of gravitational wave detectors to measure the inclination angle of double neutron star and neutron star–black hole binaries for different astrophysical scenarios. We find that a five-detector network can measure the inclination angle to an accuracy of ?5.1 (2.2) deg for a double neutron star (neutron star–black hole) system at 200 Mpc if the direction of the source as well as the redshift is known electromagnetically. We argue as to how an accurate estimation of the inclination angle of the binary can prove to be crucial in understanding off-axis GRBs, the dynamics and the energetics of their jets, and help the searches for (possible) orphan afterglows of the SGRBs.

K.?G. Arun; Hideyuki Tagoshi; Archana Pai; Chandra Kant Mishra

2014-07-22T23:59:59.000Z

368

Consistent Regional Heterogeneity of Passive Diastolic Stretch and Systolic Deformation in the Healthy Heart: Age-Related Changes in Left Ventricle Contractility  

Science Journals Connector (OSTI)

Abstract The consistency of the normal spatial distribution of segmental passive stretch (PreS) and systolic strain (SS) within the left ventricle was investigated and a recently proposed echocardiographic estimate of left ventricular (LV) contractility was used to detect contractility changes with age. Hereto, in 54 healthy subjects, segmental PreS and SS were measured on tissue Doppler images of six left ventricle walls. For each subject, a linear regression line was estimated through the segmental PreS and SS values. The slopes and intercepts of this PreS-SS relationship did not differ between age groups, suggesting no changes in LV contractility with age. Moreover, a consistent regional distribution of PreS was observed, with the highest values measured in the septum, resulting in a similar distribution of SS as a direct consequence of the Frank-Starling mechanism.

Ruta Jasaityte; Jan D'hooge; Lieven Herbots; Ana M. Daraban; Frank Rademakers; Piet Claus

2014-01-01T23:59:59.000Z

369

Investigating the Influence of the Added Mass Effect to Marine Hydrokinetic Horizontal-Axis Turbines Using a General Dynamic Wake Wind Turbine Code  

SciTech Connect

This paper describes a recent study to investigate the applicability of a horizontal-axis wind turbine (HAWT) structural dynamics and unsteady aerodynamics analysis program (FAST and AeroDyn respectively) to modeling the forces on marine hydrokinetic (MHK) turbines. This paper summarizes the added mass model that has been added to AeroDyn. The added mass model only includes flow acceleration perpendicular to the rotor disc, and ignores added mass forces caused by blade deflection. A model of the National Renewable Energy Laboratory's (NREL) Unsteady Aerodynamics Experiment (UAE) Phase VI wind turbine was analyzed using FAST and AeroDyn with sea water conditions and the new added mass model. The results of this analysis exhibited a 3.6% change in thrust for a rapid pitch case and a slight change in amplitude and phase of thrust for a case with 30{sup o} of yaw.

Maniaci, D. C.; Li, Y.

2011-10-01T23:59:59.000Z

370

Investigating the Influence of the Added Mass Effect to Marine Hydrokinetic Horizontal-Axis Turbines Using a General Dynamic Wake Wind Turbine Code: Preprint  

SciTech Connect

This paper describes a recent study to investigate the applicability of a horizontal-axis wind turbine (HAWT) structural dynamics and unsteady aerodynamics analysis program (FAST and AeroDyn respectively) to modeling the forces on marine hydrokinetic (MHK) turbines. It summarizes the added mass model that has been added to AeroDyn. The added mass model only includes flow acceleration perpendicular to the rotor disc, and ignores added mass forces caused by blade deflection. A model of the National Renewable Energy Laboratory's (NREL) Unsteady Aerodynamics Experiment (UAE) Phase VI wind turbine was analyzed using FAST and AeroDyn with sea water conditions and the new added mass model. The results of this analysis exhibited a 3.6% change in thrust for a rapid pitch case and a slight change in amplitude and phase of thrust for a case with 30 degrees of yaw.

Maniaci, D. C.; Li, Y.

2012-04-01T23:59:59.000Z

371

Aerodynamic characteristics of seven symmetrical airfoil sections through 180-degree angle of attack for use in aerodynamic analysis of vertical axis wind turbines  

SciTech Connect

When work began on the Darrieus vertical axis wind turbine (VAWT) program at Sandia National Laboratories, it was recognized that there was a paucity of symmetrical airfoil data needed to describe the aerodynamics of turbine blades. Curved-bladed Darrieus turbines operate at local Reynolds numbers (Re) and angles of attack (..cap alpha..) seldom encountered in aeronautical applications. This report describes (1) a wind tunnel test series conducted at moderate values of Re in which 0 less than or equal to ..cap alpha.. less than or equal to 180/sup 0/ force and moment data were obtained for four symmetrical blade-candidate airfoil sections (NACA-0009, -0012, -0012H, and -0015), and (2) how an airfoil property synthesizer code can be used to extend the measured properties to arbitrary values of Re (10/sup 4/ less than or equal to Re less than or equal to 10/sup 7/) and to certain other section profiles (NACA-0018, -0021, -0025).

Sheldahl, R E; Klimas, P C

1981-03-01T23:59:59.000Z

372

Investigating the Influence of the Added Mass Effect to Marine Hydrokinetic Horizontal-Axis Turbines Using a General Dynamic Wake Wind Turbine Code  

NLE Websites -- All DOE Office Websites (Extended Search)

Investigating the Influence of Investigating the Influence of the Added Mass Effect to Marine Hydrokinetic Horizontal-Axis Turbines Using a General Dynamic Wake Wind Turbine Code D.C. Maniaci Pennsylvania State University Y. Li National Renewable Energy Laboratory Presented at the Oceans 11 Conference Kona, Hawaii September 19-21, 2011 Conference Paper NREL/CP-5000-52306 October 2011 NOTICE The submitted manuscript has been offered by an employee of the Alliance for Sustainable Energy, LLC (Alliance), a contractor of the US Government under Contract No. DE-AC36-08GO28308. Accordingly, the US Government and Alliance retain a nonexclusive royalty-free license to publish or reproduce the published form of this contribution, or allow others to do so, for US Government purposes.

373

Left ventricular myocardial tagging  

Science Journals Connector (OSTI)

Since cardiac disease is the main cause of mortality in Western societies, the heart and its coronary supply have been extensively studied over the past centuries. While more recently, the focus has been mainl...

Frank E. Rademakers

2004-01-01T23:59:59.000Z

374

Left ventricular myocardial tagging  

Science Journals Connector (OSTI)

Nuclear Magnetic Resonance myocardial tagging is a potent non-invasive technique which enables the quantification of myocardial deformation, globally but also regionally at different time points during the car...

Frank E. Rademakers; Jan Bogaert

1997-06-01T23:59:59.000Z

375

A Novel Design of Balun using Left-Handed Transmission Line *Seungjun Lee, **Jong-Sik Lim, *Hoe-sung Yang, and *Sangwook Nam  

E-Print Network (OSTI)

A Novel Design of Balun using Left-Handed Transmission Line *Seungjun Lee, **Jong-Sik Lim, *Hoe circuits. More recently, a theory and implementation of a compact and practical LH-transmission line was developed by Caloz et al [5]. The LH-transmission line is the electrically dual of the conventional

Nam, Sangwook

376

Supplementary Figure 1: Bayesian 50% majority-rule consensus trees for the combined dataset of mitochondrial genes (left) and nuclear genes (right). Color coding distinguishes  

E-Print Network (OSTI)

1 Supplementary Figure 1: Bayesian 50% majority-rule consensus trees for the combined dataset of mitochondrial genes (left) and nuclear genes (right). Color coding distinguishes groups supported by PP 99 for individual nuclear genes: Rag-1, Rag-2 and C-mos. Color coding distinguishes groups supported by PP 99

377

I-95 traveling north or south Exit 47 to Route 34 west to Exit 1. Turn left onto Church Street South. 100 Church  

E-Print Network (OSTI)

two lights. At the third light, turn right onto Church St. South. 100 Church Street South. Pass hospital on your right and at the second light beyond York Street, turn right onto Church StreetI-95 traveling north or south Exit 47 to Route 34 west to Exit 1. Turn left onto Church Street

378

Figure 1. The dataset for the running example is excerpted at left, arranged in the typical manner for MVPA. The boxes at right introduce the dataset  

E-Print Network (OSTI)

Figure 1. The dataset for the running example is excerpted at left, arranged in the typical manner for MVPA. The boxes at right introduce the dataset representation used in later figures. In these boxes the "dataset-wise" scheme, the examples are relabeled prior to conducting the cross- validation, while

379

CSE IGERTCOMPUTATIONAL SCIENCE AND ENGINEERING IGERT QUARTERLy NEwSLETTER Simulations of a two-component fluid (left) using a phase field  

E-Print Network (OSTI)

CSE IGERTCOMPUTATIONAL SCIENCE AND ENGINEERING IGERT QUARTERLy NEwSLETTER Simulations of a two-component fluid (left) using a phase field model with dynamic adaptive mesh refinement (right). Hector Ceniceros patterns when a less viscous fluid (dyed water in the image) is injected into a more viscous fluid (clear

Bigelow, Stephen

380

A comparative analysis of 3D conformal deep inspiratory–breath hold and free-breathing intensity-modulated radiation therapy for left-sided breast cancer  

SciTech Connect

Patients undergoing radiation for left-sided breast cancer have increased rates of coronary artery disease. Free-breathing intensity-modulated radiation therapy (FB-IMRT) and 3-dimensional conformal deep inspiratory–breath hold (3D-DIBH) reduce cardiac irradiation. The purpose of this study is to compare the dose to organs at risk in FB-IMRT vs 3D-DIBH for patients with left-sided breast cancer. Ten patients with left-sided breast cancer had 2 computed tomography scans: free breathing and voluntary DIBH. Optimization of the IMRT plan was performed on the free-breathing scan using 6 noncoplanar tangential beams. The 3D-DIBH plan was optimized on the DIBH scan and used standard tangents. Mean volumes of the heart, the left anterior descending coronary artery (LAD), the total lung, and the right breast receiving 5% to 95% (5% increments) of the prescription dose were calculated. Mean volumes of the heart and the LAD were lower (p<0.05) in 3D-DIBH for volumes receiving 5% to 80% of the prescription dose for the heart and 5% for the LAD. Mean dose to the LAD and heart were lower in 3D-DIBH (p?0.01). Mean volumes of the total lung were lower in FB-IMRT for dose levels 20% to 75% (p<0.05), but mean dose was not different. Mean volumes of the right breast were not different for any dose; however, mean dose was lower for 3D-DIBH (p = 0.04). 3D-DIBH is an alternative approach to FB-IMRT that provides a clinically equivalent treatment for patients with left-sided breast cancer while sparing organs at risk with increased ease of implementation.

Reardon, Kelli A.; Read, Paul W.; Morris, Monica M. [Department of Radiation Oncology, University of Virginia, Charlottesville, VA (United States); Reardon, Michael A. [Department of Radiology, University of Virginia, Charlottesville, VA (United States); Geesey, Constance [Department of Radiation Oncology, University of Virginia, Charlottesville, VA (United States); Wijesooriya, Krishni, E-mail: kw5wx@hscmail.mcc.virginia.edu [Department of Radiation Oncology, University of Virginia, Charlottesville, VA (United States)

2013-07-01T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Bern, 5. Juli 2010 Nachhaltige Entwicklung an der Universitt Bern  

E-Print Network (OSTI)

...............................................................................................................37 3.3 World Trade Institute (WTI), Prof. Matthi

Richner, Heinz

382

U.S. Energy Information Administration (EIA) - Sector  

Gasoline and Diesel Fuel Update (EIA)

2025, 2035, and 2040 (2011 dollars per barrel) Projections 2011 2025 2035 2040 WTI Brent WTI Brent WTI Brent WTI Brent AEO2013 (Reference case) 94.86 111.26 115.36 117.36...

383

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network (OSTI)

) "Zti-1 * * (Wti Wti-1) , together with the final data "Ytssn= g(Xsstn). Of course, given (Y= (ti ti-1) E Yti(Wti Wti-1)jFti-1 ss ss ss ss

Université Pierre-et-Marie-Curie, Paris 6

384

Room temperature in-plane ?100? magnetic easy axis for Fe{sub 3}O{sub 4}/SrTiO{sub 3}(001):Nb grown by infrared pulsed laser deposition  

SciTech Connect

We examine the magnetic easy-axis directions of stoichiometric magnetite films grown on SrTiO{sub 3}:Nb by infrared pulsed-laser deposition. Spin-polarized low-energy electron microscopy reveals that the individual magnetic domains are magnetized along the in-plane ?100? film directions. Magneto-optical Kerr effect measurements show that the maxima of the remanence and coercivity are also along in-plane ?100? film directions. This easy-axis orientation differs from bulk magnetite and films prepared by other techniques, establishing that the magnetic anisotropy can be tuned by film growth.

