Powered by Deep Web Technologies
Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Changing Demographics in Latvia by Changing Ethnic Law  

E-Print Network (OSTI)

This thesis examines language and citizenship laws in Latvia to determine how they have been used to change Latvia's internal ethnic identity and external geopolitical relations. A discourse analysis of two of the region's major news sources...

Cooper, Zachary L.

2008-08-04T23:59:59.000Z

2

Latvia: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Latvia: Energy Resources Latvia: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":57,"lon":25,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

3

GV1 Solar Power Plant | Open Energy Information  

Open Energy Info (EERE)

GV1 Solar Power Plant GV1 Solar Power Plant Jump to: navigation, search Name GV1 Solar Power Plant Facility GV1 Sector Solar Facility Type Concentrating Solar Power Developer Greenvolts Location Tracy, California Coordinates 37.7396513°, -121.4252227° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.7396513,"lon":-121.4252227,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

4

SUSTAINABILITY POLICY University Policy No: GV0800 (1794) Classification: Governance  

E-Print Network (OSTI)

SUSTAINABILITY POLICY University Policy No: GV0800 (1794) Classification: Governance Approving resources in a responsible manner, and work towards a sustainable future in cooperation with organizations to assist the University Community in incorporating Sustainability into decision making and provides

Victoria, University of

5

EUDEEP (Smart Grid Project) (Latvia) | Open Energy Information  

Open Energy Info (EERE)

Latvia) Latvia) Jump to: navigation, search Project Name EUDEEP Country Latvia Coordinates 56.879635°, 24.603189° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":56.879635,"lon":24.603189,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

6

Deputy Secretary of Energy Meets with President of Latvia | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of Energy Meets with President of Latvia of Energy Meets with President of Latvia Deputy Secretary of Energy Meets with President of Latvia April 4, 2011 - 6:07pm Addthis Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs On Friday, Deputy Secretary of Energy Daniel Poneman met with President Zatlers of Latvia, and the two discussed a range of energy issues; including energy security and the need for diversified resources, development opportunities in the liquid natural gas and shale gas markets, and the need to create an integrated Baltic energy market. Deputy

7

An Energy Overview of the Republic of Latvia  

SciTech Connect

The DOE Office of Fossil Energy is maintaining a web site that is meant to provide useful business- and energy-related information about countries and regions of the world for exporters, project developers, and researchers. The site consists of more than 130 country pages (organized into seven different world regions), with each country page having its own set of links to information sources about that country. There are also more than 30 Country Energy Overviews at the web site -- each of these is a comprehensive review of a specific country's entire energy situation, including sections on Energy Policy, Oil, Natural Gas, Coal, Hydroelectric/Renewables, Nuclear Power, Energy Transmission Infrastructure, Electricity, Electric Industry Overview, Environmental Activities, Privatization, Trade, and Economic Situation. The specific country highlighted in this Country Energy Overview is Latvia. The site is designed to be dynamic. Updates to the overviews will be made as need and resources permit.

anon.

2003-10-20T23:59:59.000Z

8

Advocacy Coalitions in East European Sex Tourism: The Case of Latvia  

E-Print Network (OSTI)

The widening of the European Union and the emergence of budget airlines have brought with them a host of challenges to new member states like Latvia. A result of the economic polarization and its disproportionate effect ...

Dean, Laura A.

2011-12-31T23:59:59.000Z

9

Capturing Video Using the SONY GV-HD700 Cassette Deck In the AV Production Room (Room 261), Mann Library has a SONY GV-HD700 Digital HD Video  

E-Print Network (OSTI)

Capturing Video Using the SONY GV-HD700 Cassette Deck In the AV Production Room (Room 261), Mann Library has a SONY GV-HD700 Digital HD Video Cassette Deck. It is attached to the left side Mac Pro Creation Station, and can be used to "capture", or convert video from miniDV tapes to digital files. 1

Angenent, Lars T.

10

Lake Charles, LA Natural Gas LNG Imports from Equatorial Guinea...  

Gasoline and Diesel Fuel Update (EIA)

Lake Charles, LA Natural Gas LNG Imports from Equatorial Guinea (Dollars per Thousand Cubic Feet) Lake Charles, LA Natural Gas LNG Imports from Equatorial Guinea (Dollars per...

11

NPP Tropical Forest: Marafunga, Papua New Guinea  

NLE Websites -- All DOE Office Websites (Extended Search)

Marafunga, Papua New Guinea, 1970-1971 Marafunga, Papua New Guinea, 1970-1971 [PHOTOGRAPH] Photograph: Profile of tropical forest at Marafunga (click on the photo to view a series of images from this site) Data Citation Cite this data set as follows: Edwards, P. J., and P. J. Grubb. 1999. NPP Tropical Forest: Marafunga, Papua New Guinea, 1970-1971. Data set. Available on-line [http://www.daac.ornl.gov] from Oak Ridge National Laboratory Distributed Active Archive Center, Oak Ridge, Tennessee, U.S.A. Description Biomass and nutrient content of different vegetation components and soil for a lower montane secondary rain forest were determined in 1970-71 at Marafunga in the highlands of Papua New Guinea. The only component of net primary production (NPP) determined at Marafunga was litterfall, although

12

Ebola virus transmission in guinea pigs  

Science Journals Connector (OSTI)

...Rights Reserved. 2014 research-article Ebola virus transmission in guinea pigs Gary...School of Medicine, Philadelphia, PA, USA Ebola virus (EBOV) transmission is currently...movement over short distances. Importance Ebola is generally thought to be spread between...

Gary Wong; Xiangguo Qiu; Jason S. Richardson; Todd Cutts; Brad Collignon; Jason Gren; Jenna Aviles; Carissa Embury-Hyatt; Gary P. Kobinger

2014-11-12T23:59:59.000Z

13

Petroleum Service Projects in the Gulf of Guinea  

E-Print Network (OSTI)

carried out by the OIS group in the gulf of Guinea. The following are the specific projects in the Gulf of Guinea that I participated in: Managing delivering, maintenance and marketing of offshore vessels, Offshore pipe laying project, Integrated pipeline...

Ken-Worgu, Kenneth Chukwumeka

2011-10-21T23:59:59.000Z

14

Guinea: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Guinea: Energy Resources Guinea: Energy Resources (Redirected from ECOWAS Gateway-Guinea) Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":11,"lon":-10,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

15

Equatorial Guinea: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Equatorial Guinea: Energy Resources Equatorial Guinea: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":2,"lon":10,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

16

Guinea-USAID Climate Activities | Open Energy Information  

Open Energy Info (EERE)

Guinea-USAID Climate Activities Guinea-USAID Climate Activities Jump to: navigation, search Name Guinea-USAID Climate Activities Agency/Company /Organization U.S. Agency for International Development Sector Energy, Land Focus Area Renewable Energy, Forestry, Agriculture Topics Background analysis Website http://www.usaid.gov/our_work/ Country Guinea Western Africa References USAID Guinea[1] "USAID supports improved governance in the sustainable management of Guinea's tropical forests and watersheds. USAID's climate change activities focus on a multi-sectoral, integrated approach to economic growth. Working to improve governance within the agriculture, natural resources management, and small enterprise development sectors, USAID's work has led to more accountable and transparent government institutions,

17

ATP is released from guinea pig ureter epithelium on distension  

E-Print Network (OSTI)

ATP is released from guinea pig ureter epithelium on distension G. E. KNIGHT,1 P. BODIN,1 W. C. DE Knight, G. E., P. Bodin, W. C. De Groat, and G. Burn- stock. ATP is released from guinea pig ureter.2001.--Distension of the perfused guinea pig ureter at pressures from 20 to 700 cmH2O in- creased the amount of ATP

Burnstock, Geoffrey

18

Application of sPC-SAFT-JC and sPC-SAFT-GV to Phase Equilibria Predictions of Alkane/Alcohol, Alcohol/Alcohol, and Water/Alcohol Binary Systems  

Science Journals Connector (OSTI)

Application of sPC-SAFT-JC and sPC-SAFT-GV to Phase Equilibria Predictions of Alkane/Alcohol, Alcohol/Alcohol, and Water/Alcohol Binary Systems ... This paper reports on the ability of sPC-SAFT extended with the polar terms of Gross and Vrabec (GV) and Jog and Chapman (JC) to predict the phase equilibria of alkane/alcohol, alcohol/alcohol, and water/alcohol binary systems. ... For these selected binary systems, the GV and JC polar terms deliver similar results when incorporated into sPC-SAFT. ...

