National Library of Energy BETA

Sample records for lead agency doc

  1. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  2. Property:LeadAgency | Open Energy Information

    Open Energy Info (EERE)

    Subproperties This property has the following 1 subproperty: R RAPIDRoadmap9-FD-k Pages using the property "LeadAgency" Showing 25 pages using this property. (previous...

  3. Microsoft Word - Final Lead Assembly SA.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... of European Fabrication of Lead MOX Assemblies. ...... 20 Table 4. Comparison of Human Health ...

  4. Energy Secretary Bodman Leads US Delegation to International Energy Agency

    Energy Savers [EERE]

    Ministerial | Department of Energy Leads US Delegation to International Energy Agency Ministerial Energy Secretary Bodman Leads US Delegation to International Energy Agency Ministerial May 2, 2005 - 12:41pm Addthis PARIS, FRANCE -- Secretary of Energy Samuel W. Bodman this week is leading the U.S. Delegation to the Ministerial Meeting of the International Energy Agency (IEA), being held in Paris. Secretary Bodman will emphasize three principles at the IEA Ministerial -- that energy security

  5. Microsoft Word - Position on the use of lead shielding 05-15-061.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1120 Position Paper on the Use of Lead Shielding for the Disposal of Low Level Waste at the Nevada Test Site Revision 2, June 2, 2005 Approved By: U.S. Department of Energy National Nuclear Security Administration Nevada Site Office Original Signed by Gary Pyles 05/17/2006 Gary Pyles, NNSA/NSO, RWAP Task Manager Date Concur: Original Signed James B. Zovi 05/17/2006 James B. Zovi, Bechtel Nevada, RWAP Manager Date Prepared By: Bechtel Nevada, Radioactive Waste Acceptance Program Original Signed

  6. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  7. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  8. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  9. Key Agency Targets Summary _FY 2012_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    all projects in the capital work plan; and 3) At least 80% of Capital Allocation Board (CAB) approved "major capital investment" projectprogram elements of cost, schedule, and...

  10. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  11. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  12. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  13. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  14. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  15. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  16. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  17. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  18. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  19. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  20. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  1. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  2. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  3. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  4. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  5. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  6. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  7. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  8. Reporting Guidance for Federal Agency Annual Report on Energy...

    Broader source: Energy.gov (indexed) [DOE]

    factors for that period. It is only to be completed if an agency discovers an error in a previously reported annual data prior to FY 2008. 2015reportingrequirements.doc...

  9. Advanced Research Projects Agency - Energy Program Specific Recovery Plan

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Research Projects Agency - Energy Program Specific Recovery Plan Advanced Research Projects Agency - Energy Program Specific Recovery Plan PDF icon Microsoft Word - 44F1801D.doc More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 Advanced Research Projects Agency -EnergyDepartment Audit Report: OAS-RA-11-11

  10. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  11. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  12. TentativeAgreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  13. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  14. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  15. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  16. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  17. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  18. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  19. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  20. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  1. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  2. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  3. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  4. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  5. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  6. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  7. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  8. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  9. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  10. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  11. titlepg.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 (Released October 8, 1997) Energy Information Administration DOE/EIA-0202(97/4Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections Fourth Quarter 1997 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be

  12. Environmental Records.doc

    Office of Environmental Management (EM)

    LIST OF TERMS ALARA as low as reasonably achievable CAA Clean Air Act CEQ Council on Environmental Quality CERCLA Comprehensive Environmental Response, Compensation, and Liability Act CFR Code of Federal Regulations CX categorical exclusion DOE U.S. Department of Energy EA environmental assessment ECL environmental checklist EIS environmental impact statement EPA U.S. Environmental Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of 1986 FFA&CO Federal Facility

  13. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  14. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  16. Flash2007-33DomesticDeliveryParticipatingAgencies.doc

    Energy Savers [EERE]

    Securities and Exchange Commission 900,500.00 13 Department of TransportationFederal Motor Carrier Safety Administration 252,027.08 14 Pension Benefit Guaranty Corporation ...

  17. Microsoft Word - FOIA NOT AGENCY RECORD RESPONSE.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 11, 2013 CERTIFIED MAIL Mr. Ryan Henry Law Offices of Ryan Henry, P.L.L.C. 1380 Pantheon Way, Suite 215 San Antonio, Texas 78232 Dear Mr. Henry: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00782) This letter is in response to your electronic Freedom of Information Act (FOIA) request that you sent to the Department of Energy (DOE), Richland Operations Office (RL) requesting documents relating to the jobs performed by Dritherm International, Inc., from January 1, 1995, to present, including

  18. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  19. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  20. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  1. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  2. Fonsi.Leo.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AGENCY: U.S. Department of Energy ACTION: Finding of No Significant Impact SUMMARY: The U.S. Department of Energy (DOE) has prepared an Environmental Assessment (EA), DOE/EA-1319, to assess environmental impacts associated with the disposition of surplus Hanford Site uranium. DOE has identified 1,866 metric tons of uranium (MTU) on the Hanford Site as surplus. As of late calendar year 1999, the predominant amount of approximately 1,700 MTU [1,866 MTU minus 140 MTU (135 MTU of contaminated fuel

  3. AL2007-03.doc

    Broader source: Energy.gov (indexed) [DOE]

    from GAO and Inspector General (IG) reports of other federal agencies. Introduction The IA relationship involves two Federal agencies that enter into a relationship for the...

  4. Microsoft Word - Vol II_FM.doc

    National Nuclear Security Administration (NNSA)

    2006 EPA/600/R-05/144bF Air Quality Criteria for Lead Volume II of II EPA/600/R-05/144bF October 2006 Air Quality Criteria for Lead Volume II National Center for Environmental Assessment-RTP Division Office of Research and Development U.S. Environmental Protection Agency Research Triangle Park, NC PREFACE National Ambient Air Quality Standards (NAAQS) are promulgated by the United States Environmental Protection Agency (EPA) to meet requirements set forth in Sections 108 and 109 of the U.S.

  5. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 2002 1 Short-Term Energy Outlook September 2002 Overview World Oil Markets: The waxing and waning intensities of concern surrounding potential military action against Iraq and uncertainty over OPEC production policy leading up to their September 19 meeting have contributed to WTI spot crude oil prices bouncing between $26 and $30 per barrel since early August. The average spot WTI price in August was $28.40 per barrel. Developments suggesting an easing of tensions could temporarily

  6. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  7. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  8. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  9. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  10. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  11. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  12. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  13. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  14. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  15. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  16. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  17. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  18. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  19. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  1. Microsoft Word - Appendix F_OfficialContactList.doc

    Office of Legacy Management (LM)

    Official Contact List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page F-3 Long-Term Surveillance and Maintenance Emergency Contact List Environmental Protection Agency Mr. Dan Wall Remedial Project Manager Superfund Division U.S. EPA Region 7 901 North 5 th Street Kansas City, Kansas 66101 (913) 551-7710 Missouri Department of Natural Resources Mr. Robert Geller Chief, Federal Facilities Section Missouri Department of Natural Resources 1738 East Elm

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  3. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  4. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  5. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  6. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  7. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  8. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  9. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  10. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  11. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  12. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  13. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  14. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  15. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  16. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  17. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  18. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  19. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  20. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  1. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  2. al99-06.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  3. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  4. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  5. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  6. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  7. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  8. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  9. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  10. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  11. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  12. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  13. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  14. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  17. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  18. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  19. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  20. Agency Sub-

    Office of Environmental Management (EM)

    Report as of March 2016 Agency Sub- agency Title Of Initiative/Rule or ICR RIN/OMB Control Number Summary of Initiative Status of Initiative -- New to this update, Ongoing, or Completed Target Completion Date (if completed, please add the publication date and cite in Federal Register for example) Does the Initiative include regulatory flexibilities such as pilot projects, safe harbor exemptions, sunset provisions, trigger provisions, streamlined requirements, state flexibilities, or other

  1. Agency Sub-

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    February 2015 Agency Sub- agency Title Of Initiative/Rule or ICR RIN/OMB Control Number Summary of Initiative Status of Initiative -- New to this update, Ongoing, or Completed Target Completion Date (if completed, please add the publication date and cite in Federal Register for example) Does the Initiative include regulatory flexibilities such as pilot projects, safe harbor exemptions, sunset provisions, trigger provisions, streamlined requirements, state flexibilities, or other similar

  2. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  3. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  4. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  5. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  6. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  7. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  8. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  9. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  10. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  11. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  12. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  13. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  14. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  15. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  16. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  17. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  18. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  19. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  20. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  1. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  2. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  3. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  4. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  5. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  6. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  7. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  8. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  9. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME...

  10. Microsoft Word - secondqmetric.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and the CAPT group Lawrence Livermore National Laboratory Livermore, California UCRL-TR-219973 This document was prepared as an account of work sponsored by an agency of the...

  11. Microsoft Word - table_26.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Fueled Vehicles"; state agencies; Form EIA-23, "Annual Survey of Domestic Oil and Gas Reserves"; PointLogic Energy; DI; Ventyz; and EIA estimates based on historical data. Table 27...

  12. Microsoft Word - Chapter 01.doc

    National Nuclear Security Administration (NNSA)

    INTRODUCTION AND PURPOSE AND NEED FOR AGENCY ACTION 1-1 1.0 INTRODUCTION AND PURPOSE AND NEED FOR AGENCY ACTION 1.1 Introduction This Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site Locations in the State of Nevada (NNSS SWEIS) analyzes potential environmental impacts of continued management and operation of the Nevada National Security Site (NNSS) (formerly known

  13. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    The alternative fuel demonstration project was transferred to the U.S. Department of Energy's Golden Field Office. The Nevada Desert Free Air Carbon Dioxide Enrichment Facility was built. S.3.1.5 Work-for-Others Programs The Weapons of Mass Destruction First Responder Training Program was transferred to the Federal Emergency Management Agency. The Defense Threat Reduction Agency Hard Target Defeat Program is inactive other than tests of small air-dropped munitions against tunnel targets. The

  14. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  15. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  16. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  17. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 1. Introduction The Department of Energy sees the implementation of the Plain Writing Act as an important initiative that helps the Department share relevant information in a way that is clear, concise, and informative. The areas referenced in this report are only a few of the successes we have encountered as we continue to implement the Act. 1. Departmental Plain Writing Officials 2. Ingrid Kolb, Director of the Office of Management, Senior Agency Official Responsible for Plain Writing 3.