Monti, Matteo; Sanz, Mikel; Oujja, Mohamed; Rebollar, Esther; Castillejo, Marta; Marco, José F.; Figuera, Juan de la, E-mail: juan.delafiguera@iqfr.csic.es [Instituto de Química Física “Rocasolano,” CSIC, Madrid E-28006 (Spain); Pedrosa, Francisco J.; Bollero, Alberto [IMDEA Nanociencia, Instituto Madrileño de Estudios Avanzados en Nanociencia, Madrid E-28049 (Spain); Camarero, Julio; Cuñado, Jose Luis F. [IMDEA Nanociencia, Instituto Madrileño de Estudios Avanzados en Nanociencia, Madrid E-28049 (Spain); Dpto. de Física de la Materia Condensada, Universidad Autónoma de Madrid, Madrid E-28049 (Spain); Nemes, Norbert M. [Dpto. de Física Aplicada III, Universidad Complutense de Madrid, Madrid E-28040 (Spain); Mompean, Federico J.; Garcia-Hernández, Mar [Instituto de Ciencia de Materiales de Madrid, CSIC, Madrid E-28049 (Spain); Nie, Shu; McCarty, Kevin F. [Sandia National Laboratories, Livermore, California 94550 (United States); N'Diaye, Alpha T.; Chen, Gong; Schmid, Andreas K. [Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)

2013-12-14T23:59:59.000Z

385

America and the Misshaping of a New World Order  

E-Print Network (OSTI)

the World Tribunal on Iraq (WTI) held in Istanbul in Juneinternational criminal law. The WTI heard testimony from ?

Gunn, Giles; Gutiérrez-Jones, Carl

2010-01-01T23:59:59.000Z

386

Medial Axis Local Planner: Local Planning for Medial Axis Roadmaps  

E-Print Network (OSTI)

implemented this local planner and have tested it in 2D and 3D rigid body and 8D and 16D fixed base articulated linkage environments. We compare MALP with a straight-line local planner (SL), a typical local planer used in motion planning that interpolated...

Manavi, Kasra Mehron

2012-07-16T23:59:59.000Z

387

Triple-axis X-ray Reciprocal Space Mapping of In(y)Ga(1-y)As Thermophotovoltaic Diodes Grown on (100) InP Substrates  

SciTech Connect

Analysis of the composition, strain-relaxation, layer-tilt, and the crystalline quality of In{sub y}Ga{sub 1-y}As/InP{sub 1-x}As{sub x} thermophotovoltaic (TPV) diodes grown by metal organic vapor phase epitaxy (MOVPE) is demonstrated using triple-axis x-ray reciprocal space mapping techniques. In{sub 0.53}Ga{sub 0.47}As (E{sub gap} = 0.74eV) n/p junction diodes are grown lattice matched (LM) to InP substrates and lattice mismatched (LMM) In{sub 0.67}Ga{sub 0.33}As (E{sub gap} = 0.6eV) TPV diodes are grown on three-step InP{sub 1-x}As{sub x} (0 < x < 0.32) buffer layers on InP substrates. X-ray reciprocal space maps about the symmetric (400) and asymmetric (533) reciprocal lattice points (RELPs) determine the in-plane and out-of-plane lattice parameters and strain of the In{sub y}Ga{sub 1-y}As TPV active layer and underlying InP{sub 1-x}As{sub x} buffers. Triple-axis x-ray rocking curves about the LMM In{sub 0.67}Ga{sub 0.33}As RELP show an order of magnitude increase of its full width at half maximum (FWHM) compared to that from the LM In{sub 0.53}Ga{sub 0.47}As (250asec vs. 30asec). Despite the significant RELP broadening the photovoltaic figure of merits show that the electronic quality of the LMM In{sub 0.67}Ga{sub 0.33}As approaches that of the lattice matched diode material. This indicates that misfit-related crystalline imperfections are not dominating the photovoltaic response of the optimized LMM In{sub 0.67}Ga{sub 0.33}As material compared with the intrinsic recombination processes and/or recombination through native point defects which would be present in both LMM and LM diode material. However, additional RELP broadening in non-optimized LMM In{sub 0.67}Ga{sub 0.33}As n/p junction diodes does correspond to significant degradation of TPV diode open circuit voltage and minority carrier lifetime demonstrating that there is correlation between x-ray FWHM and the electronic performance of the LMM TPV diodes.

M Dashiell; H Ehsani; P Sander; F Newman; C Wang; Z Shellenbarger; D Donetski; N Gu; S Anikeev

2006-02-16T23:59:59.000Z

388

Paracentric inversion of chromosome 7 (46,XX,inv(7)(q21.2q22)) in a newborn with hypoplastic left heart syndrome  

SciTech Connect

Hypoplastic left heart syndrome (HLHS) is a severe congenital heart disease that is uniformly fatal without surgical intervention. Fetal echocardiography allows prenatal diagnosis, but this condition may not become apparent until after the mid-second trimester. We report a term baby with severe HLHS who had an 18 week fetal ultrasound that reportedly demonstrated a normal heart. There was no family history of congenital heart disease. She was phenotypically female with no dysmorphic features. Physical examination was otherwise normal. She expired at 48 hours of age. The autopsy was noncontributory. The karyotype was 46,XX, but there was an apparently balanced paracentric inversion of the long arm of chromosome 7 (46,XX,inv(7)(q21.2q22)). The mother`s chromosome study was normal without any inversion, and the father was not available for study. Hypoplastic left heart syndrome has been associated with extracardiac anomalies and chromosomal abnormalities including 45,XO,11q-, and trisomy 18. It has also been reported in 5 members spanning 3 generations of a family with a spectrum of left heart defects suggesting an autosomal dominant pattern with high penetrance. First-degree relatives of infants with HLHS have a thirteen percent incidence of related cardiovascular malformations, a frequency higher than predicted by a multifactorial model of inheritance, suggesting that at least a portion of HLHS have a genetic basis. Karyotype analysis, including high resolution banding, may help define the etiology of this condition. Chromosome 7 has not been implicated in HLHS. This case emphasizes the need for genetic analysis, including a pedigree, of affected families. It also underscores the importance of screening by karyotype analysis to determine whether defects of the long arm of chromosome 7 are important in the pathogenesis of hypoplastic left heart syndrome.

Kuforjii, T.A.; Pillers, D.M.; Silberbach, M. [Oregon Health Sciences Univ., Portland, OR (United States)] [and others

1994-09-01T23:59:59.000Z

389

Hydrokinetic energy conversion systems and assessment of horizontal and vertical axis turbines for river and tidal applications: A technology status review  

Science Journals Connector (OSTI)

The energy in flowing river streams, tidal currents or other artificial water channels is being considered as viable source of renewable power. Hydrokinetic conversion systems, albeit mostly at its early stage of development, may appear suitable in harnessing energy from such renewable resources. A number of resource quantization and demonstrations have been conducted throughout the world and it is believed that both in-land water resources and offshore ocean energy sector will benefit from this technology. In this paper, starting with a set of basic definitions pertaining to this technology, a review of the existing and upcoming conversion schemes, and their fields of applications are outlined. Based on a comprehensive survey of various hydrokinetic systems reported to date, general trends in system design, duct augmentation, and placement methods are deduced. A detailed assessment of various turbine systems (horizontal and vertical axis), along with their classification and qualitative comparison, is presented. In addition, the progression of technological advancements tracing several decades of R&D efforts are highlighted.

M.J. Khan; G. Bhuyan; M.T. Iqbal; J.E. Quaicoe

2009-01-01T23:59:59.000Z

390

Gamma Bang Time/Reaction History Diagnostics for the National Ignition Facility (NIF) Using 90-degree Off-axis Parabolic Mirrors  

SciTech Connect

Gas Cherenkov detectors (GCD) have been used to convert fusion gamma into photons to achieve gamma bang time (GBT) and reaction history measurements. The GCD designed for Omega used Cassegrain reflector optics in order to fit inside a ten-inch manipulator. A novel design for the National Ignition Facility (NIF) using 90º Off-Axis Parabolic (OAP) mirrors will increase light collection efficiency from fusion gammas and achieve minimum time dispersion. The broadband Cherenkov light (from 200 to 800 nm) is relayed into a high-speed detector using three parabolic mirrors. Because light is collected from many source planes throughout the CO2 gas volume, the detector is positioned at the stop position rather than an image position. The stop diameter and its position are independent of the light-generation location along the gas cell. The current design collects light from a 100-mm diameter by 500-mm-long gas volume. Optical ray tracings demonstrate how light can be collected from different angled trajectories of the Compton electrons as they fly through the CO2 gas volume. A cluster of four channels will allow for increased dynamic range as well as different gamma energy threshold sensitivities. 52.70.La, 29.40.Ka, 42.15.Eq, 07.60.-j, 07.85.-m

H.W. Herrmann, R.M. Malone, W. Stoeffl, J.M. Mack, C.S. Young

2008-06-01T23:59:59.000Z

391

Three-dimensional echocardiographic determination of left ventricular volumes and function by multiplane transesophageal transducer: dynamic in vitro validation and in vivo comparison with angiography and thermodilution  

Science Journals Connector (OSTI)

The goal of this study was to validate 3-dimensional echocardiography by multiplane transesophageal transducer for the determination of left ventricular volumes and ejection fraction in an in vitro experiment and to compare the method in vivo with biplane angiography and the continuous thermodilution method. In the dynamic in vitro experiment, we scanned rubber balloons in a water tank by using a pulsatile flow model. Twenty-nine measurements of volumes and ejection fractions were performed at increasing heart rates. Three-dimensional echocardiography showed a very high accuracy for volume measurements and ejection fraction calculation (correlation coefficient, standard error of estimate, and mean difference for end-diastolic volume 0.998, 2.3 mL, and 0.1 mL; for end-systolic volume 0.996, 2.7 mL, and 0.5 mL; and for ejection fraction 0.995, 1.0%, and ?0.4%, respectively). However, with increasing heart rate there was progressive underestimation of ejection fraction calculation (percent error for heart rate below and above 100 bpm 0.59% and ?8.6%, P<.001). In the in vivo study, left ventricular volumes and ejection fraction of 24 patients with symmetric and distorted left ventricular shape were compared with angiography results. There was good agreement for the subgroup of patients with normal left ventricular shape (mean difference ±95% confidence interval for end-diastolic volume 5.2±6.7 mL, P<.05; for end-systolic volume ?0.5±8.4 mL, P=not significant; for ejection fraction 2.4%±7.2%, P=not significant) and significantly more variability in the patients with left ventricular aneurysms (end-diastolic volume 23.1±56.4 mL, P<.01; end-systolic volume 5.6±41.0 mL, P=not significant; ejection fraction 4.9%±16.0%, P<.05). Additionally, in 20 critically ill, ventilated patients, stroke volume and cardiac output measurements were compared with measurement from continuous thermodilution. Stroke volume as well as cardiac output correlated well to thermodilution (r=0.89 and 0.84, respectively, P<.001), although both parameters were significantly underestimated by 3-dimensional echocardiography (mean difference ±95% confidence interval =?6.4±16.0 mL and ?0.6±1.6 L/min, respectively, P<.005)

Harald P. Kühl; Andreas Franke; Uwe Janssens; Marc Merx; Jürgen Graf; Winfried Krebs; Helmut Reul; Günter Rau; Rainer Hoffmann; Heinrich G. Klues; Peter Hanrath

1998-01-01T23:59:59.000Z

392

Assessment of dedicated low-dose cardiac micro-CT reconstruction algorithms using the left ventricular volume of small rodents as a performance measure  

SciTech Connect

Purpose: Phase-correlated microcomputed tomography (micro-CT) imaging plays an important role in the assessment of mouse models of cardiovascular diseases and the determination of functional parameters as the left ventricular volume. As the current gold standard, the phase-correlated Feldkamp reconstruction (PCF), shows poor performance in case of low dose scans, more sophisticated reconstruction algorithms have been proposed to enable low-dose imaging. In this study, the authors focus on the McKinnon-Bates (MKB) algorithm, the low dose phase-correlated (LDPC) reconstruction, and the high-dimensional total variation minimization reconstruction (HDTV) and investigate their potential to accurately determine the left ventricular volume at different dose levels from 50 to 500 mGy. The results were verified in phantom studies of a five-dimensional (5D) mathematical mouse phantom. Methods: Micro-CT data of eight mice, each administered with an x-ray dose of 500 mGy, were acquired, retrospectively gated for cardiac and respiratory motion and reconstructed using PCF, MKB, LDPC, and HDTV. Dose levels down to 50 mGy were simulated by using only a fraction of the projections. Contrast-to-noise ratio (CNR) was evaluated as a measure of image quality. Left ventricular volume was determined using different segmentation algorithms (Otsu, level sets, region growing). Forward projections of the 5D mouse phantom were performed to simulate a micro-CT scan. The simulated data were processed the same way as the real mouse data sets. Results: Compared to the conventional PCF reconstruction, the MKB, LDPC, and HDTV algorithm yield images of increased quality in terms of CNR. While the MKB reconstruction only provides small improvements, a significant increase of the CNR is observed in LDPC and HDTV reconstructions. The phantom studies demonstrate that left ventricular volumes can be determined accurately at 500 mGy. For lower dose levels which were simulated for real mouse data sets, the HDTV algorithm shows the best performance. At 50 mGy, the deviation from the reference obtained at 500 mGy were less than 4%. Also the LDPC algorithm provides reasonable results with deviation less than 10% at 50 mGy while PCF and MKB reconstruction show larger deviations even at higher dose levels. Conclusions: LDPC and HDTV increase CNR and allow for quantitative evaluations even at dose levels as low as 50 mGy. The left ventricular volumes exemplarily illustrate that cardiac parameters can be accurately estimated at lowest dose levels if sophisticated algorithms are used. This allows to reduce dose by a factor of 10 compared to today's gold standard and opens new options for longitudinal studies of the heart.