Adriaan J. de Villiers; Cara E. Schwarz; Krasimir G. Chobanov; Andries J. Burger

2014-03-12T23:59:59.000Z

19

Guinea: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

form form View source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit with form History Facebook icon Twitter icon » Guinea: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":11,"lon":-10,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

20

Comparison of guinea pig cytomegalovirus and guinea pig herpes-like virus: pathogenesis and persistence in experimentally infected animals.  

Science Journals Connector (OSTI)

...seven of nine guinea pigs inoculated with GPCMV-infected salivary gland tissue suspension (Table 1). Typical Cow- dry type A intranuclear inclusions (Fig. 2A), occasionally accompanied by basophilic cyto- plasmic inclusions (Fig. 2B...

R B Tenser; G D Hsiung

1976-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Pathogenicity of a soil-derived Aspergillus fumigatus isolate for normal and immunosuppressed guinea pigs  

E-Print Network (OSTI)

pathogenicity study . . 40 17 Hematological parameters for guinea pigs euthanized immediately following high dose aerosol challenge . . 56 Hematological parameters for guinea pigs euthanized at four days post cnallenge in the high dose pathogenicity study... . Clearance of spores from the lungs of guinea pigs following aerosol challenge Page with A. fumigatus in the low dose pathogenicity study Clearance of spores from the lungs of guinea pigs following aerosol challenge 37 fth A. ~fu f tus f the hfyh duse...

Kenyon, Elaina Marie

2012-06-07T23:59:59.000Z

22

Guinea-Bissau: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Guinea-Bissau: Energy Resources Guinea-Bissau: Energy Resources (Redirected from ECOWAS Gateway-Guinea-Bissau) Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":12,"lon":-15,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

23

Papua New Guinea: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Papua New Guinea: Energy Resources Papua New Guinea: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":-6,"lon":147,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

24

Guinea-Bissau: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Guinea-Bissau: Energy Resources Guinea-Bissau: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":12,"lon":-15,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

25

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...at least wasted a substantial amount of energy. What is clearer is that interagency...guinea worm eradication will divert the energy of health workers from other essential...1986. Human case of dracunculiasis in Japan. Am. J. Trop. Med. Hyg 35: 159-161...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

26

Brief Report: Emergence of Zaire Ebola Virus Disease in Guinea  

Science Journals Connector (OSTI)

...gene to test samples obtained from 20 hospitalized patients who were suspected of being infected with a hemorrhagic fever virus. In addition, we performed EBOV-specific real-time RT-PCR assays targeting the glycoprotein (GP) or nucleoprotein (NP) gene. Samples from 15 of 20 patients tested positive... In March 2014, an outbreak of Ebola virus disease associated with a high fatality rate was identified in Guinea, with evidence of ongoing person-to-person transmission. In this update to the preliminary report, the virus is found to be a new strain related to Zaire ebolavirus.

Baize S.; Pannetier D.; Oestereich L.

2014-10-09T23:59:59.000Z

27

Geology, hydrocarbon potential of Rio Muni area, Equatorial Guinea  

SciTech Connect

The Republic of Equatorial Guinea, located in the oil producing province of West Africa, consists of three islands and an enclave in continental Africa with a total surface area of about 28,000 sq km. The islands are in the Gulf of Guinea. The largest, Bioko, lies off Nigeria and Cameroon. The continental enclave, Rio Muni, is bounded to the north by Cameroon and to the east and south by Gabon. The coastal basin of Rio Muni, which is the subject of this article, contributes the major portion of areas offered in the current exploration licensing round. Some 5,275 km of seismic data have been recorded the past 10 years covering most of the offshore and onshore areas of Rio Muni. The quality of seismic data is generally good. Data from all size wells drilled in the area and an aeromagnetic survey of the whole onshore and offshore are also available. The paper describes the West African setting, exploration history, basin development, presalt play, postsalt Aptian play, Albian play, clastic play, Senonian/Paleogene play, and the current licensing round.

Ross, D.; Hempstead, N. (EMS Ltd., Oxted (United Kingdom))

1993-08-30T23:59:59.000Z

28

Papua New Guinea-Lowering Emissions in Asia's Forests (LEAF) | Open Energy  

Open Energy Info (EERE)

Papua New Guinea-Lowering Emissions in Asia's Forests (LEAF) Papua New Guinea-Lowering Emissions in Asia's Forests (LEAF) Jump to: navigation, search Name Papau New Guinea-Lowering Emissions in Asia's Forests (LEAF) Agency/Company /Organization United States Agency for International Development Sector Climate, Land Focus Area Biomass, Forestry Topics GHG inventory, Low emission development planning, -LEDS Resource Type Training materials Website http://www.snvworld.org/en/sec Country Papua New Guinea Melanesia References LEAF[1] "Lowering Emissions in Asia's Forests (LEAF), supported by USAID/RDMA, aims to strengthen the capacity of target countries to achieve meaningful and sustained reductions in GHG emissions from the forestry-land use sector while assisting them in benefitting from the emerging international REDD+

29

Papua New Guinea Improved Energy Access for Rural Communities | Open Energy  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » Papua New Guinea Improved Energy Access for Rural Communities Jump to: navigation, search Name of project Papua New Guinea Improved Energy Access for Rural Communities Location of project Papua New Guinea Energy Services Lighting, Cooking and water heating, Space heating, Cooling, Information and communications, Earning a living Year initiated 2012 Organization Asian Development Bank Website http://www.adb.org/news/briefs Coordinates -6.314993°, 143.95555° References Asian Development Bank[1] In Papua New Guinea, approximately 10% of the population has access to

30

Papua New Guinea-Low Emissions Asian Development (LEAD) Program | Open  

Open Energy Info (EERE)

Papua New Guinea-Low Emissions Asian Development (LEAD) Program Papua New Guinea-Low Emissions Asian Development (LEAD) Program Jump to: navigation, search Name Papua New Guinea-Low Emissions Asian Development (LEAD) Program Agency/Company /Organization ICF International, United States Agency for International Development (USAID) Partner USFS, EPA, United States Department of State Sector Climate, Energy, Land Topics Background analysis, Low emission development planning, -LEDS Website http://www.LowEmissionsAsia.or Country Papua New Guinea Melanesia References USAID LEAD Program[1] The Low Emissions Asian Development (LEAD) program is a regional US Agency for International Development (USAID) activity that supports developing countries in Asia to achieve long-term, transformative development and accelerate sustainable, climate-resilient economic growth while slowing the

31

Papua New Guinea-ClimateWorks Low Carbon Growth Planning Support | Open  

Open Energy Info (EERE)

Papua New Guinea-ClimateWorks Low Carbon Growth Planning Support Papua New Guinea-ClimateWorks Low Carbon Growth Planning Support Jump to: navigation, search Name Papua New Guinea-Low Carbon Growth Planning Support Agency/Company /Organization ClimateWorks, Project Catalyst, McKinsey and Company Sector Energy, Land Topics Background analysis, Low emission development planning, Policies/deployment programs Country Papua New Guinea Melanesia References LCGP support[1] Low Carbon Growth Plans Advancing Good Practice, August 2009[2] Overview "Achieving development goals depends on enabling poorer countries to accelerate or maintain robust economic growth despite the disproportionate impacts of climate change which they face. The central challenge is to enable all countries to strengthen delivery of their own development

32

Ebola virus infection in guinea pigs: presumable role of granulomatous inflammation in pathogenesis  

Science Journals Connector (OSTI)

An approach combining virology with light and electron microscopy was used to study the organs of guinea pigs during nine serial passages of Ebola virus, strain Zaire. It was observed that the wild type of Ebola ...