  18. Microsoft Word - fonsi-1.doc

    Office of Legacy Management (LM)

    Finding of No Significant Impact Ground Water Compliance at the Shiprock Uranium Mill Tailings Site Agency: U.S. Department of Energy Action: Finding of No Significant Impact (FONSI) Summary: The U.S. Department of Energy (DOE) proposes to conduct ground water remediation at the former Shiprock, New Mexico, uranium mill tailings site. The purpose of the proposed action is to meet U.S. Environmental Protection Agency ground water standards as defined in Title 40 Part 192 of the Code of Federal

  19. International Energy Agency

    Broader source: Energy.gov [DOE]

    DOE's market transformation efforts have reached to European and other countries who are part of the international distributed and decentralized energy community. Through its partnership with DOE, the combined heat and power (CHP) program of the International Energy Agency (IEA) conducts research and analysis of CHP markets and deployment efforts around the world and has used lessons learned from U.S. research, development, and deployment efforts to recommend market transformation activities and policies that will lead to new CHP installations worldwide.

  20. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  1. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  2. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  3. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Environmental Management (EM)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  4. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  5. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  6. Q1 1998 STEO Docs

    Gasoline and Diesel Fuel Update (EIA)

    8 (Released January 12, 1998) Energy Information Administration DOE/EIA-0202(98/1Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections First Quarter 1998 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be

  7. Microsoft Word - fourthqmetric 2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    comparison of model short-range forecasts and the ARM Microbase data. September 19, 2006 J. Hnilo Lawrence Livermore National Laboratory Livermore, California UCRL-TR-224648 This document was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor the University of California nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or

  8. Microsoft Word - Chapter 06.doc

    National Nuclear Security Administration (NNSA)

    6 CUMULATIVE IMPACTS 6-1 6.0 CUMULATIVE IMPACTS Council on Environmental Quality (CEQ) National Environmental Policy Act (NEPA) regulations (42 United States Code [U.S.C.] 4321 et seq.) define a cumulative impact as the "impact on the environment which results from the incremental impact of the action when added to past, present, and reasonably foreseeable future actions regardless of what agency (Federal or non-Federal) or person undertakes such other actions. Cumulative impacts can result

  9. Microsoft Word - Chapter 10.doc

    National Nuclear Security Administration (NNSA)

    0 CONSULTATION AND COORDINATION 10-1 10.0 CONSULTATION AND COORDINATION Chapter 10 presents an overview of the National Nuclear Security Administration's (NNSA's) consultation and coordination efforts with other Federal, state, and local government agencies and American Indian groups during the development of this Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site

  10. fleetappforms04f1298.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    fleetappforms04f1298.doc&#0; More Documents & Publications pocforms06a0399.doc&#0; Inspection Report: INS-O-09-04 Inspection Report: INS-O-06-01

  11. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcript_jedi_model.doc Microsoft Office document icon transcript_jedi_model.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  12. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc Microsoft Office document icon expanding_chp_in_your_state.doc More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  13. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. PDF icon DOCS System Configuration Management Plan More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL Baseline

  14. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc Microsoft Office document icon 20130226_sunshot_transcript_lbnl.doc More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Photos of T Building Rooms with Special ICs This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page D-1 Figure D-1. T Building Rooms with Special ICs Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page D-2 Figure D-2. T Bldg. Room 16 View A Figure D-3. T Bldg. Room 16 View B Figure D-4. T Bldg. Room 16 View

  16. Residential Retrofit Program Design Guide Overview Transcript.doc |

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Residential Retrofit Program Design Guide Overview Transcript.doc Microsoft Office document icon Residential Retrofit Program Design Guide Overview Transcript.doc More Documents & Publications Residential Retrofit Program Design Guide Overview Transcript.doc Residential Retrofit Design Guide Overview Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript

  17. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section 311 AL FAL Feb 17 2010 Financial Assistance Letter No. FAL 2006-03

  18. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides Presentations, Women-Owned Small Business Forum (May 2013)

  19. Microsoft Word - meritrev.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For Financial Assistance Application Content and Evaluation Criteria/Process Application Content and Evaluation Criteria/Process

  20. AcqGuide37pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide37pt1.doc&#0; PDF icon AcqGuide37pt1.doc&#0; More Documents & Publications Chapter 37 - Service Contracting Microsoft Word - AcqGuide37pt1 binney Nov 2010 Special Review: OAS-M-15-05

  1. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide4pt1.doc&#0; PDF icon AcqGuide4pt1.doc&#0; More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  2. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt5.doc&#0; AcqGuide70pt5.doc&#0; PDF icon AcqGuide70pt5.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts CHAPTER 3 Policy Flash 2013-62 Acquisition Letter 09 - Revision of Department of Energy (DOE) Order 350.1 and Special H Clause

  3. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Policy Flash 2013-30 Acquisition Letter on Acquisition Planning Considerations for Management and Operating Contracts

  4. Microsoft Word - AL2005-15.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5.doc Microsoft Word - AL2005-15.doc PDF icon Microsoft Word - AL2005-15.doc More Documents & Publications Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Public comment re Price-Anderson Act Public Comment on Price Anderson Act from the University of Chicago

  5. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo AcqGuide70.52Matrixpart2Redo-OPAM

  6. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Recovery Act: Wind Energy Consortia between Institutions of Higher Learning and Industry Microsoft Word - kDE-FOA-0000090.rtf DISCLAIMER:

  7. AcqGuide3pt1.doc | Department of Energy

    Energy Savers [EERE]

    pt1.doc&#0; AcqGuide3pt1.doc&#0; PDF icon AcqGuide3pt1.doc&#0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&#0;

  8. Microsoft Word - Cross Reference Matrix Introduction.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & Publications Quality Assurance Requirements USA RS Basic Contract - Contract No.: DE-RW0000005 Office of Civilian Radioactive Waste Management-Quality Assurance Requirements and Description

  9. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - AcqGuide70pt52Matrixpart2Redo Part 2, Clauses Prescribed in DEAR Parts 952 and 970

  10. CompleteProject List.doc | Department of Energy

    Office of Environmental Management (EM)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  11. al99-06attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    attachment.doc&#0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes

  12. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Environmental Management (EM)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc PDF icon Microsoft Word - Political Activity and the Federal Employee.doc More Documents & Publications Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE EIS-0307: Withdrawal of Notice of Intent to Prepare an Environmental Impact Statement

  13. Microsoft Word - al95-14.doc | Department of Energy

    Office of Environmental Management (EM)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union CDLB-1003.PDF&#0; 10 CFR 600.325 - Intellectual Property Provisions (GDLB-1003) Grant

  14. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Environmental Management (EM)

    fal2004-04.doc Microsoft Word - fal2004-04.doc PDF icon Microsoft Word - fal2004-04.doc More Documents & Publications Financial Assistance Guide (2013) For Profit Audits - Information Related to 12/21/11 Federal Register Notice Policy Flash Search Listing (2001-2014)

  15. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Environmental Management (EM)

    CSATCourseCatalog_02.doc Microsoft Word - CSATCourseCatalog_02.doc classroom-1008856_960_720.jpg PDF icon Microsoft Word - CSATCourseCatalog_02.doc More Documents & Publications CSAT Course Catalog Headquarters Facilities Master Security Plan - Chapter 17, Headquarters Security Officer Program Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program

  16. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing (2001-2014) POLICY FLASH 2015-32 - FAC 2005-83

  17. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers Clean Cities Regional Support & Petroleum Displacement Awards Clean Cities 2009 Petroleum Displacement Awards

  18. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Environmental Management (EM)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc PDF icon Microsoft Word - LibraryofPriorRulemakings.doc More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  19. Microsoft Word - figure_03.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2014 10 U.S. Energy Information Administration | Natural Gas Annual Figure 3. Marketed production of natural gas in the United States and the Gulf of Mexico, 2014 (million cubic feet) None 1-15,000 15,001-100,000 100,001-200,000 200,001-500,000 500,001 and over Sources: Energy Information Administration (EIA), Form EIA-895, "Annual Quantity and Value of Natural Gas Report"; Form EIA-914, "Monthly Natural Gas Production Report"; state agencies; Form EIA-23, "Annual Survey

  20. Habadv#165 RCBRA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  1. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  2. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    Gunnison, Colorado, Processing Site September 2010 LMS/GUP/S06692 This page intentionally left blank LMS/GUP/S06692 2010 Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report-Gunnison, Colorado, Processing Site September 2010 Doc. No. S06692 Page i Contents

  3. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Present Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page A-iii Contents A1.1 Location and Property Ownership ................................................................................1 A1.2 Physiography and Topography.....................................................................................4 A1.3 Hydrogeology

  4. Microsoft Word - 44F1801D.doc

    Broader source: Energy.gov (indexed) [DOE]

    ARPA-E) Final_June 5 Advanced Research Projects Agency - Energy (ARPA-E) PSRP: Advanced Research Projects Agency - Energy (ARPA-E) ($400 Million) PSRP Lead Program Office and/or Laboratory/Site Office: ARPA-E PSRP Lead Manager: Shane Kosinski, Acting Deputy Director phone: (202) 586-4336 e-mail: Shane.Kosinski@hq.doe.gov address: 1000 Independence Ave, SW, Washington, DC 20585 Does this program align with an existing PART program? Y/N No Does this program align with an existing CFDA program? Y/N

  5. Microsoft Word - Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    08 1 December 2008 Short-Term Energy Outlook December 9, 2008 Release Highlights The current global economic slowdown is now projected to be more severe and longer than in last month's Outlook, leading to further reductions of global energy demand and additional declines in crude oil and other energy prices. The monthly average price of West Texas Intermediate (WTI) crude oil has fallen by more than half between July and November, reflecting the fallout from the rapid decline in world petroleum