Maier, Joscha, E-mail: joscha.maier@dkfz.de [Medical Physics in Radiology, German Cancer Research Center (DKFZ), Im Neuenheimer Feld 280, 69120 Heidelberg (Germany)] [Medical Physics in Radiology, German Cancer Research Center (DKFZ), Im Neuenheimer Feld 280, 69120 Heidelberg (Germany); Sawall, Stefan; Kachelrieß, Marc [Medical Physics in Radiology, German Cancer Research Center (DKFZ), Im Neuenheimer Feld 280, 69120 Heidelberg, Germany and Institute of Medical Physics, University of Erlangen–Nürnberg, 91052 Erlangen (Germany)] [Medical Physics in Radiology, German Cancer Research Center (DKFZ), Im Neuenheimer Feld 280, 69120 Heidelberg, Germany and Institute of Medical Physics, University of Erlangen–Nürnberg, 91052 Erlangen (Germany)

2014-05-15T23:59:59.000Z

393

N-Terminal Pro-B-Type Natriuretic Peptide Plasma Levels as a Potential Biomarker for Cardiac Damage After Radiotherapy in Patients With Left-Sided Breast Cancer  

SciTech Connect

Purpose: Adjuvant radiotherapy (RT) after breast-conserving surgery has been associated with increased cardiovascular mortality. Cardiac biomarkers may aid in identifying patients with radiation-mediated cardiac dysfunction. We evaluated the correlation between N-terminal pro-B-type natriuretic peptide (NT-proBNP) and troponin (TnI) and the dose of radiation to the heart in patients with left-sided breast cancer. Methods and Materials: NT-proBNP and TnI plasma concentrations were measured in 30 left-sided breast cancer patients (median age, 55.0 years) 5 to 22 months after RT (Group I) and in 30 left-sided breast cancer patients (median age, 57.0 years) before RT as control group (Group II). Dosimetric and geometric parameters of heart and left ventricle were determined in all patients of Group I. Seventeen patients underwent complete two-dimensional echocardiography. Results: NT-proBNP levels were significantly higher (p = 0.03) in Group I (median, 90.0 pg/ml; range, 16.7-333.1 pg/ml) than in Group II (median, 63.2 pg/ml; range, 11.0-172.5 pg/ml). TnI levels remained below the cutoff threshold of 0.07 ng/ml in both groups. In patients with NT-proBNP values above the upper limit of 125 pg/ml, there were significant correlations between plasma levels and V{sub 3Gy}(%) (p = 0.001), the ratios D{sub 15cm{sup 3}}(Gy)/D{sub mean}(Gy) (p = 0.01), the ratios D{sub 15cm}{sup 3}/D{sub 50%} (Gy) (p = 0.008) for the heart and correlations between plasma levels and V{sub 2Gy} (%) (p = 0.002), the ratios D{sub 1cm{sup 3}}(Gy)/D{sub mean}(Gy) (p = 0.03), and the ratios D{sub 0.5cm{sup 3}}(Gy)/D{sub 50%}(Gy) (p = 0.05) for the ventricle. Conclusions: Patients with left-sided breast cancer show higher values of NT-pro BNP after RT when compared with non-RT-treated matched patients, increasing in correlation with high doses in small volumes of heart and ventricle. The findings of this study show that the most important parameters are not the mean doses but instead the small percentage of organ volumes (heart or ventricle) receiving high dose levels, supporting the notion that the heart behaves as a serial organ.

D'Errico, Maria P., E-mail: patderrico@libero.it [Department of Laboratory Medicine, 'A. Perrino' Hospital, Brindisi (Italy); Grimaldi, Luca [Department of Medical Physics, 'A. Perrino' Hospital, Brindisi (Italy); Petruzzelli, Maria F. [Department of Radiation Oncology, 'A. Perrino' Hospital, Brindisi (Italy); Gianicolo, Emilio A.L. [Clinical Physiology Institute, National Research Council (IFC-CNR), Pisa-Lecce (Italy); Tramacere, Francesco [Department of Radiation Oncology, 'A. Perrino' Hospital, Brindisi (Italy); Monetti, Antonio; Placella, Roberto [Department of Laboratory Medicine, 'A. Perrino' Hospital, Brindisi (Italy); Pili, Giorgio [Department of Medical Physics, 'A. Perrino' Hospital, Brindisi (Italy); Andreassi, Maria Grazia; Sicari, Rosa; Picano, Eugenio [Clinical Physiology Institute, National Research Council (IFC-CNR), Pisa-Lecce (Italy); Portaluri, Maurizio [Department of Radiation Oncology, 'A. Perrino' Hospital, Brindisi (Italy); Clinical Physiology Institute, National Research Council (IFC-CNR), Pisa-Lecce (Italy)

2012-02-01T23:59:59.000Z

394

Stellar Kinematics in the Complicated Inner Spheroid of M31: Discovery of Substructure Along the Southeastern Minor Axis and its Relationship to the Giant Southern Stream  

E-Print Network (OSTI)

We present the discovery of a kinematically-cold stellar population along the SE minor axis of the Andromeda galaxy (M31) that is likely the forward continuation of M31's giant southern stream. This discovery was made in the course of an on-going spectroscopic survey of red giant branch (RGB) stars in M31 using the DEIMOS instrument on the Keck II 10-m telescope. Stellar kinematics are investigated in eight fields located 9-30 kpc from M31's center (in projection). A likelihood method based on photometric and spectroscopic diagnostics is used to isolate confirmed M31 RGB stars from foreground Milky Way dwarf stars: for the first time, this is done without using radial velocity as a selection criterion, allowing an unbiased study of M31's stellar kinematics. The radial velocity distribution of the 1013 M31 RGB stars shows evidence for the presence of two components. The broad (hot) component has a velocity dispersion of 129 km/s and presumably represents M31's virialized spheroid. A significant fraction (19%) of the population is in a narrow (cold) component centered near M31's systemic velocity with a velocity dispersion that decreases with increasing radial distance, from 55.5 km/s at R_proj=12 kpc to 10.6 km/s at R_proj=18 kpc. The spatial and velocity distribution of the cold component matches that of the "Southeast shelf" predicted by the Fardal et al. (2007) orbital model of the progenitor of the giant southern stream. The metallicity distribution of the cold component matches that of the giant southern stream, but is about 0.2 dex more metal rich on average than that of the hot spheroidal component. We discuss the implications of our discovery on the interpretation of the intermediate-age spheroid population found in this region in recent ultra-deep HST imaging studies.

Karoline M. Gilbert; Mark Fardal; Jasonjot S. Kalirai; Puragra Guhathakurta; Marla C. Geha; Jedidah Isler; Steven R. Majewski; James C. Ostheimer; Richard J. Patterson; David B. Reitzel; Evan Kirby; Michael C. Cooper

2007-03-01T23:59:59.000Z

395

A new, very massive modular Liquid Argon Imaging Chamber to detect low energy off-axis neutrinos from the CNGS beam. (Project MODULAr)  

E-Print Network (OSTI)

The paper is considering an opportunity for the CERN/GranSasso (CNGS) neutrino complex, concurrent time-wise with T2K and NOvA, to search for theta_13 oscillations and CP violation. Compared with large water Cherenkov (T2K) and fine grained scintillators (NOvA), the LAr-TPC offers a higher detection efficiency and a lower backgrounds, since virtually all channels may be unambiguously recognized. The present proposal, called MODULAr, describes a 20 kt fiducial volume LAr-TPC, following very closely the technology developed for the ICARUS-T60o, and is focused on the following activities, for which we seek an extended international collaboration: (1) the neutrino beam from the CERN 400 GeV proton beam and an optimised horn focussing, eventually with an increased intensity in the framework of the LHC accelerator improvement program; (2) A new experimental area LNGS-B, of at least 50000 m3 at 10 km off-axis from the main Laboratory, eventually upgradable to larger sizes. A location is under consideration at about 1.2 km equivalent water depth; (3) A new LAr Imaging detector of at least 20 kt fiducial mass. Such an increase in the volume over the current ICARUS T600 needs to be carefully considered. It is concluded that a very large mass is best realised with a set of many identical, independent units, each of 5 kt, "cloning" the technology of the T600. Further phases may foresee extensions of MODULAr to meet future physics goals. The experiment might reasonably be operational in about 4/5 years, provided a new hall is excavated in the vicinity of the Gran Sasso Laboratory and adequate funding and participation are made available.

B. Baibussinov; M. Baldo Ceolin; G. Battistoni; P. Benetti; A. Borio; E. Calligarich; M. Cambiaghi; F. Cavanna; S. Centro; A. G. Cocco; R. Dolfini; A. Gigli Berzolari; C. Farnese; A. Fava; A. Ferrari; G. Fiorillo; D. Gibin; A. Guglielmi; G. Mannocchi; F. Mauri; A. Menegolli; G. Meng; C. Montanari; O. Palamara; L. Periale; A. Piazzoli; P. Picchi; F. Pietropaolo; A. Rappoldi; G. L. Raselli; C. Rubbia; P. Sala; G. Satta; F. Varanini; S. Ventura; C. Vignoli

2007-04-11T23:59:59.000Z

396

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 8. Additional analysis in response to peer review recommendations  

SciTech Connect

Contents: Introduction; Combustion Engineering; Air Dispersion and Deposition Modeling; Accident Analysis; Exposure Assessment; Toxicology; and Ecological Risk Assessment.

NONE

1997-05-01T23:59:59.000Z

397

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 7. Accident analysis; selection and assessment of potential release scenarios  

SciTech Connect

In this part of the assessment, several accident scenarios are identified that could result in significant releases of chemicals into the environment. These scenarios include ruptures of storage tanks, large magnitude on-site spills, mixing of incompatible wastes, and off-site releases caused by tranpsortation accidents. In evaluating these scenarios, both probability and consequence are assessed, so that likelihood of occurrence is coupled with magnitude of effect in characterizing short term risks.

NONE

1997-05-01T23:59:59.000Z

398

Risk assessment for the Waste Technologies Industries (WTI) Hazardous Waste Incineration Facility (East Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions  

SciTech Connect

Contents: Introduction; Data Used in Characterizing Emissions; Incinerator Stack Emissions; Fugitive Emissions; Uncertainty in Emissions Characterization; and References.

NONE

1997-05-01T23:59:59.000Z

399

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions  

SciTech Connect

Contents: Introduction; Technical Description of ISC-COMPDEP; Modeling Input Parameters; Discussion of Modeling Results; Summary and Major Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

400

Exploring the Doubly Charged Higgs of the Left-Right Symmetric Model using Vector Boson Fusion-like Events at the LHC  

E-Print Network (OSTI)

This paper studies the pair production of the doubly charged Higgs boson of the left-right symmetric models using multilepton final state in the vector boson fusion (VBF)-like processes. The study is performed in the framework consistent with the model's correction to the standard model $\\rho_{EW}$ parameter. VBF topological cuts, number of leptons in the final state and $p_T$ cuts on the leptons are found to be effective in suppressing the background. Significant mass reach can be achieved for exclusion/discovery of the doubly charge Higgs boson for the upcoming LHC run with a luminosity of $\\mathcal{O}(10^3)$ fb$^{-1}$.

Bhaskar Dutta; Ricardo Eusebi; Yu Gao; Tathagata Ghosh; Teruki Kamon

2014-04-02T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Anterior Myocardial Territory May Replace the Heart as Organ at Risk in Intensity-Modulated Radiotherapy for Left-Sided Breast Cancer  

SciTech Connect

Purpose: We investigated whether the heart could be replaced by the anterior myocardial territory (AMT) as the organ at risk (OAR) in intensity-modulated radiotherapy (IMRT) of the breast for patients with left-sided breast cancer. Methods and Materials: Twenty-three patients with left-sided breast cancer who received postoperative radiation after breast-conserving surgery were studied. For each patient, we generated five IMRT plans including heart (H), left ventricle (LV), AMT, LV+AMT, and H+LV as the primary OARs, respectively, except both lungs and right breast, which corresponded to IMRT(H), IMRT(LV), IMRT(AMT), IMRT(LV+AMT), and IMRT(H+LV). For the planning target volumes and OARs, the parameters of dose-volume histograms were compared. Results: The homogeneity index, conformity index, and coverage index were not compromised significantly in IMRT(AMT), IMRT(LV) and IMRT(LV+ AMT), respectively, when compared with IMRT(H). The mean dose to the heart, LV, and AMT decreased 5.3-21.5% (p < 0.05), 19.9-29.5% (p < 0.05), and 13.3-24.5% (p < 0.05), respectively. Similarly, the low (e.g., V5%), middle (e.g., V20%), and high (e.g., V30%) dose-volume of the heart, LV, and AMT decreased with different levels. The mean dose and V10% of the right lung increased by 9.2% (p < 0.05) and 27.6% (p < 0.05), respectively, in IMRT(LV), and the mean dose and V5% of the right breast decreased significantly in IMRT(AMT) and IMRT(LV+AMT). IMRT(AMT) was the preferred plan and was then compared with IMRT(H+LV); the majority of dose-volume histogram parameters of OARs including the heart, LV, AMT, both lungs, and the right breast were not statistically different. However, the low dose-volume of LV increased and the middle dose-volume decreased significantly (p < 0.05) in IMRT(AMT). Also, those of the right lung (V10%, V15%) and right breast (V5%, V10%) decreased significantly (p < 0.05). Conclusions: The AMT may replace the heart as the OAR in left-sided breast IMRT after breast-conserving surgery to decrease the radiation dose to the heart.