E. Ryabchikova; L. Kolesnikova; M. Smolina; V. Tkachev

1996-01-01T23:59:59.000Z

33

Chloroquine Is Grossly Overdosed and Overused but Well Tolerated in Guinea-Bissau  

Science Journals Connector (OSTI)

...1984. 4-Aminoquinolines can be dangerous to your health: chloroquine (Aralen) intoxication...Guinea Bissau. Trop. Med. Int. Health 13: 410-417. 17 Sanchez...Klein-Schwartz. 2005. Are 1-2 dangerous? Chloroquine and hydroxychloroquine...

Johan Ursing; Poul-Erik Kofoed; Amabelia Rodrigues; Yngve Bergqvist; Lars Rombo

2008-10-27T23:59:59.000Z

34

Papua New Guinea-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Page Page Edit with form History Facebook icon Twitter icon » Papua New Guinea-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Papau New Guinea-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Papau New Guinea UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa

35

Beam-Beam Interaction Simulations with Guinea Pig  

NLE Websites -- All DOE Office Websites (Extended Search)

5 5 SLAC-TN-03-070 September 2003 Beam-Beam Interaction Simulations with Guinea Pig C. Sramek, T. O. Raubenheimer, A. Seryi, M. Woods, J. Yu Stanford Linear Accelerator Center Stanford University Stanford, CA Abstract: At the interaction point of a particle accelerator, various phenomena occur that are known as beam-beam effects. Incident bunches of electrons (or positrons) experience strong electromagnetic fields from the opposing bunches, which leads to electron deflection, beamstrahlung and the creation of electron/positron pairs and hadrons due to two-photon exchange. In addition, the beams experience a "pinch effect" which focuses each beam and results in either a reduction or expansion of their vertical size. Finally, if a

36

U.S. LNG Imports from Equatorial Guinea  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

37

SEDIMENT TRANSPORT AND DEPOSITION IN THE OK TEDI-FLY RIVER SYSTEM, PAPUA NEW GUINEA  

E-Print Network (OSTI)

SEDIMENT TRANSPORT AND DEPOSITION IN THE OK TEDI-FLY RIVER SYSTEM, PAPUA NEW GUINEA: THE MODELING. This sediment flows from the Ok Tedi to the Fly River, eventually reaching the Gulf of Papua. This document River. The second author of this report has been served as the sediment transport consultant for Ok Tedi

Parker, Gary

38

ISSN 0362-1197, Human Physiology, 2007, Vol. 33, No. 1, pp. 122124. Pleiades Publishing, Inc., 2007. Original Russian Text J.G. Byeon, A.Ya. Kaplan, S.F. Timashev, G.V. Vstovskii, B.W. Park, 2007, published in Fiziologiya Cheloveka, 2007, Vol. 33, No. 1  

E-Print Network (OSTI)

., 2007. Original Russian Text © J.G. Byeon, A.Ya. Kaplan, S.F. Timashev, G.V. Vstovskii, B.W. Park, 2007 was performed for EEG records obtained from 45 10- to 14-year-old boys with schizophrenia spectrum disorders of 39 healthy 11- to 13-year-old boys. Monopolar EEG recordings 1­2 min in duration were carried out

Kaplan, Alexander

39

Freedom of Information and Petroleum Development in the Gulf of Guinea Region| A Comparative Analysis of the Legal Frameworks in Nigeria, Ghana, and Liberia.  

E-Print Network (OSTI)

?? Recent discoveries of oil and natural gas in the Gulf of Guinea have renewed interest in petroleum development in West Africa. This news is (more)

Calhoun, John Paul

2012-01-01T23:59:59.000Z

40

Fluid mechanical consequences of pendular activity, segmentation, and pyloric1 outflow in the proximal duodenum of the rat and the guinea pig2  

E-Print Network (OSTI)

in the proximal duodenum of the rat and the guinea pig2 3 Clément de Loubens1* , Roger G. Lentle2 , Richard J Alimentaires, INRA, AgroParisTech, CBAI 78850 Thiverval Grignon,6 France7 2 Institute of Food, Nutrition of the rat and guinea pig.22 During pendular activity in the rat duodenum, the flow was pulsatile

Boyer, Edmond

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Complex adenovirus-vectored vaccine protects guinea pigs from three strains of Marburg virus challenges  

SciTech Connect

The Marburg virus (MARV), an African filovirus closely related to the Ebola virus, causes a deadly hemorrhagic fever in humans, with up to 90% mortality. Currently, treatment of disease is only supportive, and no vaccines are available to prevent spread of MARV infections. In order to address this need, we have developed and characterized a novel recombinant vaccine that utilizes a single complex adenovirus-vectored vaccine (cAdVax) to overexpress a MARV glycoprotein (GP) fusion protein derived from the Musoke and Ci67 strains of MARV. Vaccination with the cAdVaxM(fus) vaccine led to efficient production of MARV-specific antibodies in both mice and guinea pigs. Significantly, guinea pigs vaccinated with at least 5 x 10{sup 7} pfu of cAdVaxM(fus) vaccine were 100% protected against lethal challenges by the Musoke, Ci67 and Ravn strains of MARV, making it a vaccine with trivalent protective efficacy. Therefore, the cAdVaxM(fus) vaccine serves as a promising vaccine candidate to prevent and contain multi-strain infections by MARV.

Wang Danher [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Hevey, Michael [Virology Division, United States Army Medical Research Institute of Infectious Diseases (USAMRIID), 1425 Porter Street, Fort Detrick, MD 21702-5011 (United States); Juompan, Laure Y. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Trubey, Charles M. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Raja, Nicholas U. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Deitz, Stephen B. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Woraratanadharm, Jan [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Luo Min [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Yu Hong [Department of Microbiology and Immunology, Medical University of South Carolina, 173 Ashley Ave., BSB 201, Charleston, SC 29403 (United States); Swain, Benjamin M. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Moore, Kevin M. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States); Dong, John Y. [Division of Bio-defense Vaccines, GenPhar Inc., 871 Lowcountry Blvd., Mount Pleasant, SC 29464 (United States) and Department of Microbiology and Immunology, Medical University of South Carolina, 173 Ashley Ave., BSB 201, Charleston, SC 29403 (United States)]. E-mail: dongj@genphar.com

2006-09-30T23:59:59.000Z

42

Coxiella burnetii Isolates Cause Genogroup-Specific Virulence in Mouse and Guinea Pig Models of Acute Q Fever  

Science Journals Connector (OSTI)

...disease in the SCID mouse model, and genogroup-consistent...immunocompetent-mouse model. Guinea pigs developed...signs of (i) an acute flu-like illness with or...whether these groupings predict virulence potential and...but avirulent in rodent models of disease (47, 48...

K. E. Russell-Lodrigue; M. Andoh; M. W. J. Poels; H. R. Shive; B. R. Weeks; G. Q. Zhang; C. Tersteeg; T. Masegi; A. Hotta; T. Yamaguchi; H. Fukushi; K. Hirai; D. N. McMurray; J. E. Samuel

2009-09-28T23:59:59.000Z

43

The role of CCL5 (RANTES) in the immune response against Mycobacterium tuberculosis in the guinea pig  

E-Print Network (OSTI)

by the current TB vaccine, Mycobacterium bovis BCG. Recombinant guinea pig (rgp)CCL5 and anti-rgpCCL5 were developed and characterized. The biological activity of rgpCCL5 was determined in a chemotaxis assay using T lymphocytes and pleural exudate cells...