  6. Microsoft Word - Synakowski.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 March 2016 Science on Saturday: Reimagining the Possible: Scientific Transformations Shaping the Path Towards Fusion Energy Edmund Synakowski Associate Director of Science for Fusion Energy Sciences Department of Energy ABSTRACT: Leading challenges and the role of transformation in the fusion and plasma sciences - The fusion energy and plasma sciences have undergone remarkable transformational events in its history. Many of these events have shaped and reshaped our understanding of what the

  7. Microsoft Word - 20111012_RAP Dec_Mtg_Topics.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October12, 2011 1/2 Potential December RAP Committee Meeting Agenda Topics Topic/Purpose (incl. any framing questions) 2012 Priority? Issue Managers (* denotes lead) Agency Lead (s) Time Allocation 618-10&11 * Characterization (bottles) * Etc. TBD TBD TBD 60 min (30 min) 100 - K * What RAP will do based on review of Proposed Plan * River Corridor decisions - schedule * In situ technology development - status * Discuss potential concerns (advice points?) TBD TBD TBD 120 min Site-wide Permit *

  8. Microsoft Word - Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 2010 1 May 2010 Short-Term Energy Outlook May 11, 2010 Release Highlights  EIA projects U.S. real gross domestic product (GDP) will grow by 3.0 percent and world real oil-consumption-weighted GDP will increase by 3.6 percent in 2010, both of which are 0.2 percent higher than in the previous Outlook. The 2011 forecast for real GDP growth is at 2.9 percent and 3.7 percent for the United States and the world, respectively.  The more optimistic economic growth forecasts lead to an increase

  9. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Final Sample Participant Profile November 2008.doc

  10. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR-Provisions-FederalAcquisitionReg.doc Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc PDF icon Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc

  11. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&#0; EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc

  12. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&#0; 2011-31 Attachment Aquisition Letter AcqGuide38pt1.doc&#0;

  13. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  14. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    Report for the Gunnison, Colorado, Processing Site August 2009 LMS/GUP/S05527 This page intentionally left blank LMS/GUP/S05527 2009 Verification Monitoring Report for the Gunnison, Colorado, Processing Site August 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. No. S05527 Page i Contents

  15. Microsoft Word - S06371_VMR_060210.doc

    Office of Legacy Management (LM)

    Naturita, Colorado, Processing Site May 2010 LMS/NAP/S06371 This page intentionally left blank LMS/NAP/S06371 Office of Legacy Management Verification Monitoring Report for the Naturita, Colorado, Processing Site May 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report⎯Naturita, Colorado May 2010 Doc. No. S06371 Page i Contents 1.0 Introduction

  16. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 LMS/NAP/S07050 This page intentionally left blank LMS/NAP/S07050 Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy Naturita-Monitoring Report for Wetland Area September 2010 Doc. No. S07050 Page i Contents 1.0 Introduction

  17. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  18. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  19. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  20. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  1. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  2. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  3. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  4. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  5. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  6. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  7. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 LMS/RFN/S06654 ESL-RPT-2010-01 This page intentionally left blank LMS/RFN/S06654 ESL-RPT-2010-01 Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 This page intentionally left blank U.S. Department of Energy Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater, Rifle, Colorado July 2010 Doc.

  8. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Final Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page A-iii Contents A1.0 Weldon Spring Site Description and History................................................................... A-1 A1.1 Location and Property Ownership .......................................................................... A-1 A1.2 Physiography and

  9. Microsoft Word - Appendix B.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU)

  10. Microsoft Word - S01382_September2004.doc

    Office of Legacy Management (LM)

    S0138200 Verification Monitoring Report for the Gunnison, Colorado, UMTRCA Title I Processing Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Verification Monitoring Report-Gunnison, Colorado September 2004 Doc. No. S0138200 Page iii Contents Acronyms and Abbreviations

  11. Microsoft Word - S06350_EA.doc

    Office of Legacy Management (LM)

    Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 LMS/DUD/S06350 DOE/EA 1770 This page intentionally left blank LMS/DUD/S06350 DOE/EA 1770 Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Disposal Site August 2010 This page intentionally left blank U.S. Department of Energy Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 Doc. No. S06350 Page i Contents Summary

  12. Microsoft Word - BreakoutSummary.doc

    Office of Environmental Management (EM)

    H:/TECWG/January 2002/Breakout Worksheets.doc *The number appearing in brackets refer to the number of participants with the same comment. 1. On a scale of 1 (lowest) to 10 (highest), how would you rate TEC's effectiveness relative to other comparable organizations? Average score = 7.51 2. The TEC mission is to "serve as a mechanism to provide continuing and improved coordination between appropriate DOE elements, other levels of government, and outside organizations having a responsibility

  13. Microsoft Word - DOE RFI.doc

    Office of Environmental Management (EM)

    Ms. Patricia Hoffman Assistant Secretary United States Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, DC 20585 RE: Smart Grid RFI Dear Assistant Secretary Hoffman, Thank you for the opportunity to provide information to the Department of Energy Federal Register Doc. 2010-23251 filed September 16, 2010. With our recent acquisition of Ventyx, ABB is one of the few companies in the smart grid space that can approach the entire smart grid value chain, from distributed

  14. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc&#0; AL2007-02.doc&#0; PDF icon AL2007-02.doc&#0; More Documents & Publications Attached is Policy Flash 2013-34 Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2014-07 Policy Flash 2014-29 Acquisition Letter 2014-07 - Benchmark Compensation Amount for Individual Executive Salary Actions

  15. AcqGuide70pt4.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt4.doc&#0; AcqGuide70pt4.doc&#0; PDF icon AcqGuide70pt4.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts Acquisition Letter No. AL 2014-01

  16. Microsoft Word - AL2005-13.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-13.doc PDF icon Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&#0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the West Hackberry Brine Tank-14 Resulting in Injury, Strategic Petroleum Reserve West Hackberry, LA Microsoft Word - AcqGuide37pt1 binney Nov 2010

  17. Using Other Agencies' Contracts

    Broader source: Energy.gov [DOE]

    The Department of Energy's (DOE) use of other agencies contracts has increased in recent years. Other agency contracts include Economy Act interagency agreements, Franchise Fund Organizations,...

  18. Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Department of Energy Report and Agency Improvement Plan,For Fiscal Year 2006 and Fiscal Year 2007 PDF icon Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 More Documents & Publications Office of Information Resources (MA-90) Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc DOE Chief FOIA Officer Report

  19. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  20. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  1. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  2. DOC-DOE China Mission Announcement Press Release | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPOEmail-Update001Through11

  3. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  4. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  5. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  6. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  7. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  8. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  9. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  10. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  11. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  12. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  13. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  14. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  15. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  16. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  17. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  18. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Environmental Management (EM)

    DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; PDF icon DOE HR Guidebook 12_15_05.DOC&#0; More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  19. Cooperating Agencies | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cooperating Agencies Cooperating Agencies Selected documents on the topic of Cooperating Agencies under NEPA. December 23, 2004 Reporting Cooperating Agencies in Implementing the...

  20. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  1. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OP-PR-0015.001.doc Begin Shutdown Date: 2000/12/08 To eliminate the possibility of going into a state of operations when people may be working on ladders or in the ring, the following SOP's are required of every shutdown. A shutdown is defined as a period wherein there are no accelerator operations. This procedure is in effect for all scheduled shutdowns and for non-scheduled shutdowns lasting more than 24 hours. 1. The accelerator staff must inform the CAMD staff of a shutdown via e-mail. In

  2. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  3. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  4. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  5. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    09 August 2010 LMS/WEL/S06713 LMS/WEL/S06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS/WEL/S06713 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 This page intentionally left blank U.S. Department of Energy Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 Doc. No. S06713 Page i Contents

  6. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  7. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Annual Assessment Checklists For Parcels D, H, 4, and 3 and Phase I Land Parcel (Physical Walkover Conducted on April 14, 2009) This page intentionally left blank CHECKLIST WORKSHEET - COMBINED - ALL PARCELS Review of Effectiveness of Institutional Controls U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page A-1 Parcels reviewed: D, H, 3, 4, 6, 7, 8, and Phase I (A, B, and C) Preliminary inspections performed on:

  8. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 LMS/MND/S06401 This page intentionally left blank LMS/MND/S06401 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page i Contents

  9. Leading Edge Technology in Diesel Emissions Control | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Leading Edge Technology in Diesel Emissions Control Leading Edge Technology in Diesel Emissions Control Poster presented at the 16th Directions in Engine-Efficiency and Emissions Research (DEER) Conference in Detroit, MI, September 27-30, 2010. PDF icon p-02_roberts.pdf More Documents & Publications NO2 Management in Diesel Exhaust System Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Low Temperature Catalyst for Fuel Injection System

  10. energyefficiencyink12schoolsandstateapplications.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    energyefficiencyink12schoolsandstateapplications.doc Microsoft Office document icon energyefficiencyink12schoolsandstateapplications.doc More Documents & Publications Energy Efficiency in K-12 Schools & State Applications CERTIFICATE OF AUTHENTICITY Successful Partnerships and Lessons from the Field, Part 1, Webinar Transcript

  11. Microsoft Word - Grant Rating Sheet.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    No Proposed project supports agency education objectives-increasing understanding, awareness and appreciation of the Columbia River system and its many uses? Does it enhance the...

  12. M-90-03-02.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Hanford Federal Facility Agreement and Consent Order (HFFACO) requirements M-90-10 and M-90- 11 to accelerate joint agency decisions and schedule establishment...

  13. AcqGuide38pt1.doc

    Broader source: Energy.gov (indexed) [DOE]

    the competitive nature of the purchase. Must agencies conduct Procurement Planning and Market Research before using an FSS contract? Not necessarily. As a general rule, obtaining...

  14. AcqGuide3pt1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... General Law at Headquarters, or the local ethics official in the field, can provide ... to your supervisor and your agency ethics official, and F Either reject the ...

  15. Microsoft Word - Renew the Parks.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cost of PV systems was the biggest concern. To overcome this barrier, the National Park Service will have to form partnerships with other agencies and groups. Potential...

  16. Microsoft Word - ayers_jk.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Space Agency Langley Atmospheric Radiation Measurement Project Cloud Products and ... from the surface at various Atmospheric Radiation Measurement (ARM) Program sites, the ARM ...