Tan Wenyong [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Key Laboratory of Molecular Biophysics of the Ministry of Education, College of Life Science and Technology, Huazhong University of Science and Technology, Wuhan (China); Liu Dong [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Xue Chenbin [Key Laboratory of Molecular Biophysics of the Ministry of Education, College of Life Science and Technology, Huazhong University of Science and Technology, Wuhan (China); Xu Jiaozhen; Li Beihui [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Chen Zhengwang [Key Laboratory of Molecular Biophysics of the Ministry of Education, College of Life Science and Technology, Huazhong University of Science and Technology, Wuhan (China); Hu Desheng [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China); Wang Xionghong, E-mail: tanwyym@yahoo.com.cn [Department of Radiotherapy, Hubei Cancer Hospital, Wuhan (China)

2012-04-01T23:59:59.000Z

402

Abstract crystals Department of Mathematics  

E-Print Network (OSTI)

is a normal crystal define a bijection si : B B by sib = ~f wti(b) i b, if wti(b) 0, ~e -wti(b) i b, if wti, b2 B2} with wti(b1 b2) = wti(b1) + wti(b2), i(b1 b2) = max{i(b1), i(b2) - wt(b1), i }, i(b1 b2

Ram, Arun

403

A large liquid argon time projection chamber for long-baseline, off-axis neutrino oscillation physics with the NuMI beam  

SciTech Connect

Results from neutrino oscillation experiments in the last ten years have revolutionized the field of neutrino physics. While the overall oscillation picture for three neutrinos is now well established and precision measurements of the oscillation parameters are underway, crucial issues remain. In particular, the hierarchy of the neutrino masses, the structure of the neutrino mixing matrix, and, above all, CP violation in the neutrino sector are the primary experimental challenges in upcoming years. A program that utilizes the newly commissioned NuMI neutrino beamline, and its planned upgrades, together with a high-performance, large-mass detector will be in an excellent position to provide decisive answers to these key neutrino physics questions. A Liquid Argon time projection chamber (LArTPC) [2], which combines fine-grained tracking, total absorption calorimetry, and scalability, is well matched for this physics program. The few-millimeter-scale spatial granularity of a LArTPC combined with dE/dx measurements make it a powerful detector for neutrino oscillation physics. Scans of simulated event samples, both directed and blind, have shown that electron identification in {nu}{sub e} charged current interactions can be maintained at an efficiency of 80%. Backgrounds for {nu}{sub e} appearance searches from neutral current events with a {pi}{sup 0} are reduced well below the {approx} 0.5-1.0% {nu}{sub e} contamination of the {nu}{sub {mu}} beam [3]. While the ICARUS collaboration has pioneered this technology and shown its feasibility with successful operation of the T600 (600-ton) LArTPC [4], a detector for off-axis, long-baseline neutrino physics must be many times more massive to compensate for the low event rates. We have a baseline concept [5] based on the ICARUS wire plane structure and commercial methods of argon purification and housed in an industrial liquefied-natural-gas tank. Fifteen to fifty kton liquid argon capacity tanks have been considered. A very preliminary cost estimate for a 50-kton detector is $100M (unloaded) [6]. Continuing R&D will emphasize those issues pertaining to implementation of this very large scale liquid argon detector concept. Key hardware issues are achievement and maintenance of argon purity in the environment of an industrial tank, the assembly of very large electrode planes, and the signal quality obtained from readout electrodes with very long wires. Key data processing issues include an initial focus on rejection of cosmic rays for a surface experiment. Efforts are underway at Fermilab and a small number of universities in the US and Canada to address these issues with the goal of embarking on the construction of industrial-scale prototypes within one year. One such prototype could be deployed in the MiniBooNE beamline or in the NuMI surface building where neutrino interactions could be observed. These efforts are complementary to efforts around the world that include US participation, such as the construction of a LArTPC for the 2-km detector location at T2K [7]. The 2005 APS neutrino study [1] recommendations recognize that ''The development of new technologies will be essential for further advances in neutrino physics''. In a recent talk to EPP2010, Fermilab director P. Oddone, discussing the Fermilab program, states on his slides: ''We want to start a long term R&D program towards massive totally active liquid Argon detectors for extensions of NOvA''. [8]. As such, we are poised to enlarge our R&D efforts to realize the promise of a large liquid argon detector for neutrino physics.

Finley, D.; Jensen, D.; Jostlein, H.; Marchionni, A.; Pordes, S.; Rapidis, P.A.; /Fermilab; Bromberg, C.; /Michigan State U.; Lu, C.; McDonald, T.; /Princeton U.; Gallagher,; Mann, A.; Schneps, J.; /Tufts U.; Cline, D.; Sergiampietri, F.; Wang, H.; /UCLA; Curioni, A.; Fleming, B.T.; /Yale U.; Menary, S.; /York U., Canada

2005-09-01T23:59:59.000Z

404

A Comprehensive Analysis of Cardiac Dose in Balloon-Based High-Dose-Rate Brachytherapy for Left-Sided Breast Cancer  

SciTech Connect

Purpose: To investigate radiation dose to the heart in 60 patients with left-sided breast cancer who were treated with balloon-based high-dose-rate brachytherapy using MammoSite or Contura applicators. Methods and Materials: We studied 60 consecutive women with breast cancer who were treated with 34 Gy in 10 twice-daily fractions using MammoSite (n = 37) or Contura (n = 23) applicators. The whole heart and the left and right ventricles were retrospectively delineated, and dose-volume histograms were analyzed. Multiple dosimetrics were reported, such as mean dose (D{sub mean}); relative volume receiving 1.7, 5, 10, and 20 Gy (V1.7, V5, V10, and V20, respectively); dose to 1 cc (D{sub 1cc}); and maximum point dose (D{sub max}). Biologic metrics, biologically effective dose and generalized equivalent uniform dose were computed. The impact of lumpectomy cavity location on cardiac dose was investigated. Results: The average {+-} standard deviation of D{sub mean} was 2.45 {+-} 0.94 Gy (range, 0.56-4.68) and 3.29 {+-} 1.28 Gy (range, 0.77-6.35) for the heart and the ventricles, respectively. The average whole heart V5 and V10 values were 10.2% and 1.3%, respectively, and the heart D{sub max} was >20 Gy in 7 of 60 (11.7%) patients and >25 Gy in 3 of 60 (5%) patients. No cardiac tissue received {>=}30 Gy. The V1.7, V5, V10, V20, and D{sub mean} values were all higher for the ventricles than for the whole heart. For balloons located in the upper inner quadrant of the breast, the average whole heart D{sub mean} was highest. The D{sub mean}, biologically effective dose, and generalized equivalent uniform dose values for heart and ventricles decreased with increasing minimal distance from the surface of the balloon. Conclusions: On the basis of these comprehensive cardiac dosimetric data, we recommend that cardiac dose be routinely reported and kept as low as possible in balloon-based high-dose-rate brachytherapy treatment planning for patients with left-sided breast cancer so the correlation with future cardiac toxicity data can be investigated.

Valakh, Vladimir, E-mail: vladimir@valakh.com [Department of Radiation Oncology, Allegheny General Hospital, Pittsburgh, PA (United States); Kim, Yongbok; Werts, E. Day; Trombetta, Mark G. [Department of Radiation Oncology, Allegheny General Hospital, Pittsburgh, PA (United States); Drexel University College of Medicine, Allegheny Campus, Pittsburgh, PA (United States)

2012-04-01T23:59:59.000Z

405

The rare crystallographic structure of d(CGCGCG){sub 2}: The natural spermidine molecule bound to the minor groove of left-handed Z-DNA d(CGCGCG){sub 2} at 10 {sup o}C  

SciTech Connect

Several crystal structure analyses of complexes of synthetic polyamine compounds, including N {sup 1}-(2-(2-aminoethylamino))ethyl)ethane-1,2-diamine PA(222) and N {sup 1}-(2-(2-(2-aminoethylamino)ethylamino)ethyl)ethane-1,2-diamine PA(2222), and left-handed Z-DNA d(CGCGCG){sub 2} have been reported. However, until now, there have been no examples of naturally occurring polyamines bound to the minor groove of the left-handed Z-DNA of d(CGCGCG){sub 2} molecule. We have found that spermidine, a natural polyamine, is connected to the minor groove of left-handed Z-DNA of d(CGCGCG){sub 2} molecule in a crystalline complex grown at 10 {sup o}C. The electron density of the DNA molecule was clear enough to determine that the spermidine was connected in the minor groove of two symmetry related molecules of left-handed Z-DNA d(CGCGCG){sub 2}. This is the first example that a spermidine molecule can form a bridge conformation between two symmetry related molecules of left-handed Z-DNA d(CGCGCG){sub 2} in the minor groove.

Ohishi, Hirofumi [Osaka University of Pharmaceutical Sciences, 4-20-1, Nasahara, Takatsuki, Osaka 569-1094 (Japan)]. E-mail: ohishi@gly.oups.ac.jp; Tozuka, Yoshitaka [Osaka University of Pharmaceutical Sciences, 4-20-1, Nasahara, Takatsuki, Osaka 569-1094 (Japan); Da-Yang, Zhou [The Institute of Scientific and Industrial Research, Osaka University, 8-1, Mihogaoka, Ibaragi, Osaka 567-0047 (Japan); Ishida, Toshimasa [Osaka University of Pharmaceutical Sciences, 4-20-1, Nasahara, Takatsuki, Osaka 569-1094 (Japan); Nakatani, Kazuhiko [The Institute of Scientific and Industrial Research, Osaka University, 8-1, Mihogaoka, Ibaragi, Osaka 567-0047 (Japan)

2007-06-22T23:59:59.000Z

406

Peptide translocation by variants of the transporter associated with antigen processing  

Science Journals Connector (OSTI)

...test the transactivational properties of WTI-del2, we used transient transfections...level. In contrast, trans-fection of WTi-del2 led to twofold greater transcriptional...antagonistic effect of wild-type W/Ti and WTI-del2 suggests that W/Ti function may...

MT Heemels; TN Schumacher; K Wonigeit; HL Ploegh

1993-12-24T23:59:59.000Z

407

Chapter 13. No Watt Left Behind No Watt Left Behind  

E-Print Network (OSTI)

­ from the smallest refrigerator to the largest building air-conditioning system ­ become fouled of previous forays. Much of the current thinking for making buildings "smart" about their energy consumption. This information is essential in order to understand and optimize energy consumption, to detect and #12;Chapter 13

408

Treatment of left sided breast cancer for a patient with funnel chest: Volumetric-modulated arc therapy vs. 3D-CRT and intensity-modulated radiotherapy  

SciTech Connect

This case study presents a rare case of left-sided breast cancer in a patient with funnel chest, which is a technical challenge for radiation therapy planning. To identify the best treatment technique for this case, 3 techniques were compared: conventional tangential fields (3D conformal radiotherapy [3D-CRT]), intensity-modulated radiotherapy (IMRT), and volumetric-modulated arc therapy (VMAT). The plans were created for a SynergyS® (Elekta, Ltd, Crawley, UK) linear accelerator with a BeamModulator™ head and 6-MV photons. The planning system was Oncentra Masterplan® v3.3 SP1 (Nucletron BV, Veenendal, Netherlands). Calculations were performed with collapsed cone algorithm. Dose prescription was 50.4 Gy to the average of the planning target volume (PTV). PTV coverage and homogeneity was comparable for all techniques. VMAT allowed reducing dose to the ipsilateral organs at risk (OAR) and the contralateral breast compared with IMRT and 3D-CRT: The volume of the left lung receiving 20 Gy was 19.3% for VMAT, 26.1% for IMRT, and 32.4% for 3D-CRT. In the heart, a D{sub 15%} of 9.7 Gy could be achieved with VMAT compared with 14 Gy for IMRT and 46 Gy for 3D-CRT. In the contralateral breast, D{sub 15%} was 6.4 Gy for VMAT, 8.8 Gy for IMRT, and 10.2 Gy for 3D-CRT. In the contralateral lung, however, the lowest dose was achieved with 3D-CRT with D{sub 10%} of 1.7 Gy for 3D-CRT, and 6.7 Gy for both IMRT and VMAT. The lowest number of monitor units (MU) per 1.8-Gy fraction was required by 3D-CRT (192 MU) followed by VMAT (518 MU) and IMRT (727 MU). Treatment time was similar for 3D-CRT (3 min) and VMAT (4 min) but substantially increased for IMRT (13 min). VMAT is considered the best treatment option for the presented case of a patient with funnel chest. It allows reducing dose in most OAR without compromising target coverage, keeping delivery time well below 5 minutes.