Skwor, Troy Arthur

2005-02-17T23:59:59.000Z

44

GONGED (Geometridae of New Guinea Electronic Database): a progress report on development of an online facility of images  

E-Print Network (OSTI)

of an online facility of images Jeremy D. Holloway, Scott E. Miller, David M. Pollock, Lauren Helgen & Karolyn (Geometridae of New Guinea Electronic Database): a progress report on development of an online facility. The product is expected to be an illustrated atlas of some 1500 species that will in turn be linked to similar

Mathis, Wayne N.

45

Influence of oral MCT or LCT load on glycemia in Wistar and Zucker rats and in guinea pigs  

E-Print Network (OSTI)

Influence of oral MCT or LCT load on glycemia in Wistar and Zucker rats and in guinea pigs A. BACH! to C12) in non-fasting Wistar rats induced a decrease in plasma levels of lactate, pyruvate and glucose load. Post-MCT hypoglycemia was also observed in previously fasting rats and was definitely determined

Paris-Sud XI, Université de

46

The Augmentation of Melanocytic Nevi in Guinea Pigs by Solar-simulated Light: An Animal Model for Human Melanocytic Nevi  

Science Journals Connector (OSTI)

...Melanocytic Nevi in Guinea Pigs by Solar-simulated Light: An Animal...followed by prolonged exposure to solar-simulated light. The specific...animal model where exposure to solar-simu lated light would induce...from Charles River (Quebec, Canada) and maintained in standard...

Scott Menzies; Mamdouh Khalil; Kerry Crotty; and Antonio Bonin

1998-12-01T23:59:59.000Z

47

,"Price of U.S. Liquefied Natural Gas Imports From Equatorial Guinea (Dollars per Thousand Cubic Feet)"  

U.S. Energy Information Administration (EIA) Indexed Site

Equatorial Guinea (Dollars per Thousand Cubic Feet)" Equatorial Guinea (Dollars per Thousand Cubic Feet)" ,"Click worksheet name or tab at bottom for data" ,"Worksheet Name","Description","# Of Series","Frequency","Latest Data for" ,"Data 1","Price of U.S. Liquefied Natural Gas Imports From Equatorial Guinea (Dollars per Thousand Cubic Feet)",1,"Monthly","9/2013" ,"Release Date:","12/12/2013" ,"Next Release Date:","1/7/2014" ,"Excel File Name:","ngm_epg0_nus-nek_pml_dmcfm.xls" ,"Available from Web Page:","http://tonto.eia.gov/dnav/ng/hist/ngm_epg0_nus-nek_pml_dmcfm.htm" ,"Source:","Energy Information Administration"

48

Alternating electrical?resistance changes in the guinea?pig cochlea caused by acoustic stimuli  

Science Journals Connector (OSTI)

A new method for measuring electrical?impedance changes that are elicited by tonal stimuli in the cochlea of the anesthetized guinea pig has been developed. Constant?amplitude currents of low?frequency sinusoidal waveform are delivered to scala media simultaneously with tonal stimuli. In the signal recorded from scala media energy is detected at frequencies equal to the sum and difference of the applied frequencies. This energy is interpreted as due to changes ?R in the resistance of the scala media that are synchronized with the acoustic waveform. The maximum magnitude of the change varies from about 0.2% in turn I to about 1% in turn III. During normal conditions striking parallels exist between the behavior of ?R and C M as both frequency and intensity are varied. However under asphyxic conditions the observed change in ?R is usually much less than that in C M. The results are shown to be qualitatively though not quantitatively consistent with a two?dimensional variable?resistance model of the cochlea.

C. D. Geisler; D. C. Mountain; A. E. Hubbard; H. O. Adrian; A. Ravindran

1977-01-01T23:59:59.000Z

49

Electrical Resistance Measurements of the Walls of the Guinea Pig Cochlear Channels  

Science Journals Connector (OSTI)

Microelectrode pairs for current injection and recording of the resulting potentials were introduced into scala media scala vestibuli and scala tympani of the first three turns of the guinea pig cochlea; an additional pair of electrodes was placed in the neck musculature. The potential difference between each recording electrode combination was determined for direct current pulses passed interscalarly and from each scala to the neck. These potentials were used to derive values for the elements of simple cross?sectional resistive?network models of the lower three cochlear turns. It was found that the driving?point resistances between scala media and each of the perilymphatic scalae were nearly equal having average values of 10 8 and 6 k? in the first second and third turns respectively. This resistance decline was concomitant with an increase in the scala media longitudinal attenuation factor which averaged 3 dB/mm in the first turn and progressively increased to 10 dB/mm in the third turn.

S. Sitko; V. Honrubia; D. Strelioff

1973-01-01T23:59:59.000Z

50

The effect of polyunsaturated fatty acid peroxidation on cholesterol concentrations in plasma, aorta, liver, and spleen of the guinea pig  

E-Print Network (OSTI)

administration of an oral sucrose solution containing MDA (9. 75 micromoles) for 6 weeks. MDA accumulation in plasma and aortic tissue was also monitored. Two groups were pair-fed a basal purified diet; one group received the MDA solution, the other received...) was used as the principal dietary source of PUFA. Two groups of guinea pigs were fed a basal purified diet containing either adeguate vitamin C (4 g/kg) or no vitamin C for 3 weeks. Ingested MDA had no effect on cholesterol levels in plasma or tissue...

Corrigan, Sheila Marie

1986-01-01T23:59:59.000Z

51

Deep seismic reflection study of a passive margin, southeatern Gulf of Guinea  

SciTech Connect

A large grid of deep-imaging, marine seismic reflection data has been acquired in the Gulf of Guinea. The data show that the architecture of old Atlantic igneous crust and upper mantle is highly variable, particularly if reflection Moho is taken to be the base of the crust. Most abrupt changes in oceanic basement thickness and depth to Moho can be correlated with fracture-zone crossings, but significant variations can occur between fracture zones and along flow lines, especially near the ocean-continent transition. Reflection Moho is usually continuous from ocean to continent and does not display any systematic changes in character, continuity, or reflection time even beneath the innermost shelf areas. There are several varieties of intracrustal reflectors, including those that mark different levels within the oceanic gabbroic complex and events that diagonally link the top of oceanic seismic layer 2 and Moho. Different types of sub-Moho dipping reflections also are observed. Some are associated with fracture zones, some originate within continental crust and dip toward the ocean, dissecting Moho without offsetting it, and still others originate at the oceanic Moho and dip toward the continent. The transition from oceanic to continental crust is generally quite sharp north of lat 1{degree}S, but the exact nature of the transition ranges from rift-block geology to abrupt juxtapositions of oceanic and continental crustal rocks. South of about lat 1{degree}S, the transition to continental crust is more gradual, involving a progressive thickening of oceanic crust toward land. This difference may relate to the occurrence of much more oblique initial rifting north of 1{degree}S.

Rosendahl, B.R.; Groschel-Becker, H.; Meyers, J.; Kaczmarick, K. (Univ. of Miami, Florida (USA))

1991-04-01T23:59:59.000Z

52

Effects of protein or zinc deficiency on cellular immunity in vaccinated and non-vaccinated guinea pigs with experimentally induced pulmonary listeriosis  

E-Print Network (OSTI)

EFFECTS OF PROTEIN OR ZINC DEFICIENCY ON CELLULAR IMMUNITY IN VACCINATED AND NON-VACCINATED GUINEA PIGS WITH EXPERIMENTALLY INDUCED PULMONARY LISTERIOS I 8 A Thesi s by LEZLEE HELAINE GRAHAM COGHLAN Submitted to the Graduate College of Texas... animals were vaccinated on day 23, and all received aerosol challenge on day 33 and were killed 4 days later. Both zinc and protein deficiency resulted in animals that were clinically abnormal in growth patterns, hematology, ability to mount a delayed...