  17. Federal Agency NEPA Procedures

    Broader source: Energy.gov [DOE]

    Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ...

  18. Microsoft Word - Transmission - DOE lead agency NOPR - Final...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    February 24, 2012 Mr. Brian Mills Office of Electricity Delivery and Energy Reliability (OE-20) U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 ...

  19. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 2007_5_05_08 rev 1.doc Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc PDF icon Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc More Documents & Publications FY 2007 Total System Life Cycle Cost, Pub 2008 Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc FY 2007 Fee Adequacy, Pub 2008

  20. AcqGuideChapter39pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuideChapter39pt2.doc&#0; AcqGuideChapter39pt2.doc&#0; PDF icon AcqGuideChapter39pt2.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology Department of Energy (DOE) Acquisition Guide Microsoft Word - AL2006-08.doc

  1. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party Agreement for Energy Savings Performance Contracts Photovoltaics at DOE's National Renewable Energy Laboratory License

  2. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf FAL2003-03.pdf

  3. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc Audit Report: IG-0857 Audit Report: OAS-M-13-07

  4. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  5. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  6. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Environmental Management (EM)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc PDF icon Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  7. Microsoft Word - 1_2011_CEG_Update_v2.doc | Department of Energy

    Office of Environmental Management (EM)

    1_2011_CEG_Update_v2.doc Microsoft Word - 1_2011_CEG_Update_v2.doc PDF icon Microsoft Word - 1_2011_CEG_Update_v2.doc More Documents & Publications OPAM Policy Acquisition Guides Microsoft Word - AL2006-07.doc IT Project Management Profile

  8. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Environmental Management (EM)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc PDF icon Microsoft Word - GC Mediation Evaluation _2-06-09_.doc More Documents & Publications Mediation Survey Form Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  9. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    NDEP Correspondence and Record of Review This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page D-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-3 Due Date 12-23-09 Review No. 1 Project Offsites -

  10. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  11. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&#0; Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  12. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Environmental Management (EM)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc PDF icon Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  13. Flash2007-02Attachment.doc

    Broader source: Energy.gov (indexed) [DOE]

    April 11, 2005 and April 17, 2006, requiring agencies to publish on the Government-wide point of entry (GPE) or e-Buy the documentation required by the FAR to support the use of...

  14. Microsoft Word - FAC2005-27.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Act contain the definitions of minority institution and Hispanic-serving institution. ... and comply with 8.405 and 16.505 in a report to the agency senior procurement ...

  15. Microsoft Word - TR01-18.doc

    Office of Legacy Management (LM)

    Inspection Report for the Weldon Spring, Missouri, Site January 2011 LMS/WEL/S07299 ENERGY Legacy Management U.S. DEPARTMENT OF This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or

  16. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  17. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  18. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER (Sept 2010) (a) Definitions. (1)...

  19. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  20. Experimental Evaluation of DOC Performance Using Secondary Fuel Injection |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_Yetkin.pdf More Documents & Publications Engine Tests of an Active PM

  1. Design Potential of Metal Foil Substrates for Optimized DOC Performance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_rice.pdf More Documents & Publications Components for Optimized SCR

  2. Notices ENVIRONMENTAL PROTECTION AGENCY

    Energy Savers [EERE]

    076 Federal Register / Vol. 77, No. 250 / Monday, December 31, 2012 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9006-8] Notice of Intent: Designation of an Expanded Ocean Dredged Material Disposal Site (ODMDS) off Charleston, South Carolina AGENCY: U.S. Environmental Protection Agency (EPA) Region 4. ACTION: Notice of Intent to prepare an Environmental Assessment (EA) for the designation of an expanded ODMDS off Charleston, South Carolina. Purpose: EPA has the authority to designate ODMDSs

  3. Microsoft Word - ICMP2005Rev2.doc

    National Nuclear Security Administration (NNSA)

    49-REV2 INTEGRATED CLOSURE AND MONITORING PLAN for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site Prepared for U.S. Department of Energy National Nuclear Security Administration Nevada Site Office under Contract Number DE-AC08-96NV11718 June 2005 DISCLAIMER NOTICE This report was prepared as an account of work sponsored by an agency of the U.S. Government. Neither the U.S. Government nor any agency thereof, nor any of their employees, nor any of their

  4. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1.doc

  5. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

  6. BPA-2010-01339-FCorrespondence.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of search time and 100 pages of duplication at no cost. Ms. Jo Jeter, Lead Human Resources Specialist, Talent Acquisition, has been assigned as the Authorizing Official for...

  7. Microsoft Word - best-fa.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    leading to failure. Fourteenth ARM Science Team Meeting Proceedings, Albuquerque, New Mexico, March 22-26, 2004 9 Solution and Implementation Many solutions were investigated and...

  8. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  9. Microsoft Word - Norwich Final EA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    36 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 iii March 2011 COVER SHEET Responsible Agency: U.S. Department of Energy (DOE or the

  10. Microsoft Word - 03NESHAP-FINAL.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Standards Hazardous Air Pollutants DOE/NV/11718--929 June 2004 Calendar Year 2003 Prepared by: Bechtel Nevada Post Office Box 98521 Las Vegas, NV 89193-8521 for DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof or its contractors or subcontractors. This report has been reproduced

  11. Microsoft Word - 2007_Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    402 ECOLOGICAL MONITORING AND COMPLIANCE PROGRAM 2007 REPORT March 2008 Prepared by National Security Technologies, LLC Ecological Services P.O. Box 98521 Las Vegas, NV 89193-8521 DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof or its contractors or subcontractors.

  12. Microsoft Word - NEPA Fact Sheet 082814.doc

    National Nuclear Security Administration (NNSA)

    National Environmental Policy Act The National Environmental Policy Act (NEPA) of 1969 was enacted by Congress to ensure that federal agencies consider the potential environmental impacts of their proposed actions and alternatives before deciding on a course of action. NEPA requires the preparation of an environmental impact statement (EIS) for major federal actions that may significantly affect the quality of the environment. Under NEPA, the term "environment" encompasses both the

  13. Microsoft Word - 01a - Cover.doc

    National Nuclear Security Administration (NNSA)

    Environmental Assessment for Increased Depleted Uranium Use on Target 63-10, Nevada Test and Training Range Prepared for Headquarters Air Combat Command and Nellis Air Force Base, NV September 2006 ACRONYMS AND ABBREVIATIONS AFB Air Force Base AFI Air Force Instruction AFIOH Air Force Institute for Operational Health Air Force United States Air Force API Armor-Piercing Incendiary ATSDR Agency for Toxic Substances and Disease Registry BRAC Base Realignment and Closure CAA Clean Air Act CAF Combat

  14. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    E E COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy, National Nuclear Security Administration TITLE: Final Complex Transformation Supplemental Programmatic Environmental Impact Statement (Complex Transformation SPEIS, DOE/EIS-0236-S4) CONTACTS: For further information on this SPEIS, For general information on the DOE write or call: National Environmental Policy Act (NEPA) process, write or call: Theodore A. Wyka Carol Borgstrom, Director Complex Transformation Office of NEPA Policy

  15. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    C C CO O OM MP PL LE EXtransfo o or r rm m mat on COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy, National Nuclear Security Administration TITLE: Final Complex Transformation Supplemental Programmatic Environmental Impact Statement (Complex Transformation SPEIS, DOE/EIS-0236-S4) CONTACTS: For further information on this SPEIS, For general information on the DOE write or call: National Environmental Policy Act (NEPA) process, write or call: Theodore A. Wyka Carol Borgstrom, Director

  16. Industrial lead paint removal specifications

    SciTech Connect (OSTI)

    Stone, R.C.

    1997-06-01

    The purpose of this paper is to inform the reader as to some of the pertinent rules and regulations promulgated by the Environmental Protection Agency (EPA) and the Occupational Safety and Health Administration (OSHA) that may effect an industrial lead paint removal project. The paper discusses a recommended schedule of procedures and preparations to be followed by the lead paint removal specification writer when analyzing the possible impact of the project on the environment, the public and workers. Implications of the Clean Air Act, the Clean Water Act and the Resource Conservation and Recovery Act (RCRA) along with hazardous waste handling, manifesting, transporting and disposal procedures are discussed with special emphasis placed as to their impact on the writer and the facility owner. As the rules and regulations are highly complex, the writer has attempted to explain the methodology currently being used in state-of-the-art industrial lead abatement specifications.

  17. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers [EERE]

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  18. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  19. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  20. Agency-Wide Screening

    Broader source: Energy.gov [DOE]

    Federal agencies face energy-related requirements on new construction projects and major renovations. These Federal requirements range from reductions in fossil-fuel use to specifying the use of...

  1. State Agency Loan Program

    Broader source: Energy.gov [DOE]

    Just over half of all SALP loans are directed to Energy Performance Contracts (EPCs) that the Maryland Department of General Services coordinates with the State’s agencies. These EPCs are typical...

  2. FEMP Best Practices and Lessons Learned for Federal Agency ESPC Projects: Preliminary Assessment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5. PRELIMINARY ASSESSMENT (PA) 5.1 To get a useful PA from the ESCO, the agency should provide the ESCO with all relevant current information about the facilities, including energy consumption and previous audits. 5.2 The PA should be only as long as necessary to convey the viability of a project. An example/template of a PA can be found at: http://www1.eere.energy.gov/femp/docs/10_patemplate.docx . 5.3 Set deadlines for PA submission and for agency completion of PA review and response to the

  3. Broad Agency Announcements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Broad Agency Announcements Broad Agency Announcements World-class experts and capabilities countering all aspects of explosive threats, and aiming predominantly at enhanced detection capabilities. LACED can respond to BAAs, so long as the BAA solicitations satisfies FOA criteria noted in "When LACED can Participate" under the FOAs section. When a BAA is relevant to LACED's unique capabilities and its Department of Energy mission, LACED in general may respond to the BAA on its own.