Haertl, Petra M., E-mail: petra.haertl@klinik.uni-regensburg.de [Department of Radiotherapy, Regensburg University Medical Center, Regensburg (Germany); Pohl, Fabian; Weidner, Karin; Groeger, Christian; Koelbl, Oliver; Dobler, Barbara [Department of Radiotherapy, Regensburg University Medical Center, Regensburg (Germany)

2013-04-01T23:59:59.000Z

409

The production and decay of the top partner $T$ in the left-right twin higgs model at the ILC and CLIC  

E-Print Network (OSTI)

The left-right twin Higgs model (LRTHM) predicts the existence of the top partner $T$. In this work, we make a systematic investigation for the single and pair production of this top partner $T$ through the processes: $e^{+}e^{-}\\to t\\ov{T} + T\\bar{t}$ and $ T\\ov{T}$, the neutral scalar (the SM-like Higgs boson $h$ or neutral pseudoscalar boson $\\phi^{0}$) associate productions $e^{+}e^{-}\\to t\\ov{T}h +T\\bar{t}h$, $T\\ov{T}h$, $t\\ov{T}\\phi^{0}+T\\bar{t}\\phi^{0}$ and $ T\\ov{T}\\phi^{0}$. From the numerical evaluations for the production cross sections and relevant phenomenological analysis we find that (a) the production rates of these processes, in the reasonable parameter space, can reach the level of several or tens of fb; (b) for some cases, the peak value of the resonance production cross section can be enhanced significantly and reaches to the level of pb; (c) the subsequent decay of $T\\to \\phi^{+}b \\to t\\bar{b}b$ may generate typical phenomenological features rather different from the signals from other new physics models beyond the standard model(SM); and (d) since the relevant SM background is generally not large, some signals of the top partner $T$ predicted by the LRTHM may be detectable in the future ILC and CLIC experiments.

Yao-Bei Liu; Zhen-Jun Xiao

2014-12-13T23:59:59.000Z

410

Measurements in the HCl 3 left-arrow 0 band using a near-IR InGaAsP diode laser  

SciTech Connect

Hydrogen chloride gas is measured by absorption in the second overtone band near 1.2 ..mu..m using an InGaAsP diode laser. The strength and air-broadening coefficient of the H/sup 35/Cl P(3) line are measured. The line strength is approx.18% higher than the previous grating spectrometer measurement and suggests that the commonly used experimental value for the 3 left-arrow 0 HCl vibrational moment may be low. High-frequency two-tone FM detection is also used in this study to measure trace concentrations of HCl. Using a multimode laser, the sensitivity limit is 3-parts per million HCl in air at 50 Torr, corresponding to a minimum detectable fractional absorption (multimode) of 4 x 10/sup -6/. Optimization of the detection method should permit real-time measurement of concentrations below 0.1 ppm. The low cost and convenient operating characteristics of InGaAsP diode lasers make them attractive for many applications in high-resolution near-IR spectroscopy and trace species detection.

Stanton, A.C.; Silver, J.A.

1988-12-15T23:59:59.000Z

411

Currently, in countries where automobiles are moving on the right, drivers are required to drive in the rightmost lane. To overtake another vehicle, they move one lane to the left, pass, and return to their  

E-Print Network (OSTI)

Summary Currently, in countries where automobiles are moving on the right, drivers are required automobiles travel on the left. Finally, in "Further Thinking", we try to integrate more factors to improve February 11, 2014 Abstract Currently, in countries where automobiles are moving on the right, drivers

Morrow, James A.

412

Influence of c-axis orientation and scandium concentration on infrared active modes of magnetron sputtered Sc{sub x}Al{sub 1?x}N thin films  

SciTech Connect

Doping of wurtzite aluminium nitride (AlN) with scandium (Sc) significantly enhances the piezoelectric properties of AlN. Sc{sub x}Al{sub 1?x}N thin films with different Sc concentrations (x = 0 to 0.15) were deposited by DC reactive magnetron sputtering. Infrared (IR) absorbance spectroscopy was applied to investigate the Sc concentration dependent shift of the IR active modes E{sub 1}(TO) and A{sub 1}(TO). These results are compared to ab initio simulations, being in excellent agreement with the experimental findings. In addition, IR spectroscopy is established as an economical and fast method to distinguish between thin films with a high degree of c-axis orientation and those exhibiting mixed orientations.

Mayrhofer, P. M.; Bittner, A.; Schmid, U. [Institute of Sensor and Actuator Systems, Vienna University of Technology, Floragasse 7, 1040 Vienna (Austria)] [Institute of Sensor and Actuator Systems, Vienna University of Technology, Floragasse 7, 1040 Vienna (Austria); Eisenmenger-Sittner, C. [Institute of Solid State Physics, Vienna University of Technology, Wiedner Hauptstrasse 8, 1040 Vienna (Austria)] [Institute of Solid State Physics, Vienna University of Technology, Wiedner Hauptstrasse 8, 1040 Vienna (Austria); Euchner, H. [Institute of Materials Science and Technology, Vienna University of Technology, Karlsplatz 13, 1040 Vienna (Austria)] [Institute of Materials Science and Technology, Vienna University of Technology, Karlsplatz 13, 1040 Vienna (Austria)

2013-12-16T23:59:59.000Z

413

DOE/EA-1570: Final Environmental Assessment for Construction and Operation of Neutrinos at the Main Injector Off-Axis Electron Neutrino Appearance Experiment at the Fermi National Accelerator Laboratory, Batavia, Illinois, and St. Louis County, Minnesota  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

70 70 FINAL ENVIRONMENTAL ASSESSMENT Environmental Assessment for Construction and Operation of Neutrinos at the Main Injector Off-Axis Electron Neutrino (ν e ) Appearance Experiment (NOvA) at the Fermi National Accelerator Laboratory, Batavia, Illinois, and St. Louis County, Minnesota U.S. Department of Energy, Lead Agency Fermi Site Office Batavia, IL U.S. Army Corps of Engineers, Cooperating Agency St. Paul District St. Paul, MN June 2008 (DOE/EA-1570) NOvA Environmental Assessment June 2008 ii DISCLAIMER Reference herein to any specific commercial product, process or service by trade name, trademark, manufacturer, or otherwise does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any

414

Quantification of regional left and right ventricular radial and longitudinal function in healthy children using ultrasound-based Strain Rate and Strain Imaging  

Science Journals Connector (OSTI)

Abstract Background: Noninvasive assessment of left (LV) and right (RV) ventricular function in children could benefit from a technique that would characterize local myocardial deformation. Color Doppler myocardial imaging (CDMI) allows the calculation of either local longitudinal or radial Strain Rate (SR) and Strain (?). To determine the clinical feasibility and reproducibility of longitudinal and radial SR and ?, the following study was carried out. Methods: CDMI data were obtained from 33 healthy children (4-16 years). To quantify regional longitudinal and radial function SR and ? data were obtained from apical and parasternal views respectively. From the extracted SR curves, peak values for systole, early diastole, and late diastole were calculated. From the extracted ? curves the systolic, early and late diastolic ? values were calculated. Results: LV longitudinal deformation were homogeneous for LV basal, mid and apical segments (peak systolic SR: ?1.9 ± 0.7 s?1, systolic ? ?25% ± 7%). Longitudinal SR and ? values were significantly higher and heterogeneous in the RV (compared with LV walls) and were maximal in the mid part of the RV free wall (peak systolic SR: ?2.8 ± 0.7 s?1, systolic ? ?45% ± 13%). The RV inferior wall showed homogenous but lower longitudinal SR and ? values. The LV systolic and diastolic SR and ? values were higher for deformation in the radial direction compared with the longitudinal direction (radial peak systolic SR: 3.7 ± 0.9 s?1, radial systolic ? 57% ± 11%; P <.0001). The interobserver variability for radial systolic ? and SR was 10.3% and 13.1%, respectively. Conclusion: Ultrasound-based Strain SR/? imaging is a practical, reproducible clinical technique, which allows the calculation of regional longitudinal and radial deformation from both LV and RV segments. The combination of regional SR/? indices and the timing of specific systolic or diastolic regional events may offer a new noninvasive approach to quantifying regional myocardial function in congenital and acquired heart disease in children. (J Am Soc Echocardiogr 2002;15:20-8.)

Frank Weidemann; Benedicte Eyskens; Fadi Jamal; Luc Mertens; Miroslaw Kowalski; Jan D'Hooge; Bart Bijnens; Marc Gewillig; Frank Rademakers; Liv Hatle; George R. Sutherland

2002-01-01T23:59:59.000Z

415

The impact of uncertainty and risk measures  

E-Print Network (OSTI)

West Texas Intermediate (WTI) price series begins in 1983,West Texas In- termediate (WTI) is used to estimate theof data sets by using WTI for both the main VAR and realized

Jo, Soojin; Jo, Soojin

2012-01-01T23:59:59.000Z

416

Animal-Vehicle Collision Data Collection Throughout the United States and Canada  

E-Print Network (OSTI)

Montana State University (WTI-MSU), P.O. Box 174250,and population dynamics. At WTI-MSU, Julie worked withroad ecology projects at WTI-MSU. She is currently working

Huijser, Marcel P.; Wagner, Meredith E.; Hardy, Amanda; Clevenger, Anthony P.; Fuller, Julie A.

2007-01-01T23:59:59.000Z

417

Large-Scale Variability Characterization and Robust Design Techniques for Nanoscale SRAM  

E-Print Network (OSTI)

2.22 Definition of WTV and WTI from measured N-DD . The write trip current (WTI) is defined as the currentthe definitions of WTV and WTI on the N-curve. One important

Guo, Zheng

2009-01-01T23:59:59.000Z

418

ARE Update Volume 11, Number 5  

E-Print Network (OSTI)

West Texas Intermediate (WTI), which describes the grade ofarticle, we describe how the WTI spot price relates to worldCushing is a hub at which WTI and other domestic crude oils

de Wit, Joeri; Smith, Aaron; Kovacs, Kent; Simon, Leo K.; Stratton, Susan

2008-01-01T23:59:59.000Z

419

Classification and characterization of topological insulators and superconductors  

E-Print Network (OSTI)

Weak topological insulators (WTI) . . . . . 1.4 Topologicalweak topological insulators (WTI). The surfaces of STIs haveSTI STM TI TRIM/TRIMs TRS TKNN VPT WTI one-dimension, two-

Mong, Roger

2012-01-01T23:59:59.000Z

420

Comparison of measured and calculated dose rates for the castor® HAW 20/28 CG  

Science Journals Connector (OSTI)

......Scheib 2 A. Rimpler 2 Corresponding author: kuehl@wti.wse.de 1 WTI Wissenschaftlich-Technische Ingenieurberatung GmbH...10) dose rate from the Bonner sphere system. | WTI Wissenschaftlich-Technische Ingenieurberatung GmbH......

O. Ringleb; H. Kühl; H. Scheib; A. Rimpler

2005-12-20T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

354 2010 IEEE International Solid-State Circuits Conference ISSCC 2010 / SESSION 19 / HIGH-PERFORMANCE EMBEDDED MEMORY / 19.7  

E-Print Network (OSTI)

.92) with the write trip current (WTI) met- ric. Although WTI is a static current metric [4], it reflects dynamic WTI, however, requires access to internal nodes, which is impractical in dense SRAM arrays. Figure 19

Nikolic, Borivoje

422

Expression of the Wilms' tumor suppressor gene WT1 during mouse embryogenesis  

Science Journals Connector (OSTI)

...ifferential Regulation of the Wilms' Tumor Gene, WTI, during Differentiation of Embryonal Carcinoma...pattern of the Wilms' tumor suppressor gene, WTI, during embryonal development suggests a role for the WTI proteins in the differentiation of specific...

RR Rackley; AM Flenniken; NP Kuriyan; PM Kessler; MH Stoler; BR Williams

1993-12-01T23:59:59.000Z

423

General Langevin Equation and Anomaly  

Science Journals Connector (OSTI)

......anomalous chiral Ward- Takahashi identity (WTI). Thus, we have found out that the anomalous chiral WTI is obtained by rewriting the trivial stationary...obtain the conventional regularized chiral WTI, (2 12) Next, let us consider how the above......

Satoshi Tanaka

1993-01-01T23:59:59.000Z

424

Increased expression of the insulin-like growth factor I receptor gene, IGF1R, in Wilms tumor is correlated with modulation of IGF1R promoter activity by the WT1 Wilms tumor gene product  

Science Journals Connector (OSTI)

...expression of the Wilms tumor suppressor gene WTI, whose inactivation appears to be a key step...constructs driving luciferase reporter genes and with WTI expression vectors showed that the active WTI gene product represses IGF-IR promoter activity...

H Werner; G G Re; I A Drummond; V P Sukhatme; F J Rauscher; 3rd; D A Sens; A J Garvin; D LeRoith; C T Roberts; Jr

1993-01-01T23:59:59.000Z

425

Homozygous somatic Wt1 point mutations in sporadic unilateral Wilms tumor.  

Science Journals Connector (OSTI)

...1993 Medical Sciences Homozygous somatic WTI point mutations in sporadic unilateral...loci. A Wilms tumor suppressor gene, WTI, at chromosome 11 band p13, has recently been cloned and characterized. WTI has been implicated in the develop- ment...