Coghlan, Lezlee Helaine Graham

1984-01-01T23:59:59.000Z

53

Chronic prenatal ethanol exposure alters expression of central and peripheral insulin signaling molecules in adult guinea pig offspring  

Science Journals Connector (OSTI)

Abstract Maternal ethanol consumption during pregnancy can produce a range of teratogenic outcomes in offspring. The mechanism of ethanol teratogenicity is multi-faceted, but may involve alterations in insulin and insulin-like growth factor (IGF) signaling pathways. These pathways are not only important for metabolism, but are also critically involved in neuronal survival and plasticity, and they can be altered by chronic prenatal ethanol exposure (CPEE). The objective of this study was to test the hypothesis that CPEE alters expression of insulin and IGF signaling molecules in the prefrontal cortex and liver of adult guinea pig offspring. Pregnant Dunkin-Hartley-strain guinea pigs received ethanol (4g/kg maternal body weight/day) or isocaloric-sucrose/pair-feeding (nutritional control) throughout gestation. Fasting blood glucose concentration was measured in male and female offspring at postnatal day 150200, followed by euthanasia, collection of prefrontal cortex and liver, and RNA extraction. IGF-1, IGF-1 receptor (IGF-1R), IGF-2, IGF-2 receptor (IGF-2R), insulin receptor substrate (IRS)-1, IRS-2, and insulin receptor (INSR) mRNA expression levels were measured in tissues using quantitative real-time PCR. The mean maternal blood ethanol concentration was 28115mg/dL at 1h after the second divided dose of ethanol on GD 57. CPEE resulted in increased liver weight in adult offspring, but produced no difference in fasting blood glucose concentration compared with nutritional control. In the liver, CPEE decreased mRNA expression of IGF-1, IGF-1R, and IGF-2, and increased IRS-2 mRNA expression in male offspring only compared with nutritional control. Female CPEE offspring had decreased INSR hepatic mRNA expression compared with male CPEE offspring. In the prefrontal cortex, IRS-2 mRNA expression was increased in CPEE offspring compared with nutritional control. The data demonstrate that CPEE alters both central and peripheral expression of insulin and IGF signaling molecules at the mRNA level, which may be related to metabolic dysregulation in adult offspring. Furthermore, altered insulin and IGF signaling may be a mechanism of ethanol neurobehavioral teratogenicity.

Christine C. Dobson; Kersh Thevasundaram; Daniel L. Mongillo; Andrew Winterborn; Alison C. Holloway; James F. Brien; James N. Reynolds

2014-01-01T23:59:59.000Z

54

Mutations Abrogating VP35 Interaction with Double-Stranded RNA Render Ebola Virus Avirulent in Guinea Pigs  

SciTech Connect

Ebola virus (EBOV) protein VP35 is a double-stranded RNA (dsRNA) binding inhibitor of host interferon (IFN)-{alpha}/{beta} responses that also functions as a viral polymerase cofactor. Recent structural studies identified key features, including a central basic patch, required for VP35 dsRNA binding activity. To address the functional significance of these VP35 structural features for EBOV replication and pathogenesis, two point mutations, K319A/R322A, that abrogate VP35 dsRNA binding activity and severely impair its suppression of IFN-{alpha}/{beta} production were identified. Solution nuclear magnetic resonance (NMR) spectroscopy and X-ray crystallography reveal minimal structural perturbations in the K319A/R322A VP35 double mutant and suggest that loss of basic charge leads to altered function. Recombinant EBOVs encoding the mutant VP35 exhibit, relative to wild-type VP35 viruses, minimal growth attenuation in IFN-defective Vero cells but severe impairment in IFN-competent cells. In guinea pigs, the VP35 mutant virus revealed a complete loss of virulence. Strikingly, the VP35 mutant virus effectively immunized animals against subsequent wild-type EBOV challenge. These in vivo studies, using recombinant EBOV viruses, combined with the accompanying biochemical and structural analyses directly correlate VP35 dsRNA binding and IFN inhibition functions with viral pathogenesis. Moreover, these studies provide a framework for the development of antivirals targeting this critical EBOV virulence factor.

Prins, Kathleen C.; Delpeut, Sebastien; Leung, Daisy W.; Reynard, Olivier; Volchkova, Valentina A.; Reid, St. Patrick; Ramanan, Parameshwaran; Crdenas, Washington B.; Amarasinghe, Gaya K.; Volchkov, Viktor E.; Basler, Christopher F. (CNRS-INSERM); (Mount Sinai Hospital); (LB-Ecuador); (Iowa State)

2010-10-11T23:59:59.000Z

55

A Life Cycle Analysis on a Bio-DME production system considering the species of biomass feedstock in Japan and Papua New Guinea  

Science Journals Connector (OSTI)

This paper describes the performance and/or CO2 intensities of a Bio-DME (Biomass Di-methyl Ether) production system, considering the differences of biomass feedstock. In the past LCA studies on an energy chain model, there is little knowledge on the differences of biomass feedstock and/or available condition. Thus, in this paper, we selected Papua New Guinea (PNG) which has good potential for supply of an energy crop (a short rotation forestry), and Japan where wood remnants are available, as model areas. Also, we referred to 9 species of biomass feedstock of PNG, and to 8 species in Japan. The system boundary on our LCA consists of (1) the pre-treatment process, (2) the energy conversion process, and (3) the fuel transportation process. Especially, since the pre-treatment process has uncertainties related to the moisture content of biomass feedstock, as well as the distance from the cultivation site to the energy plant, we considered them by the Monte Carlo simulation. Next, we executed the process design of the Bio-DME production system based on the basic experimental results of pyrolysis and char gasification reactions. Due to these experiments, the gas components of pyrolysis and the gasification rate under H2O (steam) and CO2 were obtained. Also, we designed the pressurized fluid-bed gasification process. In a liquefaction process, that is, a synthesis process of DME, the result based on an equilibrium constant was used. In the proposed system, a steam turbine for an auxiliary power was assumed to be equipped, too. The energy efficiencies are 39.056.8 LHV-%, depending upon the biomass species. Consequently, CO2 intensities in the whole system were 16.347.2g-CO2/MJ-DME in the Japan case, and 12.236.7g-CO2/MJ-DME in the PNG one, respectively. Finally, using the results of CO2 intensities and energy efficiencies, we obtained the regression equations as parameters of hydrogen content and heating value of a feedstock. These equations will be extremely significant when we install the BTL (biomass-to-liquid, ex. Bio-DME) energy system in the near future, in order to mitigate CO2 emissions effectively, and to estimate the energys efficiency.