  4. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc PDF icon Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  5. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More Documents & Publications Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc USA RS Basic Contract - Contract No.: DE-RW0000005 Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  6. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers [EERE]

    RFQ DE-RQ01-04ME90001.doc&#0; RFQ DE-RQ01-04ME90001.doc&#0; PDF icon RFQ DE-RQ01-04ME90001.doc&#0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&#0; Operating Guidelines Appendix A B

  7. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FINAL1.DOC Microsoft Word - DP_cover_and_front matter_FINAL1.DOC PDF icon Microsoft Word - DP_cover_and_front matter_FINAL1.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC EA-1552: Final Environmental Assessment Probabilistic Modeling and Phase 2 Decision Making at the West Valley Demonstration Project and the Western New York Nuclear Service Center

  8. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc Microsoft Office document icon advanced_biofuels_pathways_webinar_alt_text.doc More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  9. First NESAP Post-doc Takes on BoxLib

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  10. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  11. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Legal Descriptions and Ownership Information of Institutional Control Areas U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that parcel of land lying within St. Charles County, Missouri, comprising the Federal facility identified as the

  12. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial Assistance Actions SEB Secretariat and Knowledge Manager Policy Flash 2015-09

  13. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications Policy Flash 2013-09 ACQUISITION PLANNING Policy Flash 2015-13

  14. Microsoft Word - Brochure_Senior Officials.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Brochure_Senior Officials.doc Microsoft Word - Brochure_Senior Officials.doc PDF icon Microsoft Word - Brochure_Senior Officials.doc More Documents & Publications Preservation of Department of Energy Federal Records Records Management Exit Procedures Procedures for Departing Employees

  15. Microsoft Word - FEMP-State MOU pdf version.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP-State MOU pdf version.doc Microsoft Word - FEMP-State MOU pdf version.doc PDF icon Microsoft Word - FEMP-State MOU pdf version.doc More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group Meeting: Washington Update

  16. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc PDF icon Microsoft Word - Fact Sheet Environment 100808 FINAL.doc More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  17. Microsoft Word - NationalPolicyAssurances5-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications Microsoft Word - NationalPolicyAssurances907.rtf

  18. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion | Department of Energy Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Performance of two commercially available DOCs with different precious

  19. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Environmental Management (EM)

    Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; PDF icon Fact Sheet -- Climate VISION 02-12-031.doc&#0; More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  20. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

  1. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Environmental Management (EM)

    va_Final3a_06-04-032.doc Microsoft Word - va_Final3a_06-04-032.doc PDF icon Microsoft Word - va_Final3a_06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters Facilities Master Security Plan - Chapter 1, Physical Security DOE F 473.2

  2. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Environmental Management (EM)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc PDF icon NDIA_PMSC_SurveillanceGuide_Oct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Enhancing Earned Value (EV) Analysis Using Project Assessment & Reporting System (PARS II) - Road Show Presentation

  3. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Environmental Management (EM)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc PDF icon Microsoft Word - ADR Revised Policy82508Reformatted.doc More Documents & Publications ADR Revised Policy ADR Policy Federal Register Document

  4. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Environmental Management (EM)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc PDF icon Microsoft Word - CHAP02ESH _REVISED1_3.doc More Documents & Publications Chapter 70 - DOE Management and Operating Contracts Regulatory Aspects of ISM COMMENTS&#0;

  5. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers [EERE]

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  6. Energy Efficiency Lead-by-Example Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Lead-by-Example Resources Energy Efficiency Lead-by-Example Resources State and local governments can lead by example by promoting energy efficiency programs and policies for public facilities, equipment, and government operations. Find energy efficiency lead-by-example resources below. DOE Resource Federal Energy Management Program Publications. Other Resources Environmental Protection Agency: Lead by Example in Government Operations ACEEE's Lead By Example Initiatives National Governors

  7. Microsoft Word - benzyl-ms-Revisednoyellow.doc

    Office of Scientific and Technical Information (OSTI)

    ... The difference is clearly a solid state effect, where the ensemble prevents the ... -1 does not compensate fully the loss of entropy, which leads to an adduct 4.8 kcal mol -1 ...

  8. Microsoft Word - CBFO Manager Transition.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Manager Transition CARLSBAD, N.M., September 7, 2010 - Dr. Dave Moody has been selected to lead DOE's Office of Environmental Management at the Savannah River...

  9. Microsoft Word - PB-II.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    J.S. Magyar & H.A. Godwin, Northwestern University Lead poisoning can damage the brain and nervous system and is particularly dangerous for young children who are still developing. ...

  10. Microsoft Word - B996F741.doc

    Broader source: Energy.gov (indexed) [DOE]

    UEDD) Office of Environmental Management PSRP Name: The Office of Environmental Management Uranium Enrichment D&D PSRP Lead Program Office and/or Laboratory/Site Office: The Office of Environmental Management PSRP Lead Manager: Cynthia Anderson, Recovery Act Program Manager phone: (202) 586-2083 e-mail: Cynthia.Anderson@em.doe.gov address: 1000 Independence Ave., SW Washington, DC 20585 1. Objectives: Program Purpose The Uranium Enrichment Decontamination and Decommissioning (UED&D)

  11. Microsoft Word - AMS Report v6.doc

    Office of Scientific and Technical Information (OSTI)

    ADVANCED MICROTURBINE SYSTEMS Final Report for Tasks 1 Through 4 and Task 6 T. Rosfjord, Program Manager W. Tredway, Deputy Program Manager A. Chen, J. Mulugeta, and T. Bhatia United Technologies Research Center East Hartford, CT 06118 March 26, 2007 Prepared for The U.S. Department of Energy, Office of Distributed Energy Award No. DE-FC26-00CH11060 Report Number DOE/CH/11060-1 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government.

  12. Microsoft Word - AspenMEAReport.doc

    Office of Scientific and Technical Information (OSTI)

    NETL-2002/1182 ASPEN Plus Simulation of CO 2 Recovery Process Final Report Prepared for: National Energy Technology Laboratory P.O. Box 10940, 626 Cochrans Mill Road Pittsburgh, PA 15236-0940 Prepared by: Charles W. White, III EG&G Technical Services, Inc. 3604 Collins Ferry Road Suite 200 Morgantown, West Virginia 26505 September, 2002 ii DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor

  13. Microsoft Word - DOE_EA-1454.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  14. Microsoft Word - HAB adv #147.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: Hanford Budget Process Adopted: April 4, 2003 Page 1 April 4, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U. S Department of Energy, Office of River Protection P.O. Box 450 Richland, WA 99352 John Iani, Regional Administrator U. S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600

  15. Microsoft Word - HAB adv #148.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 Subject: Hanford Solid Waste EIS Adopted: June 6, 2003 Page 1 June 6, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Re: Revised Draft Hanford Solid Waste Environmental Impact Statement Dear Mssrs. Klein,

  16. Microsoft Word - HABAdv#219 ERDF.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19 Subject: ERDF Expansion - Record of Decision Amendment Adopted: June 5, 2009 Page 1 June 5, 2009 Dave Brockman, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Program Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd, Suite 115 (B1-46) Richland, WA 99352 Re: Environmental Restoration Disposal Facility (ERDF) Expansion - Record of Decision (ROD) Dear Messrs. Brockman and Faulk, Background ERDF plays a key role

  17. Microsoft Word - HABAdv#237EECA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  18. Microsoft Word - HABAdv#251PIP.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: Hanford Public Involvement Plan Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of

  19. Microsoft Word - HABAdv#252LSSC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 Subject: Hanford's 2011 Lifecycle Scope, Schedule, and Cost Report Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager

  20. Microsoft Word - NEPA18_Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6415 Rev. 18 Hanford Site National Environmental Policy Act (NEPA) Characterization J. P. Duncan, Editor K. W. Burk M. A. Chamness R. A. Fowler B. G. Fritz P. L. Hendrickson E. P. Kennedy G. V. Last T. M. Poston M. R. Sackschewsky M. J. Scott S. F. Snyder M. D. Sweeney P. D. Thorne September 2007 Prepared for the U.S. Department of Energy under Contract DE-AC05-76RL01830 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the

  1. Microsoft Word - 2012O-01.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: PW 1,3,6 and CW-5 February 10, 2012 Page 1 February 10, 2012 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton Blvd. Richland, WA 99354 Re: PW 1,3,6 and CW-5 Record of Decision Dear Messrs. McCormick, Faulk and Ms. Hedges,

  2. Microsoft Word - Cooper_Tritium.final.doc

    Office of Legacy Management (LM)

    PROCEEDINGS, TOUGH Symposium 2006 Lawrence Berkeley National Laboratory, Berkeley, California, May 15-17, 2006 - 1 - TRITIUM TRANSPORT THROUGH A LOW-PERMEABILITY NATURAL GAS RESERVOIR Clay A. Cooper 1 , Ming Ye 2 , and Jenny Chapman 2 Desert Research Institute 1 2215 Raggio Pkwy Reno, Nevada, 89512, USA E-mail: clay@dri.edu 2 755 E. Flamingo Road Las Vegas, NV 89119, USA ABSTRACT The U.S. Department of Energy and its predecessor agencies conducted a program in the 1960s and 1970s to evaluate

  3. Microsoft Word - Appendix B cover.doc

    National Nuclear Security Administration (NNSA)

    B FEDERAL REGISTER NOTICES 36691 Federal Register / Vol. 74, No. 141 / Friday, July 24, 2009 / Notices Each meeting is scheduled for 6-8 p.m. with an open-house format, during which attendees are invited to speak one-on-one with agency and Project representatives. Project presentations will be given at 6:15 and 7:30 p.m. Attendees are welcome to come and go at their convenience throughout the meeting. The purpose of the scoping meetings is to provide information about the proposed Project,

  4. Connecting Sustainability to the Agency's Mission | Department of Energy

    Office of Environmental Management (EM)

    Connecting Sustainability to the Agency's Mission Connecting Sustainability to the Agency's Mission Fact sheet describes a case study on the U.S. Fish and Wildlife Service (FWS) Energy Management Program's mission to increase energy awareness and efficiency through various projects funded through the American Recovery and Reinvestment Act (ARRA). PDF icon ic_fws.pdf More Documents & Publications Connecting Sustainability to the Agency's Mission Data, Feedback, and Awareness Lead to Big

  5. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  6. Notices ENVIRONMENTAL PROTECTION AGENCY

    Energy Savers [EERE]

    41 Federal Register / Vol. 80, No. 243 / Friday, December 18, 2015 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9024-5] Environmental Impact Statements; Notice of Availability Responsible Agency: Office of Federal Activities, General Information (202) 564-7146 or http://www2.epa.gov/nepa. Weekly receipt of Environmental Impact Statements Filed 12/07/2015 Through 12/11/2015 Pursuant to 40 CFR 1506.9. Notice Section 309(a) of the Clean Air Act requires that EPA make public its comments on

  7. Getting the Lead Out

    DOE R&D Accomplishments [OSTI]

    Gibson, Kerry

    2011-04-08

    Discarded electronics no longer pose an environmental hazard from lead solder thanks to a lead-free alternative developed at the Ames Laboratory.