M J Coppes; G J Liefers; P Paul; H Yeger; B R Williams

1993-01-01T23:59:59.000Z

426

Discrete Time Approximation and Monte-Carlo Simulation of Backward Stochastic Differential Equations  

E-Print Network (OSTI)

, ~Z ti-1 )(ti - ti-1) - ~Zti-1 · (Wti - Wti-1 ) , together with the final data ~Y tn = g(X tn-time approximation (Y , Z) : Y tn = g X tn , Z ti-1 = (ti - ti-1)-1 E Y ti (Wti - Wti-1 )|Fti-1 Y ti-1 = E Y ti, involved in the above discretization scheme, reduce to the regression of Y ti and Y ti (Wti - Wti-1

Université Pierre-et-Marie-Curie, Paris 6

427

Evaluation of bolus electron conformal therapy compared with conventional techniques for the treatment of left chest wall postmastectomy in patients with breast cancer  

SciTech Connect

Postmastectomy radiation (PMRT) lowers local-regional recurrence risk and improves survival in selected patients with breast cancer. The chest wall and lower axilla are technically challenging areas to treat with homogenous doses and normal tissue sparing. This study compares several techniques for PMRT to provide data to guide selection of optimal treatment techniques. Twenty-five consecutive left-sided patients treated postmastectomy were contoured using Radiation Therapy Oncology Group (RTOG) atlas guidelines then planned using 4 different PMRT techniques: opposed tangents with wedges (3-dimensional [3D] wedges), opposed tangents with field-in-field (FiF) modulation, 8-field intensity modulation radiotherapy (IMRT), and custom bolus electron conformal therapy (BolusECT, .decimal, Inc., Sanford, FL). Required planning target volume (PTV) coverage was held constant, and then dose homogeneity and normal tissue dose parameters were compared among the 4 techniques. BolusECT achieved clincally acceptable PTV coverage for 22 out of 25 cases. Compared with either tangential technique, IMRT and BolusECT provided the lowest heart V{sub 25} doses (3.3% ± 0.9% and 6.6% ± 3.2%, respectively with p < 0.0001). FiF had the lowest mean total lung dose (7.3 ± 1.1 Gy, with p = 0.0013), IMRT had the lowest total lung V{sub 20} (10.3% ± 1.6%, p < 0.0001), and BolusECT had the lowest mean heart dose (7.3 ± 2.0 Gy, p = 0.0002). IMRT provided the optimal dose homogeneity and normal tissue sparing compared with all other techniques for the cases in which BolusECT could not achieve acceptable PTV coverage. IMRT generally exposes contralateral breast and lung to slightly higher doses. Optimal PMRT technique depends upon patient anatomy. Patients whose maximal target volume depth is about 5.7 cm or less can be treated with BolusECT-assisted 12 or 15 MeV electron beams. At these energies, BolusECT has comparable dose-volume statistics as IMRT and lower heart V{sub 25} than opposed tangential beams. Patients with larger depths are best treated with IMRT, which provides significant advantages in both dose homogeneity and normal tissue sparing compared with all other techniques.

Opp, Dan, E-mail: Daniel.Opp@moffitt.org; Forster, Kenneth; Li, Weiqi; Zhang, Geoffrey; Harris, Eleanor E.

2013-01-01T23:59:59.000Z

428

DC SQUID spectrometers for nuclear quadrupole and low-field nuclear magnetic resonance spectroscopy  

E-Print Network (OSTI)

as dpJdt + O, where The thermal transition rates Wti can bewritten as Wti = By Wji , where By is the Boltzmann ratio (

TonThat, D.H.

2011-01-01T23:59:59.000Z

429

Menace and Management: Power in the Human-Monkey Social Worlds of Delhi and Shimla  

E-Print Network (OSTI)

time. According to the WTI report, the monkey facilities at86 All of this, claims the WTI report, was jeopardized by

Solomon, Daniel Allen

2013-01-01T23:59:59.000Z

430

2006 Long Range Development Plan Final Environmental Impact Report  

E-Print Network (OSTI)

Glenwood, New Mexico, [WTI 02-1], 1995. Zeiner, D.C. , W.F.Manual, Glenwood, New Mexico, [WTI 02-1], 1995. Yee, Henry,

Philliber, Jeff

2007-01-01T23:59:59.000Z

431

In the Beginnings: The Apotropaic Use of Scriptural Incipits in Late Antique Egypt  

E-Print Network (OSTI)

katafugh~j tou~ sw~sai/ me. wti krataiwsij k(ai\\ ) katafugh/read me); me (read moi); wti (read o#ti) krataiwsij (read

Sanzo, Joseph Emanuel

2012-01-01T23:59:59.000Z

432

R.H. Shumway and D.S. Stoffer Time Series Analysis and Its Applications  

E-Print Network (OSTI)

.1) and below: Write wti instead of wit, and write cov(wti, wtj) instead of cov(wit, wjt) for consistency. · p

433

Generalized fractional smoothness and Lp-variation of BSDEs with non-Lipschitz  

E-Print Network (OSTI)

-distance between the stochastic integral T 0 ZsdWs and its discrete counterpart n i=1 Zti-1 (Wti -Wti-1 ) is upper

Paris-Sud XI, Université de

434

Universitat Tubingen Mathematisches Institut  

E-Print Network (OSTI)

i=0 Wi (Wti+1 - Wti ) des Integrals t 0 WsdWs, wobei i = (1 - )ti + ti+1. Zeigen Sie lim 0 R = 1 2 W

Tübingen, Universität

435

Isolation and characterization of a cDNA clone for the Cat2 gene in maize and its homology with other catalases  

Science Journals Connector (OSTI)

...EAVIY|CKFHYKTDQGIIKNIL|PVEEA|GRLAQEDjPIDYGLRbDLIFNAIAS|G|NYIPS|WTI BWV LVINADIGIEAVIY|CKFHYKTDQIGIIKNIL|SVEDA|ARLAHEDIP|DYGLRIDLIFNAIAT|G|NYIPS|WTI HNIM LEVINANIGEAVIYICKFNYKTDQGIIKNIL|SVEDA|ARLSQED PIDYGIR[LIFNAIAT...

L A Bethards; R W Skadsen; J G Scandalios

1987-01-01T23:59:59.000Z

436

Effective Rural ITS Outreach: The California Program for  

E-Print Network (OSTI)

stakeholder involvement methods, and examples of how the Western Transportation Institute (WTI), Montana State were prioritized to local conditions, WTI and Caltrans conducted a of pilot workshop. Based

McGowen, Patrick

437

Analyzing Static and Dynamic Write Margin for Nanometer  

E-Print Network (OSTI)

: Static Approaches `0' `1' BL Sweep (VBL) N-Curve (WTV,WTI) WM WM WTI WTV #12;10/6/2008 ISLPED 2008 5

Calhoun, Benton H.

438

BROWNIAN MOTION INDEXED BY A TIME SCALE DAVID GROW AND SUMAN SANYAL  

E-Print Network (OSTI)

on the proba- bility space (C0[0, ), P) and the increments Wti - Wti-1 are normally distributed with mean zero

Sanyal, Suman

439

Discrete-time approximation of doubly reflected BSDEs Jean-Franois Chassagneux  

E-Print Network (OSTI)

} such that and define (Y , ¯Z) by the backward induction: ¯Z ti = (ti+1 - ti)-1 E (Wti+1 - Wti )(Y ti+1 ) | Fti

Paris-Sud XI, Université de

440

Dosimetric comparison of conventional and forward-planned intensity-modulated techniques for comprehensive locoregional irradiation of post-mastectomy left breast cancers  

SciTech Connect

Three recently published randomized trials have shown a survival benefit to postoperative radiation therapy when the internal mammary chain (IMC), supraclavicular (SCV), and axillary lymphatics are treated. When treating the IMC, techniques that minimize dose to the heart and lungs may be utilized to prevent excess morbidity and mortality and achieve the survival benefit reported. The purpose of this study was to dosimetrically compare forward-planned intensity-modulated radiation therapy (fIMRT) with conventional techniques for comprehensive irradiation of the chest wall and regional lymphatics. For irradiation of the chest wall and IMC, 3 treatment plans, (1) fIMRT, (2) partially-wide tangent (PWT) fields, and (3) a photon-electron (PE) technique, were compared for 12 patients previously treated at our institution with fIMRT to the left chest wall and regional lymphatics. Additionally, the SCV and infraclavicular lymphatics were irradiated and 4 methods were compared: 2 with anterior fields only (dose prescribed to 3 and 5 cm [SC3cm, SC5cm]) and 2 with anterior and posterior fields (fIMRT, 3DCRT). Each patient was planned to receive 50 Gy in 25 fractions. Regions of interest (ROIs) created for each patient included chest wall (CW) planning target volume (PTV), IMC PTV, and SCV PTV. Additionally, the following organs at risk (OAR) volumes were created: contralateral breast, heart, and lungs. For each plan and ROI, target volume coverage (V{sub 95-107}) and dose homogeneity (D{sub 95-5}) were evaluated. Additionally, the mean OAR dose and normal tissue complication probability (NTCP) were computed. For irradiation of the CW, target volume coverage and dose homogeneity were improved for the fIMRT technique as compared to PE (p < 0.001, p = 0.023, respectively). Similar improvements were seen with respect to IMC PTV (p = 0.012, p = 0.064). These dosimetric parameters were also improved as compared to PWT, but not to the same extent (p = 0.011, p = 0.095 for CW PTV, and p = 0.164, p > 0.2 for IMC PTV). The PE technique resulted in the lowest heart V{sub 30}, although this difference was not significant (p > 0.2). The NTCP values for excess cardiac mortality for fIMRT and PE were equivalent (1.9%) and lower than with PWT (2.8%, p > 0.2). The fIMRT technique was able to reduce heart dose and NTCP for each patient as compared to PWT. When comparing the anterior field techniques of treating SCV PTV, prescribing dose to 5 cm resulted in a improved V50 (p = 0.089). However, when compared to fIMRT, the SC3cm and SC5cm had inferior target volume coverage (p = 0.055, p = 0.014) and significantly greater dose heterogeneity (p = 0.031, p = 0.043). The addition of a posterior field increased the volume of lung receiving 40 and 50 Gy, but not significantly (p > 0.2). For complex breast treatments that irradiate the chest wall, IMC, and SCV, fIMRT resulted in improved dose homogeneity and target volume coverage as compared to conventional techniques. Furthermore, the dosimetric gains in target volume coverage with fIMRT came at no significant increase in dose to OAR. The fIMRT technique demonstrated the ability to maintain the advantage of each of the other 2 techniques: reducing the dose to OARs, as with PE, and providing superior target volume coverage, as with PWT.

Cavey, Matthew L. [Department of Radiation Oncology, University of Texas Medical Branch, Galveston, TX (United States)]. E-mail: mlcavey@utmb.edu; Bayouth, John E. [Department of Medical Physics, University of Texas Medical Branch, Galveston, TX (United States); Endres, Eugene J. [Department of Medical Physics, University of Texas Medical Branch, Galveston, TX (United States); Pena, John M. [Department of Medical Physics, University of Texas Medical Branch, Galveston, TX (United States); Colman, Martin [Department of Radiation Oncology, University of Texas Medical Branch, Galveston, TX (United States); Hatch, Sandra [Department of Medical Physics, University of Texas Medical Branch, Galveston, TX (United States)

2005-06-30T23:59:59.000Z

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Diagnostic X-Multi-Axis Beamline  

SciTech Connect

Tomographic reconstruction of explosive events require time resolved multipal lines of sight. Considered here is a four (or eight) line of sight beam layout for a nominal 20 MeV 2000 Ampere 2 microsecond electron beam for generation of x-rays 0.9 to 5 meters from a given point, the ''firing point''. The requirement of a millimeter spatial x-ray source requires that the electron beam be delivered to the converter targets with sub-millimeter precision independent of small variations in beam energy and initial conditions. The 2 usec electron beam pulse allows for four bursts in each line, separated in time by about 500 microseconds. Each burst is divided by a electro-magnetic kicker into four (or eight) pulses, one for each beamline. The arrival time of the four (or eight) beam pulses at the x-ray target can be adjusted by the kicker timing and the sequence that the beams of each burst are switched into the different beamlines. There exists a simple conceptual path from a four beamline to a eight beamline upgrade. The eight line beamline is built up from seven unique types of sub-systems or ''blocks''. The beamline consists of 22 of these functional blocks and contains a total of 455 individual magnets, figure 1. The 22 blocks are inter-connected by a total of 30 straight line inter-block sections (IBS). Beamlines 1-4 are built from 12 blocks with conceptual layout structure shown in figure 2. Beamlines 5-8 are built with an additional 10 blocks with conceptual layout structure shown in figure 3. This beamline can be thought of as looking like a lollipop consisting of a 42 meter long stick leading to a 60 by 70 meter rectangular candy blob consisting of the eight lines of sight. The accelerator providing the electron beam is at the end of the stick and the firing point is at the center of the blob. The design allows for a two stage implementation. Beamlines 1-3 can be installed to provide a tomographic azimuthal resolution of 45 degrees. An upgrade can later be made by adding beamlines 5-8 azimuthally indexed so as to provide an azimuthal resolution of 22.5 degrees. All eight beamlines point down by 10 degrees (pitch). The x-ray converter target can be located along each beamline anywhere between 0 to 5 meters from the firing point. An example of inter-facing the Diagnostic X facility with the Darht II accelerator located at LANL will be given.

Paul, A C

2000-04-05T23:59:59.000Z

442

Off-axis silicon carbide substrates  

DOE Patents (OSTI)

A method of epitaxial growth of a material on a crystalline substrate includes selecting a substrate having a crystal plane that includes a plurality of terraces with step risers that join adjacent terraces. Each terrace of the plurality or terraces presents a lattice constant that substantially matches a lattice constant of the material, and each step riser presents a step height and offset that is consistent with portions of the material nucleating on adjacent terraces being in substantial crystalline match at the step riser. The method also includes preparing a substrate by exposing the crystal plane; and epitaxially growing the material on the substrate such that the portions of the material nucleating on adjacent terraces merge into a single crystal lattice without defects at the step risers.