Masashi Higo; Kiyoshi Dowaki

2010-01-01T23:59:59.000Z

56

The Transmission of Federal Reserve Tapering News to Emerging Financial Markets  

E-Print Network (OSTI)

India Indonesia Pakistan Ukraine Czech R. Latvia LithuaniaIndia, Indonesia, Pakistan, Ukraine, Czech Republic, Latvia,India, Indonesia, Pakistan, Ukraine, Czech Republic, Latvia,

Aizenman, Joshua; Binici, Mahir; Hutchison, Michael M

2014-01-01T23:59:59.000Z

57

Total Crude Oil and Products Imports from All Countries  

Gasoline and Diesel Fuel Update (EIA)

Country: All Countries Persian Gulf OPEC Algeria Angola Ecuador Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Albania Argentina Aruba Australia Austria Azerbaijan Bahamas Bahrain Barbados Belarus Belgium Belize Benin Bolivia Brazil Brunei Bulgaria Burma Cameroon Canada Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Dominican Republic Egypt El Salvador Equatorial Guinea Estonia Finland France Gabon Georgia, Republic of Germany Ghana Gibralter Greece Guatemala Guinea Hong Kong Hungary India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Kazakhstan Korea, South Kyrgyzstan Latvia Liberia Lithuania Malaysia Malta Mauritania Mexico Midway Islands Morocco Namibia Netherlands Netherlands Antilles New Zealand Nicaragua Niue Norway Oman Pakistan Panama Papua New Guinea Peru Philippines Poland Portugal Puerto Rico Romania Russia Senegal Singapore Slovakia South Africa Spain Spratly Islands Swaziland Sweden Switzerland Syria Taiwan Thailand Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Ukraine United Kingdom Uruguay Uzbekistan Vietnam Virgin Islands (U.S.) Yemen

58

Hydrobiologia 503: 163170, 2003. M.B. Jones, A. Ingolfsson, E. Olafsson, G.V. Helgason, K. Gunnarsson &  

E-Print Network (OSTI)

, isolume Abstract Diel vertical migration (DVM) by zooplankton is a universal feature in all the World in light intensity around dusk and dawn (Ringelberg, 1995, 1999). Over the last two decades, international of the net re- moval of carbon and nitrogen from the ocean surface. By feeding near the surface at night

Hays, Graeme

59

M. Miklukho-Maclay On New Guinea  

Science Journals Connector (OSTI)

... means of their black staff; the Christian religion, and teach thenatives to read and srite, M. Maclay pointed out that traders follow imnsediately the missionaries, and spread among ...

1882-12-07T23:59:59.000Z

60

Folk narratives, archaeology, and descendant communities: a case study of the Albert J. Phillips Memorial Cemetery (41gv125), Galveston County, Texas.  

E-Print Network (OSTI)

??The excavation of historic cemeteries often incorporates a variety of sources not available to prehistorians, including written documents, headstones, and oral history. One important source (more)

Powell, Leah Carson

2012-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Ecofys-Country Fact Sheets | Open Energy Information  

Open Energy Info (EERE)

Ecofys-Country Fact Sheets Ecofys-Country Fact Sheets Jump to: navigation, search Tool Summary Name: Ecofys Country Fact Sheets Agency/Company /Organization: Ecofys Sector: Energy, Land Topics: Background analysis, Baseline projection, GHG inventory, Policies/deployment programs Website: www.ecofys.com/files/files/ecofys_2011_country_factsheets_update.pdf Country: Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Colombia, Croatia, Cyprus, Czech Republic, Denmark, Estonia, European Union, Finland, France, Germany, Greece, Hungary, Iceland, India, Indonesia, Iran, Ireland, Italy, Japan, Kazakhstan, South Korea, Latvia, Liechtenstein, Lithuania, Luxembourg, Malaysia, Malta, Mexico, Monaco, Netherlands, New Zealand, Nigeria, Norway, Pakistan, Papua New Guinea, Peru, Poland, Portugal, Romania, Russia, Saudi Arabia, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Thailand, Turkey, Ukraine, United Kingdom, United States, Venezuela

62

Ecofys-Country Fact Sheets | Open Energy Information  

Open Energy Info (EERE)

Ecofys-Country Fact Sheets Ecofys-Country Fact Sheets (Redirected from Ecofys Country Fact Sheets) Jump to: navigation, search Tool Summary Name: Ecofys Country Fact Sheets Agency/Company /Organization: Ecofys Sector: Energy, Land Topics: Background analysis, Baseline projection, GHG inventory, Policies/deployment programs Website: www.ecofys.com/files/files/ecofys_2011_country_factsheets_update.pdf Country: Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Colombia, Croatia, Cyprus, Czech Republic, Denmark, Estonia, European Union, Finland, France, Germany, Greece, Hungary, Iceland, India, Indonesia, Iran, Ireland, Italy, Japan, Kazakhstan, South Korea, Latvia, Liechtenstein, Lithuania, Luxembourg, Malaysia, Malta, Mexico, Monaco, Netherlands, New Zealand, Nigeria, Norway, Pakistan, Papua New Guinea, Peru, Poland, Portugal, Romania, Russia, Saudi Arabia, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Thailand, Turkey, Ukraine, United Kingdom, United States, Venezuela

63

U.S. LNG Imports from Equatorial Guinea  

Gasoline and Diesel Fuel Update (EIA)

Charles, LA LNG Imports from Canada Highgate Springs, VT Champlain, NY LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake...

64

Ebola outbreak in Conakry, Guinea: Epidemiological, clinical, and outcome features  

Science Journals Connector (OSTI)

AbstractObjectives The authors studied the epidemiological, clinical, and outcome features of the Ebola virus disease in patients hospitalized at the Ebola treatment center (ETC) in Conakry to identify clinical factors associated with death. Materials and methods A prospective study was conducted from March 25 to August 20, 2014. The diagnosis of Ebola virus infection was made on real-time PCR. Results Ninety patients, with a positive test result, were hospitalized. Their mean age was 34.1214.29years and 63% were male patients. Most worked in the informal sector (38%) and in the medical and paramedical staff (physicians 12%, nurses 6%, and laboratory technicians 1%). Most patients lived in the Conakry suburbs (74%) and in Boffa (11%). The main clinical signs were physical asthenia (80%) and fever (72%). Hemorrhagic signs were observed in 26% of patients. The comparison of clinical manifestations showed that hiccups (P=0.04), respiratory distress (P=0.04), and hemorrhagic symptoms (P=0.01) were more frequent among patients who died. Malaria (72%) and diabetes (2%) were the most frequent co-morbidities. The crude case fatality rate was 44% [95% confidence interval (3354%)]. The average hospital stay was 7.965.81days. Conclusion The first Ebola outbreak in Conakry was characterized by the young age of patients, discrete hemorrhagic signs related to lethality. Its control relies on a strict use of preventive measures.

M. Barry; F.A. Traor; F.B. Sako; D.O. Kpamy; E.I. Bah; M. Poncin; S. Keita; M. Cisse; A. Tour

2014-01-01T23:59:59.000Z

65

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...cost of establishing the network was an investment which should serve other health objectives...southern Sudan in 1995 to treat people at risk for onchocerciasis; treat children with...success in an endeavor of this kind is political support (from politicians and from society...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

66

U.S. LNG Imports from Equatorial Guinea  

Annual Energy Outlook 2012 (EIA)

Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake...

67

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...dracunculiasis will be sustainable, in spite of...debate about integration but has also...substantial amount of energy. What is clearer...respond to the new challenges of the final...will divert the energy of health workers...animals, and sustainable animal cycles...including the integration of the campaign...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

68

Prehistoric human impact on rainforest biodiversity in highland New Guinea  

Science Journals Connector (OSTI)

...findings for ecosystem conservation and sustainability...hummocks separated by pools of water, creating a sparse...government, conservation biologists and...Indo-Pacific Warm Pool and El Nino-southern...Biodiversity and conservation of the native flora...

2007-01-01T23:59:59.000Z

69

Experimental infection with Treponema hyodysenteriae in guinea pigs.  

Science Journals Connector (OSTI)

...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...odysenteriae, except in GP inoculated with iso- late B282 and in 16-week-old GP inoculated...