  8. Microsoft Word - TRUacceptcritrev0e2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    121 Determining Transuranic Alpha Activity Concentration for Compliance with the Nevada Test Site Waste Acceptance Criteria Revision 0 May 10, 2006 Approved By: U.S. Department of Energy National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Original Signed by Gary Pyles 05/17/2006 Gary Pyles, NNSA/NSO RWAP Task Lead Date Prepared By: Bechtel Nevada, Radioactive Waste Acceptance Program (RWAP) Original Signed by Deron Linkenheil 05/17/2006 Deron Linkenheil, Senior Engineer, CHP

  9. Microsoft Word - 01a - Cover.doc

    National Nuclear Security Administration (NNSA)

    CFRA269.l R i 4 0 BRAC Environmental Assessment for Realignment of Nellis Air Force Base demolition of, and modifications to, on-base buildings; construction of new buildings; updating Nellis AFB's Title V permit under the Clean Air Act; and stormwater discharge permits. Asbestos and Lead-Based Paint Removal and Disposal: Prior to demolition or additions to buildings, asbestos surveys are required by Air Force regulation. For the removal of asbestos, a notification process with Clark County, the

  10. Microsoft Word - 080530Wind.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FOR IMMEDIATE RELEASE Jennifer Scoggins, (202) 586-4940 Thursday, May 29, 2008 U.S. Continues to Lead the World in Wind Power Growth DOE Report Shows Rapidly Growing U.S. Wind Power Market WASHINGTON - The U.S. Department of Energy (DOE) today released the 2007 edition of its Annual Report on U.S. Wind Power Installation, Cost, and Performance Trends, which provides a comprehensive overview of developments in the rapidly evolving U.S. wind power market. Notably, the report finds that U.S. wind

  11. Energy Secretary Bodman Leads US Delegation to International...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Secretary Bodman Leads US Delegation to International Energy Agency Ministerial May 2, 2005 - 12:41pm Addthis PARIS, FRANCE -- Secretary of Energy Samuel W. Bodman this week ...

  12. 2009 Federal Register, 74 FR 50239; Centralized Library: U.S. Fish and Wildlife Service - FR Doc E9-23556

    National Nuclear Security Administration (NNSA)

    0239 Federal Register / Vol. 74, No. 188 / Wednesday, September 30, 2009 / Notices Dated: July 13, 2009. Cynthia K. Dohner, Acting Regional Director. [FR Doc. E9-23559 Filed 9-29-09; 8:45 am] BILLING CODE 4310-55-P DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-ES-2009-N141; 80221-1112- 0000-F2] Amendment of the Clark County Multiple Species Habitat Conservation Plan and Issuance of an Amended Incidental Take Permit, Clark County, NV AGENCY: Fish and Wildlife Service, Interior.

  13. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  14. Microsoft Word - S04674_2008VMR.doc

    Office of Legacy Management (LM)

    for the Durango, Colorado, Processing Site September 2008 LMS/DUP/S04674 This page intentionally left blank LMS/DUP/S04674 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2008 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2008 Doc. No. S0467400 Page iii Contents Acronyms and Abbreviations

  15. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  16. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  17. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  18. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  19. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  20. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  1. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  2. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  3. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  4. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  5. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  6. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  7. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  8. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,

  9. Microsoft Word - S06397_Apr09 thru Mar10.doc

    Office of Legacy Management (LM)

    Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 LMS/TUB/S06397 This page intentionally left blank LMS/TUB/S06397 Annual Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2009 through March 2010 July 2010 Doc. No. S06397 Page i Contents 1.0 Introduction

  10. Microsoft Word - S06430_JanMar.doc

    Office of Legacy Management (LM)

    31, 2010 April 2010 Doc. No. S06430 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: January 1-March 31, 2010 This report summarizes project status and activities implemented January through March 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly site

  11. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  12. Microsoft Word - S06584StSoil.doc

    Office of Legacy Management (LM)

    Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 LMS/MON/S06584 This page intentionally left blank LMS/MON/S06584 Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 Doc. No. S06584 Page i Contents

  13. Microsoft Word - S06770_AprJune.doc

    Office of Legacy Management (LM)

    April 1-June 30, 2010 July 2010 Doc. No. S06770 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: April 1-June 30, 2010 This report summarizes project status and activities implemented April through June 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly

  14. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  15. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  16. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU) consistent with the

  17. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  18. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    Distribution List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page G-3 Except for individual stakeholders, this distribution list is composed of people representing organizations, which have expressed interest in site activities. When individual turnover occurs in these positions, DOE will revise the list to reflect the current holder of these positions. This type of revision is considered minor and not subject to review. All individuals on this list

  19. Microsoft Word - Appendix I-LCRS Operating Plan.doc

    Office of Legacy Management (LM)

    July 2005 Doc. No. S0079000 Page I-3 I1.0 Purpose The purpose of this document is to provide information necessary for the proper operation and maintenance of the Leachate Collection and Removal System (LCRS). Specifically, the subsequent sections will provide the information relating to the management of leachate, maintenance and calibration of liquid level, general equipment maintenance, and reporting requirements. I2.0 Facility Description The LCRS facility is located at the north end of the

  20. Microsoft Word - Final TEC Meeting Summary_September_2004.doc

    Office of Environmental Management (EM)

    TEC Meeting Summary_September_2004.doc 1 U.S. Department of Energy Transportation External Coordination Working Group Meeting Minneapolis, Minnesota September 20-22, 2004 The U.S. Department of Energy (DOE), Transportation External Coordination Working Group (TEC) held its 23 rd meeting on September 20-22, 2004, in Minneapolis, Minnesota. Ninety-six participants, representing national, State, Tribal, and local government; industry; professional organizations; and other interested parties, met to

  1. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  2. Environmental Protection Agency

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ulllicu 3idica Environmental Protection Agency riivirrjlriiiciliar rVruillivitlr~ Systems Laboratory P.O. Box 93478 Las Vegas NV 89193-3478 ctr\/ O",, +-05, " 63 -EOE/DP/00539-061 May 1989 Research and Development . GEPA Off-Site Environmental Monitoring Report Radiation Monitoring Around United. States Nuclear Test Areas, Calendar Year 1988 EPA-600/4-891019 DOE/DP/00539-061 May 1989 Off-Site Environmental Monitoring Report Radiation Monitoring Around United'States Nuclear Test Areas,

  3. Environmental Protection Agency

    Office of Legacy Management (LM)

    Protection Agency . . Book, 4 Project Rulison Off-Site Surveillance Operation for the Flaring Period - October 26 - November 3, 1970 DISCLAIMER Portions of this document may be illegible in electronic image products. Images are produced from the best available original document. P r e l i m i n a r y Report March 1 0 , 1 9 7 1 PROJECT RULISON OFF-SITE ' SURVEILLANCE FOR THE E'LARING OPERATION OF OCTOBER 26 - November 3, 1970 S o u t h w e s t e r n R a d i o l o g i c a l H e a l t h Laboratqry

  4. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc PDF icon Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  5. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy PressRelease_Siting_2-8-06_Final.doc Microsoft Word - PressRelease_Siting_2-8-06_Final.doc PDF icon Microsoft Word - PressRelease_Siting_2-8-06_Final.doc More Documents & Publications EIS-0394: Advance Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Draft Environmental Impact Statement

  6. Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy SMail_Secure_Web-Based_Email_v3 _2_.doc Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc PDF icon Instructions for Using Secure Email via Outlook Web Access More Documents & Publications Using Two-Factor RSA Token with WebVPN Citrix_2FA_Authentication_09.09 Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc

  7. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Environmental Management (EM)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc PDF icon Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  8. VOLUMETRIC LEAD ASSAY

    SciTech Connect (OSTI)

    M.A. Ebadian, Ph.D.; S.K. Dua; David Roelant; Sachin Kumar

    2001-01-01

    This report describes a system for handling and radioassay of lead, consisting of a robot, a conveyor, and a gamma spectrometer. The report also presents a cost-benefit analysis of options: radioassay and recycling lead vs. disposal as waste.

  9. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Environmental Management (EM)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 Mtg-09.09.10.doc More Documents & Publications Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Earthjustice, Appliance Standards Awareness Project, Natural Resources Defense Council - Comments in response to DOE solicitation of views on the implementation of test procedure waivers for large capacity clothes

  10. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy R1_Draft_3.DOC Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC PDF icon Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_FINAL1.DOC WVDP Waste Incidental to Reprocessing Evaluation for the Concentrator Feed Makeup Tank and the Melter Feed Hold Tank Waste-Incidental-to-Reprocessing Evaluation for the West Valley Demonstration Project Vitrification Melter

  11. Microsoft Word - 25 May Vienna GTR Fact Sheet_FINAL 1 .doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 .doc More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction InitiativeU.S.-Origin Nuclear Fuel Removals Global Threat Reduction Initiative...

  12. International energy agency

    SciTech Connect (OSTI)

    Not Available

    1988-01-01

    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplied during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affiliates of U.S. companies.

  13. International Energy Agency

    SciTech Connect (OSTI)

    Not Available

    1988-03-01

    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplies during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affilitates of U.S. companies.

  14. California Environmental Protection Agency | Open Energy Information

    Open Energy Info (EERE)

    Agency Jump to: navigation, search Logo: California Environmental Protection Agency Name: California Environmental Protection Agency Address: 1001 I Street, PO Box 2815 Place:...