Edgar, James; Dudley, Michael; Kuball, Martin; Zhang, Yi; Wang, Guan; Chen, Hui; Zhang, Yu

2014-09-02T23:59:59.000Z

443

Two-axis sagittal focusing monochromator  

DOE Patents (OSTI)

An x-ray focusing device and method for adjustably focusing x-rays in two orthogonal directions simultaneously. The device and method can be operated remotely using two pairs of orthogonal benders mounted on a rigid, open frame such that x-rays may pass through the opening in the frame. The added x-ray flux allows significantly higher brightness from the same x-ray source.

Haas, Edwin G; Stelmach, Christopher; Zhong, Zhong

2014-05-13T23:59:59.000Z

444

Multi-axis planar slide system  

DOE Patents (OSTI)

An apparatus for positioning an item that provides two-dimensional, independent orthogonal motion of a platform in a X-Y plane. A pair of master and slave disks engages opposite sides of the platform. Rotational drivers are connected to master disks so the disks rotate eccentrically about axes of rotation. Opposing slave disks are connected to master disks on opposite sides of the platform by a timing belt, or are electronically synchronized together using stepper motors, to effect coordinated motion. The coordinated eccentric motion of the pairs of master/slave disks compels smooth linear motion of the platform in the X-Y plane without backlash. The apparatus can be a planar mechanism implemented in a MEMS device.

Bieg, Lothar F. (Albuquerque, NM)

2002-01-01T23:59:59.000Z

445

Subhas Chandra Bose: darling of the Axis  

E-Print Network (OSTI)

Bose (alias Basu) were well-known in India and Europe. Indians discredited Basu for taking a greater interest in Japanese right-wing politics than affairs at home. British intelligence indicated 198 that Subhas Bose's exile in Germany aroused... and Czechoslovakia. Bose always accepted Central Europe as Germany's sphere-of-influence. He concluded his article with the plaintive hope that India would never attempt to reach her potential by destroying another nation. Then why did Bose work with General...

Getz, Marshall Jay

2012-06-07T23:59:59.000Z

446

Helical axis stellarator with noninterlocking planar coils  

DOE Patents (OSTI)

The present invention generates stellarator fields having favorable properties (magnetic well and large rotational transform) by a simple coil system consisting only of unlinked planar non-circular coils. At large rotational transform toroidal effects on magnetic well and rotational transform are small and can be ignored. We do so herein, specializing in straight helical systems.

Reiman, A.; Boozer, A.H.

1984-03-06T23:59:59.000Z

447

Quantifying the Reproducibility of Heart Position During Treatment and Corresponding Delivered Heart Dose in Voluntary Deep Inhalation Breath Hold for Left Breast Cancer Patients Treated With External Beam Radiotherapy  

SciTech Connect

Purpose: Voluntary deep inhalation breath hold (VDIBH) reduces heart dose during left breast irradiation. We present results of the first study performed to quantify reproducibility of breath hold using bony anatomy, heart position, and heart dose for VDIBH patients at treatment table. Methods and Materials: Data from 10 left breast cancer patients undergoing VDIBH whole-breast irradiation were analyzed. Two computed tomography (CT) scans, free breathing (FB) and VDIBH, were acquired to compare dose to critical structures. Pretreatment weekly kV orthogonal images and tangential ports were acquired. The displacement difference from spinal cord to sternum across the isocenter between coregistered planning Digitally Reconstructed Radiographs (DRRs) and kV imaging of bony thorax is a measure of breath hold reproducibility. The difference between bony coregistration and heart coregistration was the measured heart shift if the patient is aligned to bony anatomy. Results: Percentage of dose reductions from FB to VDIBH: mean heart dose (48%, SD 19%, p = 0.002), mean LAD dose (43%, SD 19%, p = 0.008), and maximum left anterior descending (LAD) dose (60%, SD 22%, p = 0.008). Average breath hold reproducibility using bony anatomy across the isocenter along the anteroposterior (AP) plane from planning to treatment is 1 (range, 0-3; SD, 1) mm. Average heart shifts with respect to bony anatomy between different breath holds are 2 {+-} 3 mm inferior, 1 {+-} 2 mm right, and 1 {+-} 3 mm posterior. Percentage dose changes from planning to delivery: mean heart dose (7%, SD 6%); mean LAD dose, ((9%, SD 7%)S, and maximum LAD dose, (11%, SD 11%) SD 11%, p = 0.008). Conclusion: We observed excellent three-dimensional bony registration between planning and pretreatment imaging. Reduced delivered dose to heart and LAD is maintained throughout VDIBH treatment.

McIntosh, Alyson; Shoushtari, Asal N.; Benedict, Stanley H.; Read, Paul W. [Department of Radiation Oncology, University of Virginia, Charlottesville, Virginia (United States); Wijesooriya, Krishni, E-mail: kw5wx@virginia.edu [Department of Radiation Oncology, University of Virginia, Charlottesville, Virginia (United States)

2011-11-15T23:59:59.000Z

448

Left ventricular incision midway between the mitral anulus and the stumps of the papillary muscles during mitral valve excision with or without rupture or aneurysmal formation: Analysis of 10 necropsy patients  

Science Journals Connector (OSTI)

Certain clinical and morphologic observations are described in 10 patients who had mitral valve replacement (MVR) and lacerations of the left ventricular (LV) free wall midway between the anulus of the mitral valve and the stumps of the LV papillary muscles. In five patients the lacerations led to LV free wall rupture, with immediate hemopericardium in two and delayed (2 to 4 days) rupture in the other three. Of the other five patients, three developed aneurysm of the LV free wall, the mouth of which was located midway between mitral anulus and papillary muscle stumps, the sites of the lacerations observed in the other seven patients. The remaining two patients had midway lacerations which produced neither rupture nor aneurysmal formation. The midway LV lacerations are considered the result of LV incisions made at the time of mitral valve excision, generally in a setting where the left-sided cardiac chambers were only mildly dilated or normal and the tips of the blades of the scissors may have been inadequately visualized during mitral excision. This complication can be prevented by leaving the posterior mitral leaflet and its attached chordae intact or by applying exquisite care during the mitral excision procedure, or both. LV midway rupture may be the most common cause of death early after MVR and operatively induced LV lacerations may lead to LV aneurysm late postoperatively.

William C Roberts; Jeffrey M Isner; Renu Virmani

1982-01-01T23:59:59.000Z

449

Differential Renormalization of Supersymmetric Gauge Theories in Superspace  

E-Print Network (OSTI)

-Takahashi Identities in SQED . . . . . . . . . . . . . . . 62 5.1.3 Perturbative Calculations of Super WTI

Slatkin, Montgomery

450

Patrick T. McGowen, P.E., Ph.D. Research Engineer, Western Transportation Institute / Civil Engineering  

E-Print Network (OSTI)

jointly appointed between the Western Transportation Institute (WTI) and Civil Engineering Department

McGowen, Patrick

451

MMMAT H E M AT I C A LAT H E M AT I C A LAT H E M AT I C A L SSSC I E N C E SC I E N C E SC I E N C E S Undergraduate major  

E-Print Network (OSTI)

Transportation Institute (WTI). Cooperative on- campus projects involved the departments of Animal & Range

Maxwell, Bruce D.

452

Equivariant K-homology for some Coxeter groups  

Science Journals Connector (OSTI)

......of the cell, that is, there is an i such that wWTi = WTi so that w WTi WT . 784 RUB EN J. S ANCHEZ-GARC IA Secondly, we observe...spherical subsets of generators up to rank n. Define Ai = W WTi CWTi 0 i m. Then n = A i and Ai Aj n-1 for all i......

Rubén J. Sánchez-García

2007-06-01T23:59:59.000Z

453

Developing a Crash Prediction Model for Deer-Vehicle Collisions Neil DeZort  

E-Print Network (OSTI)

-Bozeman A report prepared for the WTI Undergraduate Research Experience Program April 28, 2010 #12;Developing

McGowen, Patrick

454

DEPARTMENT OF ECONOMICS AND FINANCE COLLEGE OF BUSINESS AND ECONOMICS  

E-Print Network (OSTI)

in the world of international trading today are: 1) West Texas Intermediate (WTI), the reference crude

Hickman, Mark

455

MMMAT H E M AT I C A LAT H E M AT I C A LAT H E M AT I C A L SSSC I E N C E SC I E N C E SC I E N C E S Undergraduate majors  

E-Print Network (OSTI)

Transportation Institute (WTI). Cooperative on- campus projects involved the departments of Animal & Range

Maxwell, Bruce D.

456

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 5. Human health risk assessment; evaluation of potential risks from multipathway exposure to emissions  

SciTech Connect

The report provide estimates of: (1) individual risks based on central tendency exposure; (2) individual risks based on maximum environmental concentrations; (3) risks to highly exposed or susceptible subgroups of the population (e.g., subsistence farmers and school children); (4) risks associated with specific activities that may result in elevated exposures (e.g., subsistence fishermen and deer hunters); and (5) population risk. This approach allows for the estimation of risks to specific segments of the population taking into consideration activity patterns, number of individuals, and actual locations of individuals in these subgroups with respect to the facility. The fate and transport modeling of emissions from the facility to estimate exposures to identified subgroups is described.

NONE

1997-05-01T23:59:59.000Z

457

Stat 39000/FinMath 34500 Lecture 8 STOCHASTIC INTEGRALS  

E-Print Network (OSTI)

INTEGRAND IF t IS NONRANDOM: t 0 sdWs = limit of ti+1t ti Wti ti+1t ti Wti : · LINEAR COMBINATION OF NORMAL RANDOM VARIABLES IS A NORMAL RANDOM VARIABLE · MEAN: E ti+1t ti Wti = 0 · VARIANCE: Var ( ti+1t ti Wti ) = ti+1t 2 ti Var (Wti ) = ti+1t 2 ti ti IN THE LIMIT: t 0 sdWs: · NORMAL RANDOM VARIABLE · MEAN IS ZERO

Mykland, Per A.

458

Posterior vs. Parameter Sparsity in Latent Variable Supplementary Material  

E-Print Network (OSTI)

(1) The Lagrangian becomes: L(q, c, , ) = KL(q||p) + wt cwt + wti wti(Eq[fwti] - cwt) - · c (2, , ) cwt = - i wti - wt (5) setting this to zero gives us wt = - i wti. Knowing that wt 0 we will have to introduce the constraint i wti. Substituting into the KL term we have: yields: KL(q||p) = z p(z) exp

Plotkin, Joshua B.

459

Stat 39100/FinMath 34600 Lecture 8 STOCHASTIC INTEGRALS  

E-Print Network (OSTI)

INTEGRAND IF t IS NONRANDOM: t 0 sdWs = limit of ti+1t ti Wti ti+1t ti Wti : · LINEAR COMBINATION OF NORMAL RANDOM VARIABLES IS A NORMAL RANDOM VARIABLE · MEAN: E ti+1t ti Wti = 0 · VARIANCE: Var ( ti+1t ti Wti ) = ti+1t 2 ti Var (Wti ) = ti+1t 2 ti ti IN THE LIMIT: t 0 sdWs: · NORMAL RANDOM VARIABLE · MEAN IS ZERO

Mykland, Per A.

460

Discrete Time Approximation and Monte-Carlo Simulation of Backward Stochastic Differential Equations  

E-Print Network (OSTI)

, ~Z ti-1 )(ti - ti-1) - ~Zti-1 · (Wti - Wti-1 ) , together with the final data ~Y tn = g(X tn-time approximation (Y , Z) : Y tn = g X tn , Z ti-1 = (ti - ti-1)-1 E Y ti (Wti - Wti-1 )|Fti-1 Y ti-1 = E Y ti expectations, involved in the above discretization scheme, reduce to the regression of Y ti and Y ti (Wti

Touzi, Nizar

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

MATH 56A SPRING 2008 STOCHASTIC PROCESSES 191 9.2. Integration wrt Brownian motion. We want to define the sto-  

E-Print Network (OSTI)

is given by t 0 Ys dWs := k i=1 Yi-1(Wti - Wti-1 ) + Yk(Wt - Wtk ) = Y W if t (tk, tk+1]. The first thing and notice that the future stuff has expectation zero by Lemma A. If s > t then Zs = m i=1 Yi-1 Wti - Wti-1 )E(W2 ) #12;194 STOCHASTIC INTEGRATION since Y, W are independent. In fact, we know that W = Wti

Igusa, Kiyoshi

462

[Cover page, Margins: Left 1 in  

NLE Websites -- All DOE Office Websites (Extended Search)

1/479 1/479 Real-Time Dynamic Brake Assessment Proof of Concept Test Final Report 1 November 2011 Prepared by Mary Beth Lascurain Hudson Oscar Franzese Gary Capps DOCUMENT AVAILABILITY Reports produced after January 1, 1996, are generally available free via the U.S. Department of Energy (DOE) Information Bridge. Web site http://www.osti.gov/bridge Reports produced before January 1, 1996, may be purchased by members of the public from the following source. National Technical Information Service 5285 Port Royal Road Springfield, VA 22161 Telephone 703-605-6000 (1-800-553-6847) TDD 703-487-4639 Fax 703-605-6900 E-mail info@ntis.gov Web site http://www.ntis.gov/support/ordernowabout.htm Reports are available to DOE employees, DOE contractors, Energy Technology Data Exchange (ETDE)

463

[Cover page, Margins: Left 1 in  

NLE Websites -- All DOE Office Websites (Extended Search)