L A Joens; J G Songer; D L Harris; R D Glock

1978-10-01T23:59:59.000Z

70

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...primary health care system and dissipating eradication...though a recent field assessment of integrated surveillance...action. Without a system to make use of it...GIS as a planning tool. Figure 11 shows...the surveillance systems, and their implications...of guidelines and tools for the production...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

71

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...four times that in the largest villages (154), but...specifically excluded from the borehole program as they were...justify the cost of drilling and to maintain a hand...most plentiful. When a borehole can cost as much as...it into a hole in a larger piece of ordinary cotton...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

72

Dracunculiasis (Guinea Worm Disease) and the Eradication Initiative  

Science Journals Connector (OSTI)

...of endemicity. There is a need for innovative strategies to conduct preventive interventions...become more important, not less, if innovative strategies are to be identified and...Monitoring the effects of dracunculiasis remediation on agricultural productivity using satellite...

Sandy Cairncross; Ralph Muller; Nevio Zagaria

2002-04-01T23:59:59.000Z

73

East Coast (PADD 1) Imports from All Countries  

U.S. Energy Information Administration (EIA) Indexed Site

Import Area: East Coast (PADD 1) Midwest (PADD 2) Gulf Coast (PADD 3) Rocky Mountain (PADD 4) West Coast (PADD 5) Period/Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day Import Area: East Coast (PADD 1) Midwest (PADD 2) Gulf Coast (PADD 3) Rocky Mountain (PADD 4) West Coast (PADD 5) Period/Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day Country: All Countries Persian Gulf OPEC Algeria Angola Ecuador Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Argentina Aruba Australia Austria Azerbaijan Bahamas Bahrain Barbados Belarus Belgium Brazil Brunei Bulgaria Cameroon Canada Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Denmark Dominican Republic Egypt El Salvador Equatorial Guinea Estonia Finland France Gabon Georgia, Republic of Germany Ghana Gibralter Greece Guatemala Guinea Hong Kong Hungary India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Kazakhstan Korea, South Kyrgyzstan Latvia Liberia Lithuania Malaysia Malta Mauritania Mexico Morocco Namibia Netherlands Netherlands Antilles Niue Norway Oman Pakistan Panama Peru Philippines Poland Portugal Puerto Rico Romania Russia Senegal Singapore South Africa Spain Swaziland Sweden Switzerland Syria Taiwan Thailand Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Ukraine United Kingdom Uruguay Vietnam Virgin Islands (U.S.) Yemen

74

Total All Countries Exports of Crude Oil and Petroleum Products by  

U.S. Energy Information Administration (EIA) Indexed Site

Destination: Total All Countries Afghanistan Albania Algeria Andora Angola Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahama Islands Bahrain Barbados Belarus Belgium Belize Benin Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Bermuda Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Fiji Finland France French Guiana French Pacific Islands Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Ivory Coast Jamaica Japan Jordon Kazakhstan Kenya Korea, South Korea, North Kyrgyzstan Kutubu Kuwait Latvia Lebanon Liberia Libya Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands/Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Qatar Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Saudi Arabia Senegal Serbia and Montenegro Seychelles Sierra Leone Singapore Slovakia Slovenia Soloman Islands South Africa Spain Spratly Islands Sri Lanka Sudan Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Tonga Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Arab Emirates United Kingdom Uruguay Uzbekistan Vanuatu Venezuela Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Zambia Period-Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day

75

Total Net Imports of Crude Oil and Petroleum Products into the U.S.  

U.S. Energy Information Administration (EIA) Indexed Site

Country: Total All Countries Persian Gulf OPEC Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Afghanistan Albania Andora Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Egypt El Salvador Equatorial Guinea Ethiopia Eritrea Estonia Fiji Finland France French Pacific Islands French Guiana Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Korea, South Kutubu Kyrgyzstan Latvia Lebanon Liberia Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Senegal Serbia and Montenegro Sierra Leone Singapore Slovakia Slovenia South Africa Spain Spratly Islands Sri Lanka Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Togo Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Kingdom Uruguay Uzbekistan Vanuatu Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Other Non OPEC Period-Unit: Monthly-Thousand Barrels per Day Annual-Thousand Barrels per Day

76

U  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

77

Microsoft Word - Final Nuclear Materials Management and Safeguards...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

78

Microsoft PowerPoint - 8_Martyn_NMMSS_2013_Foreign Obligations...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, The...

79

Microsoft PowerPoint - 10_ROSE_MARTYN_UPDATED_NMMSS_2014_Foreign...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, The...

80

U  

National Nuclear Security Administration (NNSA)

states: Austria, Belgium, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Microsoft PowerPoint - 2A_Wednesday 5-22 830 NMMSS_2013_Presentation...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

82

Microsoft Word - Foreign Obligation Codes.docx  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

83

Microsoft PowerPoint - 6_Mitch Hembree_Monday 5-20 1115 NMMSS...  

National Nuclear Security Administration (NNSA)

Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the...

84

Microsoft Word - April2005.doc  

National Nuclear Security Administration (NNSA)

states: Austria, Belgium, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Ireland, Italy, Hungary, Latvia, Lithuania, Luxembourg, Malta, the...

85

STUDENT HEALTH SERVICES University of Massachusetts Lowell  

E-Print Network (OSTI)

Macedonia-TFYR Palau Suriname Algeria Chad Guinea Madagascar Panama Syrian Arab Republic Angola China Guinea

Massachusetts at Lowell, University of

86

"Bond paths and van der Waals interactions in orpiment, As2S3", G.V. Gibbs, A.F. Wallace, R. Zallen, R.T. Downs. N.L.  

E-Print Network (OSTI)

Reflectivity and Lattice Fundamentals in Anatase TiO2", R.J. Gonzalez, R. Zallen, and H. Berger, Phys. Rev. B., Phys. Rev. B 25, 781 (1982). · "Crystal Structures", R. Zallen, chapter one in Handbook

Zallen, Richard

87

JID:PLA AID:20980 /SCO Doctopic: Condensed matter [m5Gv1.5; v 1.58; Prn:8/11/2011; 8:53] P.1 (1-8) Physics Letters A ()  

E-Print Network (OSTI)

) The existence of an annual solar forcing FS; (2) NH is phase locked directly to FS while NL is frequently phase rights reserved. 1. Introduction Centuries ago South American sailors observed that during some years that the maximum SST anomalies in the central tropical Pacific near 170W occurred at the end of the calendar year

Douglass, David H.

88

Newsletter Signup Form  

NLE Websites -- All DOE Office Websites (Extended Search)

EETD NEWSLETTER - MANAGE SUBSCRIPTIONS EETD NEWSLETTER - MANAGE SUBSCRIPTIONS (red fields are required) Manage subscriptions: Subscribe Unsubscribe Name E-Mail Affiliation Address Address (line 2) City State/Province Zip/Postal Code Country (please select a country) none Afghanistan Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegowina Botswana Bouvet Island Brazil British Indian Ocean Territory Brunei Darussalam Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Congo, the Democratic Republic of the Cook Islands Costa Rica Cote d'Ivoire Croatia (Hrvatska) Cuba Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France France, Metropolitan French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guinea Guinea-Bissau Guyana Haiti Heard and Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic of) Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, Democratic People's Republic of Korea, Republic of Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia, The Former Yugoslav Republic of Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia, Federated States of Moldova, Republic of Monaco Mongolia Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island Northern Mariana Islands Norway Oman Pakistan Palau Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russian Federation Rwanda Saint Kitts and Nevis Saint LUCIA Saint Vincent and the Grenadines Samoa San Marino Sao Tome and Principe Saudi Arabia Senegal Seychelles Sierra Leone Singapore Slovakia (Slovak Republic) Slovenia Solomon Islands Somalia South Africa South Georgia and the South Sandwich Islands Spain Sri Lanka St. Helena St. Pierre and Miquelon Sudan Suriname Svalbard and Jan Mayen Islands Swaziland Sweden Switzerland Syrian Arab Republic Taiwan, Province of China Tajikistan Tanzania, United Republic of Thailand Togo Tokelau Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Tuvalu Uganda Ukraine United Arab Emirates United Kingdom United States United States Minor Outlying Islands Uruguay Uzbekistan Vanuatu Venezuela Viet Nam Virgin Islands (British) Virgin Islands (U.S.) Wallis and Futuna Islands Western Sahara Yemen Yugoslavia Zambia Zimbabwe