  15. London Climate Change Agency | Open Energy Information

    Open Energy Info (EERE)

    Climate Change Agency Jump to: navigation, search Name: London Climate Change Agency Place: London, Greater London, United Kingdom Zip: SE1 8AA Product: Agency responsible for...

  16. Assam Energy Development Agency | Open Energy Information

    Open Energy Info (EERE)

    Energy Development Agency Jump to: navigation, search Name: Assam Energy Development Agency Place: Guwahati, Assam, India Zip: 781005 Sector: Renewable Energy Product: Nodal agency...

  17. Goa Energy Development Agency | Open Energy Information

    Open Energy Info (EERE)

    Goa Energy Development Agency Jump to: navigation, search Name: Goa Energy Development Agency Place: Bardez, Goa, India Zip: 403511 Sector: Renewable Energy Product: Nodal agency...

  18. NVN-088208 | Open Energy Information

    Open Energy Info (EERE)

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  19. NVN-091276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  20. PIC DOC 01/08/11 … SOS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PIC DOC 01/08/11 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta [Meetings, of many kinds, are probably the most utilized of all the public involvement activities. Meetings are attempts at direct democracy, but often provide only limited opportunities for members of the public to engage with issues and decision makers. In many cases, this engagement is brief and comes only after the issues have been framed and a narrow menu of choices

  1. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  2. Microsoft Word - ex1b-ITER-mar07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  3. Microsoft Word - ex9-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  4. Microsoft Word - ex9ed-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  5. Microsoft Word - ex9rdf-ITER-sept09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  6. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    HTH-2 Data and 2009 Well Survey Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page A-1 Table A-1 Groundwater Quality Data by Location Groundwater Quality Data by Location (USEE100) FOR SITE CNT01, Central Nevada Test Area Site REPORT DATE: 9/11/2009 Location: HTH-2 WELL Parameter Units Sample Date ID Depth Range (Ft BLS) Result Qualifiers Lab Data QA Detection Limit Uncertainty Alkalinity, Total (As CaCO3)

  7. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  8. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  9. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  10. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Description of Groundwater Modeling This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page A-3 A1.0 Modeling Codes Groundwater flow in the Building 100 area is simulated with the finite-difference code MODFLOW, as developed by the U.S. Geological Survey (McDonald and Harbaugh 1988, Harbaugh and McDonald 1996). The particle tracking module MODPATH (Pollock 1989) is employed to

  11. Microsoft Word - S01187_RVT LTMP.doc

    Office of Legacy Management (LM)

    Management Plan for the Riverton, Wyoming, Processing Site September 2009 LMS/RVT/S001187-0.0 Formerly DOE-LM/1430-2007 This page intentionally left blank LMS/RVT/S01187-0.0 Formerly DOE-LM/1430-2007 Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 Doc. No. S01187-0.0 Page i Contents

  12. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  13. Microsoft Word - S04704_2008 PCI.doc

    Office of Legacy Management (LM)

    Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada January 2009 LMS/CNT/S04704 This page intentionally left blank LMS/CNT/S04704 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada January 2009 This page intentionally left blank U.S. Department of Energy CY 2008 Post-Closure Inspection & Monitoring Report for CAU 417 January 2009 Doc.

  14. Microsoft Word - S05418_NatEnhAttenuation.doc

    Office of Legacy Management (LM)

    Natural and Enhanced Attenuation of Soil and Groundwater at the Monument Valley, Arizona, DOE Legacy Waste Site 2008 Pilot Study Status Report August 2009 LMS/MON/S05418 This page intentionally left blank LMS/MON/S05418 Natural and Enhanced Attenuation of Soil and Groundwater at the Monument Valley, Arizona, DOE Legacy Waste Site 2008 Pilot Study Status Report August 2009 This page intentionally left blank U.S. Department of Energy 2008 Pilot Study Status Report August 2009 Doc. No. S05418 Page

  15. Microsoft Word - TEC Participants_Sep_2004rev.doc

    Office of Environmental Management (EM)

    TEC Participants_Sep_2004.doc 10/28/2004 1 PARTICIPANTS U.S. DEPARTMENT OF ENERGY (DOE) TRANSPORTATION EXTERNAL COORDINATION WORKING GROUP (TEC) MEETING MINNEAPOLIS, MINNESOTA SEPTEMBER 20-22, 2004 Catherine Anne, Transportation Manager NAC International 3930 East Jones Bridge Road Suite 200 Norcross, Georgia 30092 (678) 328-1343 FAX: (678) 328-1543 canne@nacintl.com Richard Arnold Native American Interactions 1180 N. Town Center Drive Las Vegas, Nevada 89144-6363 (702) 339-7200 FAX: (702)

  16. Microsoft Word - Appendix C_DisposalCellContents.doc

    Office of Legacy Management (LM)

    Disposal Cell Contents Table C-1. Contents of the Weldon Spring, Missouri, Disposal Cell U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page C-3 Work Zone Per WP437 and Material Description Cell Placement Considerations Occupied Cell Volume (cy) Raffinate Pits Work Zone CSS Grout Produced in CSS Plant and pumped to cell. Volume as determined at the plant. 188,443.00 Raffinate Pit 4 residual sludge Stabilized in situ with grout then mixed with TSA

  17. Microsoft Word - Appendix H - InspectionChecklist.doc

    Office of Legacy Management (LM)

    H Annual Inspection Checklist U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page H-3 Annual Site Inspection Checklist Purpose of the Checklist This checklist has been developed from the EPA guidance document Comprehensive Five Year Review Guidance dated June 2001 (OSWER No. 9355.7-03B-P) and from Section 2.3 of the Long-Term Surveillance and Maintenance Plan for the Weldon Spring, Missouri, Site. The checklist was modified to site-specific conditions as

  18. Microsoft Word - Appendix L_ContingencyPlan.doc

    Office of Legacy Management (LM)

    Well Field Contingency Plan U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page L-3 L1.0 Planning and Preparation Under this contingency plan, which supersedes the Well Field Contingency Plan (DOE 1992b), any production capacity lost to the existing well field due to confirmed contaminant migration from the Weldon Spring Quarry (Quarry) will be replaced. While it is highly unlikely that such measures will be implemented, this plan defines the minimum

  19. Lead carbonate scintillator materials

    DOE Patents [OSTI]

    Derenzo, Stephen E. (Pinole, CA); Moses, William W. (Berkeley, CA)

    1991-01-01

    Improved radiation detectors containing lead carbonate or basic lead carbonate as the scintillator element are disclosed. Both of these scintillators have been found to provide a balance of good stopping power, high light yield and short decay constant that is superior to other known scintillator materials. The radiation detectors disclosed are favorably suited for use in general purpose detection and in medical uses.

  20. Energy Standards for State Agencies

    Broader source: Energy.gov [DOE]

    State departments and agencies are encouraged to employ the latest energy-conservation practices in the design, construction, renovation, operation and maintenance of state facilities. All state ...

  1. Federal Agency NEPA Procedures | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Federal Agency NEPA Procedures Federal Agency NEPA Procedures Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ Regulations while also reflecting each agency's unique mandate and mission. As a result, NEPA procedures vary from agency to agency. Further procedural differences may derive from other statutory requirements, agency-specific regulations

  2. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry

    2014-01-01

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western Russia.

  3. U.S. Leads International Collaborative to Address Wind Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development/Wildlife Challenges | Department of Energy Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges U.S. Leads International Collaborative to Address Wind Energy Development/Wildlife Challenges May 18, 2015 - 5:46pm Addthis The U.S. Department of Energy (DOE) is leading a new International Energy Agency (IEA) Wind Task to address concerns about the environmental effects of wind energy technology. Task 34, also known as WREN (Working together to

  4. Bush Administration Plays Leading Role in Studying and Addressing Global

    Energy Savers [EERE]

    Climate Change | Department of Energy Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change February 27, 2007 - 3:49pm Addthis Washington, DC - Continuing to take the lead in addressing global climate change, Energy Secretary Samuel Bodman, Environmental Protection Agency (EPA) Administrator Stephen Johnson, and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice

  5. EM Leads Successful Workshop Supporting Fukushima Cleanup | Department of

    Office of Environmental Management (EM)

    Energy Leads Successful Workshop Supporting Fukushima Cleanup EM Leads Successful Workshop Supporting Fukushima Cleanup August 8, 2013 - 12:00pm Addthis TOKYO - An EM-led U.S. delegation conducted its third workshop last month to provide expertise to Japanese officials leading the cleanup of the Fukushima Daiichi Nuclear Power Plant site and surrounding area, this time addressing priorities identified by Japan's government agencies. At the request of the Japanese Ministry of Environment

  6. lead paint chart

    Office of Environmental Management (EM)

    1930 Assume Lead Will WX Disturb Paint? No Yes Will WX Disturb More than 2 ft 2 . per Room? Yes HUD Housing or Using HUD ? Yes More than 50ugm 3 ? No LSW & HUD Rule 35.900 **...

  7. Lead carbonate scintillator materials

    DOE Patents [OSTI]

    Derenzo, S.E.; Moses, W.W.

    1991-05-14

    Improved radiation detectors containing lead carbonate or basic lead carbonate as the scintillator element are disclosed. Both of these scintillators have been found to provide a balance of good stopping power, high light yield and short decay constant that is superior to other known scintillator materials. The radiation detectors disclosed are favorably suited for use in general purpose detection and in medical uses. 3 figures.