9/87 9/87 Design Study for a Low-Enriched Uranium Core for the High Flux Isotope Reactor, Annual Report for FY 2008 March 2009 Prepared by R. T. Primm III D. Chandler G. Ilas B. C. Jolly J. H. Miller J. D. Sease DOCUMENT AVAILABILITY Reports produced after January 1, 1996, are generally available free via the U.S. Department of Energy (DOE) Information Bridge. Web site http://www.osti.gov/bridge Reports produced before January 1, 1996, may be purchased by members of the public from the following source. National Technical Information Service 5285 Port Royal Road Springfield, VA 22161 Telephone 703-605-6000 (1-800-553-6847) TDD 703-487-4639 Fax 703-605-6900 E-mail info@ntis.fedworld.gov

464

[Cover page, Margins: Left 1 in  

NLE Websites -- All DOE Office Websites (Extended Search)

10/255 10/255 Medium Truck Duty Cycle Data from Real-World Driving Environments: Project Interim Report 5 January 2011 Prepared by Oscar Franzese, Mary Beth Lascurain, Gary Capps R&D Staff DOCUMENT AVAILABILITY Reports produced after January 1, 1996, are generally available free via the U.S. Department of Energy (DOE) Information Bridge. Web site http://www.osti.gov/bridge Reports produced before January 1, 1996, may be purchased by members of the public from the following source. National Technical Information Service 5285 Port Royal Road Springfield, VA 22161 Telephone 703-605-6000 (1-800-553-6847) TDD 703-487-4639 Fax 703-605-6900 E-mail info@ntis.gov Web site http://www.ntis.gov/support/ordernowabout.htm Reports are available to DOE employees, DOE contractors, Energy Technology Data Exchange

465

[Cover page, Margins: Left 1 in  

NLE Websites -- All DOE Office Websites (Extended Search)

32 32 Supply Chain-Based Solution to Prevent Fuel Tax Evasion: Proof of Concept Final Report November 2011 Prepared by Gary Capps Mary Beth Lascurain Oscar Franzese Duncan Earl David West Timothy McIntyre Shih-Miao Chin Ho-Ling Hwang Raynella Connatser Samuel Lewis ORNL/TM-2011/132 Energy and Transportation Science Division SUPPLY CHAIN-BASED SOLUTION TO PREVENT FUEL TAX EVASION: PROOF OF CONCEPT FINAL REPORT Gary Capps Mary Beth Lascurain Oscar Franzese Duncan Earl David West Timothy McIntyre Shih-Miao Chin Ho-Ling Hwang Raynella Connatser Samuel Lewis Date Published: November 2011 Prepared by OAK RIDGE NATIONAL LABORATORY Oak Ridge, Tennessee 37831-6283 managed by UT-BATTELLE, LLC for the U.S. DEPARTMENT OF ENERGY

466

[Cover page, Margins: Left 1 in  

Office of Scientific and Technical Information (OSTI)

E. Jellison, Pooran Joshi, Fred List, Parans Paranthaman, Chad Parish, Andrew Wereszczak Oak Ridge National Laboratory DOCUMENT AVAILABILITY Reports produced after January 1,...

467

From left to right: Dina Brooks, Acting  

E-Print Network (OSTI)

level of stuttering during a job interview to illustrate a time when I was challenged and how I overcame

Sokolowski, Marla

468

[Cover page, Margins: Left 1 in  

NLE Websites -- All DOE Office Websites (Extended Search)

(typically 242 Pu) were located in the flux trap for californium production. Today, curium targets are transmuted for californium production. The 37 rods modeled in HFV4.0...

469

I Left My Body Lying Somewhere  

E-Print Network (OSTI)

avatar was literally a zero. "We don't need to fake it, we need to harness it. Point it in the right direction and let it take off by itself." "But how?" someone asked. "Sounds to me like you need to create something in the real world that... think there could be something so perfect, so complete, that the only explanation for its existence is that some benevolent being loves you and created it just for you?" "Have you seen my wife?" "That's not what I meant. I mean, like something...

2007-03-27T23:59:59.000Z

470

DECEMBER 2009 THIS PAGE INTENTIONALLY LEFT BLANK  

E-Print Network (OSTI)

for heating or cooking; hardware; sewing accessories; Christmas light sets; ink; small arms ammunition

471

LEFT-HANDEDNESS.—A HINT FOR EDUCATORS  

Science Journals Connector (OSTI)

...mountain homes are in the midst of giant redwoods, that their streams are the resorts of...plate, 1, 2), and paddles his canoe of redwood in the fish-prolific waters of the Trinity...himself in a sweat-house, sat on a humble chair (4), slept like an oriental on...

1887-02-18T23:59:59.000Z

472

Analise Matematica I LEBio, LEFT, LMAC  

E-Print Network (OSTI)

´a a m´edia aritm´etica das notas dos dois testes, as quais s´o ser~ao consideradas se forem ambas iguais¸c~ao, a Nota Final (quando inferior a 17 valores) ser´a a m´edia ponderada da Nota da Avalia¸c~ao Escrita e da

Girão, Pedro M.

473

Current Experiments in Elementary Particle Physics (Revised June 1992)  

E-Print Network (OSTI)

U) LAMPF-806 U) LAMPF-849 SMITH W.tI. SMITH W.H. SMOLYANKIN,h. ,t,_rmin,_ tlm :WAr i}r,.I,wti,,n rate. The delector was

Galic, H.

2010-01-01T23:59:59.000Z

474

Volatility Persistence in Crude Oil Markets Amlie CHARLES  

E-Print Network (OSTI)

oil markets ­ Brent, West Texas Intermediate (WTI) and Organization of Petroleum Exporting Countries Operation Desert Storm with a negative return of -42% for WTI (Askari and Krichene, 2008; Larsson

Boyer, Edmond

475

MTHODES BASIQUES EN STATISTIQUE TD 2, 28 SEPTEMBRE 2012  

E-Print Network (OSTI)

aléatoires Wti+1 - Wti sont indépendantes de loi N(0, ti+1 - ti). (1) Montrer que ce problème peut être

Castillo, Ismaël

476

AUTOMATED RADIO NETWORK DESIGN USING ANT COLONY OPTIMIZATION  

E-Print Network (OSTI)

and guidance. I am very grateful to the Western Transportation Institute (WTI) for extending a graduate to this research. I would like to thank several people at WTI for their help and technical insight, including Bill

Dyer, Bill

477

The Annals of Applied Probability 2008, Vol. 18, No. 1, 143177  

E-Print Network (OSTI)

+1, ^Zn i )h}, (1.4) where h T n and ti ih,i = 0,1,...,n, and Wi+1 Wti+1 - Wti . Here, of course, Eti

Zhang, Jianfeng

478

Discrete time approximation of decoupled Forward-Backward SDE with jumps  

E-Print Network (OSTI)

+ T n h X ti , ¯Y ti , ¯Z ti where ¯Y tn := g(X tn ) and Wi+1 := Wti+1 - Wti . In the no-jump case

Elie, Romuald

479

The efficiency of the crude oil markets: Evidence from variance ratio tests  

E-Print Network (OSTI)

oil market is weak-form efficiency while the WTI crude oil market seems to be inefficiency on the 1994­2008 sub-period, suggesting that the deregulation have not improved the efficiency on the WTI crude oil

Paris-Sud XI, Université de

480

The hadronic vacuum polarization with twisted boundary conditions  

E-Print Network (OSTI)

as in Eq. (1.2) above. The relevant Ward­ Takahashi identity (WTI) gets modified by twisting, leading- tum. Then, in Sec. III, we formulate the WTI, and demonstrate that this identity contains a contact

Golterman, Maarten

Note: This page contains sample records for the topic "left axis wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

PHYSICAL REVIEW E 87, 012814 (2013) Carbon-dioxide emissions trading and hierarchical structure in worldwide finance  

E-Print Network (OSTI)

of the stock market indicators and those of the EU CO2 emission allowance (EUA) and crude oil futures (WTI WTI) with that of the stock market indicators, and is markedly different (>20 days) from 0, showing

Stanley, H. Eugene

482

College of Engineering Points of Excellence  

E-Print Network (OSTI)

in the environment. WTI's Tony Clevenger leads effort to determine longterm benefits of wildlife crossings crossings. WTI researcher Tony Clevenger is involved in research to determine how wildlife crossings affect

Dyer, Bill

483

DEPARTMENT OF ECONOMICS AND FINANCE COLLEGE OF BUSINESS AND ECONOMICS  

E-Print Network (OSTI)

and futures returns of two major benchmark international crude oil markets, Brent and WTI, to calculate suggest holding futures in larger proportions than spot. For WTI, however, DCC and BEKK suggest holding

Hickman, Mark

484

Tungsten-Titanium as Advanced Material for RF-MEMS Switches  

Science Journals Connector (OSTI)

In this paper we present first results on the development of high temperature stable tungsten-titanium (WTi) based MEMS cantilevers, using conventional sputter ... and wet chemical etching. By synthesizing two WTi

Stefan Klein; Helmut Seidel; Ulrich Schmidt…

2008-01-01T23:59:59.000Z

485

From molecular changes to customised therapy A. Hemminki*,1  

E-Print Network (OSTI)

and the Gene Therapy Center, University of Alabama at Birmingham, WTI #602, 1824 6th Ave S., Birmingham, AL

Hemminki, Akseli

486

UNIVERSITY OF WISCONSIN-MADISON Subject CONSENT to Participate in Research  

E-Print Network (OSTI)

or different in people with and without developmental disabilities. R. WHAT WTI T MY PARTICIPATION TNVOT VE

Vorperian, Houri K.

487

Vita: ROBERT K. KAUFMANN Center for Energy & Environmental Studies 23 Hope Street  

E-Print Network (OSTI)

, M. and R.K. Kaufmann, 2013, The role of trader positions in spot and futures prices for WTI, Energy

Hutyra, Lucy R.

488

Frank Rioux St. John's University  

E-Print Network (OSTI)

. Osmosis. r represents the chemical system; 8, the thermal reservoir: and wti and wt2, weights which

Rioux, Frank

489

A Note on the Sensitivity Analysis for Stationary and Ergodic Queues  

E-Print Network (OSTI)

) This is formula (10) of [2]. Omitting for readability whenever no confusion arises and letting Ri() = Wti ( +

Zazanis, Michael A.

490

WRRC REPORT No. 4 WASHINGTON, D.C. 20008  

E-Print Network (OSTI)

. Harris, Dr. C. L. Dennard (President, WTI), Mr. D. Geller, Mr. W. E. Trieschman, Mr. P. W. Eastman, Mr. L

District of Columbia, University of the

491

The University of Chicago Department of Statistics  

E-Print Network (OSTI)

movements of WTI crude oil prices can be observed during the period from 1986 to 2008. Spectral analysis

Stephens, Matthew

492

Glen Canyon Dam, Fluctuating Water Levels, and Riparian Breeding Birds: The Need for Management Compromise  

E-Print Network (OSTI)

of the lake coincided WtI 1Paper presented at the North American several years of above average snowfall

493

WORKING PAPER N 2011 23 Inherited vs Self-Made Wealth  

E-Print Network (OSTI)

..................................................................p.17 3.4. Using estate tax data in order to estimate Gt(wti,bti*) ............................p.19 3

Paris-Sud XI, Université de

494

Oil Price Trackers Inspired by Immune Memory William Wilson , Phil Birkin , and Uwe Aickelin  

E-Print Network (OSTI)

Analysis of oil price trends The price of WTI crude oil (a world marker price for oil price movements

Aickelin, Uwe

495

On Assessing Robustness in Transportation Planning  

E-Print Network (OSTI)

that commodity. Also, for each commodity i, a weight wti : E R+ 0 is dened that quanties the provided quality of service (QoS), when this com- modity is routed along an edge e or a path p, where wti(p) = ep wti(e). Smaller weight means better QoS. When a commodity is not routed along its shortest w.r.t. wti (optimal w

Zaroliagis, Christos D.

496

Forecasting the conditional volatility of oil spot and futures prices with structural breaks and long memory models  

E-Print Network (OSTI)

downturns as a result of the September 11, 2001 terrorist attack, the West Texas Intermediate (WTI) spot

Paris-Sud XI, Université de

497

R Supplement R.1 First Things First  

E-Print Network (OSTI)

. soiltemp - A 64 Ã? 36 matrix of surface soil temperatures. Chapter 2 oil - Crude oil, WTI spot price FOB (in

498

Pion masses in 2-flavor QCD with condensation Sinya Aoki1,2  

E-Print Network (OSTI)

to be consistent with the chiral Ward-Takahashi identities (WTI). 2 #12;PHASE STRUCTURE, MASSES AND TOPOLOGICAL

Creutz, Michael

499

bornes d'un galvanomtre, il se produit sous l'influence du champ une force lectromotrice entre ces  

E-Print Network (OSTI)

Scieiices, t. WTI, p. ~~ g (; g~ 7 ) ~ Article published online by EDP Sciences and available at http

Paris-Sud XI, Université de

500

Yes, Minority and Underserved Populations Will Participate in Biospecimen Collection  

Science Journals Connector (OSTI)

...12.5kb 12.5kb p15INK4 Bam HI 1.3kb WTI BamHl Fig. 2. Deletion of pl5INK4B and...4.3kb " ^ ^P ^tedfc ^^^^ ^^^^ WTI EcoRI Table 1 Cylogenelic analysis of TRKE...p16INK4 Pstl ^^^H^^^HIHIIJI^K, WTI Pstl WTI Pstl Fig. 7. Deletion of pIS...

Edward E. Partridge

2014-06-01T23:59:59.000Z