  8. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Environmental Management (EM)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings PDF icon Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL

  9. NVN-086287 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  10. NVN-91276 | Open Energy Information

    Open Energy Info (EERE)

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  11. NVN-087930 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  12. NVN-89276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  13. NVN-087809 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  14. NVN-086761 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  15. NVN-086286 | Open Energy Information

    Open Energy Info (EERE)

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  16. NVN-087791 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  17. NVN-086285 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  18. NVN-088259 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  19. NVN-89275 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  20. NVN-087812 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  1. NVN-89278 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  2. NVN-89274 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  3. NVN-087811 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  4. NVN-89534 | Open Energy Information

    Open Energy Info (EERE)

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  5. NVN-89292 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  6. NVN-091277 | Open Energy Information

    Open Energy Info (EERE)

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  7. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc PDF icon Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc More Documents & Publications Electronic DOE Information Security System (eDISS) PIA, Office of Health Safety and Security FY 2010 E-Government Act Report DOE E-Government Act Report FY 2007

  8. Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Settlement Agreement - FINAL - 01-06-061.doc Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc PDF icon Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc More Documents & Publications Memorandum of Understanding Between the United States Department of Energy and the Washington State Department of Ecology for Development of the Hanford Site Tank Closure and Waste Management EIS ("TC&WM EIS") EIS-0391: Record of Decision Richland/Office of

  9. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  10. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Environmental Management (EM)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc PDF icon Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy R&D

  11. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  12. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    HTH-1RC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page E-1 Table E-1. HTH-1RC_Chronology Date Time Depth (ft bgs) Activity 05/26/09 15:45 - 21:00 NA DH rig (LK17) arrives on site, rig is inspected, tire replaced, and rig was moved to HTH-1 pad. 05/26/09 23:30 NA Fishing tool was run 180 ft down HTH-1 and the bladder pump was retrieved. 05/27/09 01:00 NA Rig is moved off HTH-1 and goes to UC-1-P-1S

  13. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Miscellaneous Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page F-1 Table F-1. MV-1 Tritium Results Sample Identification Date Time Depth (ft) MDA (dpm) Tritium (pCi/L) MDC (pCi/L) Upper Piezometer Development MV-1 - Air MV-1 Well Dev. 05/25/09 2250 WD 36.56 -1441 3294 MV-1 Well Dev. 05/26/09 0100 WD 35.86 540 3230 MV-1 Well Dev. 05/26/09 0216 WD 35.71 810 3217 MV-1 Well Dev. 05/26/09 0335 WD 36.80 450

  14. Microsoft Word - CFAC 7-Year PSA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  15. Microsoft Word - Power Sales Agreement ALCOA - 081909 pm.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  16. UNITED STATES ENVIRONMENTAL PROTECTION AGENCY

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UNITED STATES ENVIRONMENTAL PROTECTION AGENCY REGION 6 14,15 ROSS AVENUE, SUITE 1200 DALLAS, TX 752A2-n33 JAt 5 20ll cERTrrmD rytAlr- RETIIRN RECETPT REOITESIEn COPY Edward ...

  17. ADVANCED RESEARCH PROJECTS AGENCY - ENERGY ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 - 2013 2014 2015 2016 ADVANCED RESEARCH PROJECTS AGENCY - ENERGY Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr...

  18. TPA Agency Contacts - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WA 99352 Phone: 509-376-5803 Fax: 509-376-1563 E-mail: Kristen.L.Holmes@rl.doe.gov Emerald Laija U.S. Environmental Protection Agency 825 Jadwin Ave Suite 210 Richland, WA...

  19. Microsoft Word - HAB - AdviceDevelopmentTechniques-draft-3.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Final Draft Advice Development and Issue Manager Roles and Responsibilities This process is provided as general guidelines for Issue Managers to consider during the Hanford Advisory Board (HAB) Issue and Advice development process. Identification of Potential Issue * The issue is either identified by a Tri-Party Agreement Agency (Agency) as needing HAB input, or identified by a HAB member and brought to the attention of the appropriate HAB Committee. * Additional information may be required from

  20. Microsoft Word - AMI White paper final 013108 _2_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Modern Grid Strategy Powering our 21st-Century Economy ADVANCED METERING INFRASTRUCTURE Conducted by the National Energy Technology Laboratory for the U.S. Department of Energy Office of Electricity Delivery and Energy Reliability February 2008 Office of Electricity Delivery and Energy Reliability V1.0 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of

  1. Microsoft Word - Vol 1 Chapters TOC.doc

    National Nuclear Security Administration (NNSA)

    iii COVER SHEET Responsible Agency: U.S. Department of Energy/National Nuclear Security Administration Cooperating Agencies: U.S. Air Force U.S. Department of the Interior, Bureau of Land Management Nye County, NV Title: Final Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site Locations in the State of Nevada (DOE/EIS-0426) Location: Nye and Clark Counties, Nevada

  2. Microsoft Word - Nevada map cover page.doc

    National Nuclear Security Administration (NNSA)

    MAP OF SOLAR ENERGY STUDY AREAS FOR IN-DEPTH STUDY IN NEVADA The U.S. Department of Energy (DOE) and the Bureau of Land Management (BLM (the Agencies) are preparing a draft Programmatic Environmental Impact Statement (PEIS) pursuant to the National Environmental Policy Act to evaluate utility-scale solar energy development in six Western states: Arizona, California, Colorado, Nevada, New Mexico, and Utah. In the course of the PEIS analyses, the Agencies have identified a number of tracts of

  3. FY 2011 Agency Financial Report

    Office of Environmental Management (EM)

    Foreword he Reports Consolidation Act of 2000 authorizes Federal agencies, with the Office of Management and Budget's (OMB) concurrence, to consolidate various reports in order to provide performance, financial and related information in a more meaningful and useful format. The Department of Energy (Department or DOE) has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a

  4. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - ... The vendor has issued a fix. Addthis Related Articles V-181: Oracle Java SE Critical Patch ...

  5. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. PDF icon...

  6. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  7. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii

    Office of Legacy Management (LM)

    DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction .........................................................................................................................................1 1.1 Purpose ................................................................................................................................1 1.2 Legal and Regulatory Requirements

  8. Impact of Biodiesel Metals on the Performance and Durability of DOC and DPF

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies | Department of Energy the Performance and Durability of DOC and DPF Technologies Impact of Biodiesel Metals on the Performance and Durability of DOC and DPF Technologies Poster presented at the 16th Directions in Engine-Efficiency and Emissions Research (DEER) Conference in Detroit, MI, September 27-30, 2010. PDF icon p-16_williams.pdf More Documents & Publications Impact of Fuel Metal Impurities on Diesel Exhaust Catalysts Deactivation of Accelerated Engine-Aged and

  9. Final Solar and Wind H2 Report EPAct 812.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar and Wind H2 Report EPAct 812.doc Final Solar and Wind H2 Report EPAct 812.doc Report to Congress (ESECS EE-3060) in response to section 812(e) of the Energy Policy Act of 2005 summarizing technology roadmaps for solar- and wind-based hydrogen production. PDF icon Solar and Wind Technologies for Hydrogen Production: Report to Congress More Documents & Publications Technoeconomic Boundary Analysis of Biological Pathways to Hydrogen Production Analysis Activities at National Renewable

  10. CIGNLCommentsDOECSCRulemaking11-30-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CIGNLCommentsDOECSCRulemaking11-30-10.doc CIGNLCommentsDOECSCRulemaking11-30-10.doc The Contractors International Group on Nuclear Liability (CIGNL) hereby submits comments in response to the U.S. Department of Energy (DOE) Notice of Inquiry (NOI) on the Convention on Supplementary Compensation for Nuclear Damage (CSC) Contingent Cost Allocation.1 75 Fed. Reg. 43945 (Jul. 27, 2010); 75 Fed. Reg. 51986 (Aug. 24, 2010); and, 75 Fed. Reg. 64717 (Oct. 20, 2010). PDF icon

  11. Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    System | Department of Energy Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System effect and performance recovery studies at system level with typical diesel emission control consisting of diesel oxidation catalyst, catalyzed soot filter, and selective catalytic reduction PDF icon deer11_tang.pdf More Documents & Publications Investigation of Sulfur Deactivation on Cu/Zeolite SCR

  12. Microsoft Word - DE-FOA-0000013 Amendment 000003.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - DE-FOA-0000013 Amendment 000003.doc Microsoft Word - DE-FOA-0000013 Amendment 000003.doc This amendment extends the application due date for State Applicants from May 11, 2009 to June 25, 2009 for Recovery Act Energy Efficiency and Conservation Block Grants (EECBG) formula grants. PDF icon de_foa_0000013_amendment_000003.pdf More Documents & Publications Funding Opportunity Announcement: Recovery Act … Energy Efficiency and Conversation Block Grants … Formula Grants

  13. Spanish Development Agency ICO | Open Energy Information

    Open Energy Info (EERE)

    Agency ICO Jump to: navigation, search Name: Spanish Development Agency (ICO) Place: Spain Product: Financial Institution that provides Soft Loans Mixed Credits. References:...

  14. European Space Agency | Open Energy Information

    Open Energy Info (EERE)

    Space Agency Jump to: navigation, search Name: European Space Agency Place: Paris, France Zip: 75738 Sector: Services, Solar Product: String representation "ESAs job is ......

  15. Cooperating Agencies in Implementing the Procedural Requirements...

    Energy Savers [EERE]

    Agencies in Implementing the Procedural Requirements of the National Environmental Policy Act Cooperating Agencies in Implementing the Procedural Requirements of the National...

  16. Greenspan Agency Ltd | Open Energy Information

    Open Energy Info (EERE)

    Greenspan Agency Ltd Jump to: navigation, search Name: Greenspan Agency Ltd Place: Edinburgh, United Kingdom Zip: EH1 3LH Sector: Renewable Energy Product: Edinburgh-based...

  17. Energy Agency Coordinators for Energy Action Month

    Broader source: Energy.gov [DOE]

    Agency coordinators serve as primary Federal agency points of contact for Energy Action Month. Contact them if you have questions about implementing an Energy Action Month campaign.

  18. Chhattisgarh Renewable Energy Development Agency CREDA | Open...

    Open Energy Info (EERE)

    Chhattisgarh Renewable Energy Development Agency CREDA Jump to: navigation, search Name: Chhattisgarh Renewable Energy Development Agency (CREDA) Place: Raipur, Chhattisgarh, India...

  19. Uttaranchal Renewable Energy Development Agency UREDA | Open...

    Open Energy Info (EERE)

    Uttaranchal Renewable Energy Development Agency UREDA Jump to: navigation, search Name: Uttaranchal Renewable Energy Development Agency (UREDA) Place: Dehradun, Uttaranchal, India...

  20. Minnesota Pollution Control Agency | Open Energy Information

    Open Energy Info (EERE)

    Pollution Control Agency Jump to: navigation, search Name: Minnesota Pollution Control Agency Place: St. Paul, Minnesota Zip: 55155-4194 Product: Focused on reducing and preventing...