89

Update: 25/01/2014 Papua New Guinea PNG University of Technology,  

E-Print Network (OSTI)

system near a fixed point depends on a Diophantine con- dition, already introduced by Joseph Liouville. Acknowledgments I was invited in January 2010 by Ashok Agrawal to participate to the 97th Indian Science Congress the identity. The orbit of a point x X is the set {x, f(x), f2 (x), . . . } X. A fixed point is an element x

Waldschmidt, Michel

90

Characterization of guinea pig transfer factor collected by In vivo exposure to antilymphocyte gamma globulin  

E-Print Network (OSTI)

but have found difficulties in the reliability of the ALS treatment. They have characterized their transfer factor-like material from the plasma of sensitive donors as dialyzable, having a 280nm/260nm absorbance ratio of 0. 71, and having electrophoretic..., at the same pH. The dialysis membrane tubing (Union Carbide Corp. ) was prepared for use by. boiling in a calcium carbonate solution for 5 min, rinsing in distilled water, and storing in 50) ethanol at 4 C. Prior to use~ the membrane tubing was thoroughly...

Stewart, Robert Stanley

2012-06-07T23:59:59.000Z

91

Dracunculiasis (guinea worm disease): eradication without a drug or a vaccine  

Science Journals Connector (OSTI)

...patient received proper care by cleaning and bandaging...the patient received health education on not entering...the emergence of the health for all primary healthcare...eradication programme with the health services differs from...network and healthcare reforms initiated by countries...

2013-01-01T23:59:59.000Z

92

Recognition and Strangeness in Marine Environmental Encounters on New Guinea's Far Western Coast /  

E-Print Network (OSTI)

Raja Ampat) [Impact of Ecotourism Development on Social andin Local Communities (Marine Ecotourism Case Study, Mansuarinteraction to enter into ecotourism discussions suggests

Parker, Ian Nicholas

2013-01-01T23:59:59.000Z

93

Biodiversity inventories and conservation of the marine fishes of Bootless Bay, Papua New Guinea  

Science Journals Connector (OSTI)

The effective management and conservation of biodiversity is predicated on clearly defined conservation targets. ... experiences the highest human population density of any marine area in the country. Our checkli...

Joshua A Drew; Charlene L Buxman; Darcae D Holmes; Joanna L Mandecki

2012-08-01T23:59:59.000Z

94

Dry Powder PA-824 Aerosols for Treatment of Tuberculosis in Guinea Pigs  

Science Journals Connector (OSTI)

...lung and spleen tissues were trimmed, embedded in paraffin wax, and sectioned at 5 mum. For lungs, midsaggital sections...Spigelman, M. K. 2007. New tuberculosis therapeutics: a growing pipeline. J. Infect. Dis. 196: S28S34. 24 Stover, C. K., P...

Lucila Garcia-Contreras; Jean C. Sung; Pavan Muttil; Danielle Padilla; Martin Telko; Jarod L. VerBerkmoes; Katharina J. Elbert; Anthony J. Hickey; David A. Edwards

2010-01-19T23:59:59.000Z

95

Growth of New Guinea impatiens under no-leach drip irrigation  

E-Print Network (OSTI)

of the same fertility rate. In post-production studies following both experiments, all plants continued to grow and flower. In a third experiment, plants were grown under a no leach irrigation regime and the 12-3-4 fertility rate with six different media (peat...

Pannkuk, Timothy Richard

2012-06-07T23:59:59.000Z

96

ARTICLE IN PRESS Gulf of Guinea continental slope and Congo (Zaire) deep-sea fan  

E-Print Network (OSTI)

Gabon, Congo and Angola, presents large depocenters where sediments have been accumulating since Early is shifted northward and reaches the Congo­Gabon boundary on the shelf. Sedimentation on the slope directed long- shore drifts that build extensive sand bars along the Congo and Gabon shoreline. The low

Demouchy, Sylvie

97

Oral Therapy Using Nanoparticle-Encapsulated Antituberculosis Drugs in Guinea Pigs Infected with Mycobacterium tuberculosis  

Science Journals Connector (OSTI)

...EXPERIMENTAL THERAPEUTICS Oral Therapy Using Nanoparticle-Encapsulated Antituberculosis Drugs...India We evaluated the efficacy of nanoparticle-encapsulated antituberculosis drugs...histopathology, suggesting that the nanoparticle drug delivery system has potential...

Christine M. Johnson; Rajesh Pandey; Sadhna Sharma; G. K. Khuller; Randall J. Basaraba; Ian M. Orme; Anne J. Lenaerts

2005-10-01T23:59:59.000Z

98

Studies on the immunosuppressive effects of alpha globulins obtained from guinea pig serum  

E-Print Network (OSTI)

as to monitor changes in alpha globulin levels and antibody production. At 2 days of sensitization u-globulins were elevated and lymphocyte responses to antigen induced 8-thymidine incorporation were suppressed. 3 iv With development of immunity on day 4..., alpha globulin levels were elevated, and remained so until day 10. Antibody wss detected on day 4 snd gradually rose in titer until day 10. ACKNOWLEDGMENTS I would like to express my appreciation to my committee members, Dr. G. A. O'Donovan and Dr...

Cowart, Richard Elmer

2012-06-07T23:59:59.000Z

99

Emergence of FY*Anull in a Plasmodium vivax-endemic region of Papua New Guinea  

Science Journals Connector (OSTI)

...panel (Research Genetics) and the Stanford Human Genome Center Radiation Hybrid Mapping E-mail Server (http://www-shgc.stanford.edu/RH/rhserverformnew.html). D1S2635 maps to within 0.30.6 cM of FY. ns, not significant. Conclusion...

Peter A. Zimmerman; Ian Woolley; Godfred L. Masinde; Stephanie M. Miller; David T. McNamara; Fred Hazlett; Charles S. Mgone; Michael P. Alpers; Blaise Genton; B. A. Boatin; James W. Kazura

1999-01-01T23:59:59.000Z

100

Clinical Presentation of Patients with Ebola Virus Disease in Conakry, Guinea  

Science Journals Connector (OSTI)

...et al. in which the sample is diluted to a range of 1 copy to 1 million copies and is then tested in quadruplicate to construct a standard curve for estimating the number of genome copies. Follow-up testing for antibodies against EBOV by means of enzyme-linked immunosorbent assay (ELISA) was performed... Ebola virus is one of three members of the Filoviridae family and comprises five distinct species. Infection with Zaire ebolavirus (EBOV) has historically resulted in the highest case fatality rate up to 90%.1 Outbreaks typically originate with ...

2014-11-05T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

The response of New Guinea impatiens to varying salinity levels in a subirrigation system  

E-Print Network (OSTI)

Subirrigation is an alternative irrigation method for greenhouse crops. Lack of leaching poses the problem of high salt buildup in the root zone. The objective of this study was to determine the effects of saline irrigation water on a greenhouse...

Todd, Nancy Morgan

2012-06-07T23:59:59.000Z

102

Evolution of Cocirculating Varicella-Zoster Virus Genotypes during a Chickenpox Outbreak in Guinea-Bissau  

Science Journals Connector (OSTI)

...Medical Virology grant G0900950, the NIHR UCL/UCLH Biomedical Research Centre, and the use of the UCL Legion High Performance Computing Facility, and associated support services, in the completion of this research. This study was also supported...

Daniel P. Depledge; Eleanor R. Gray; Samit Kundu; Samantha Cooray; Anja Poulsen; Peter Aaby; Judith Breuer

2014-10-01T23:59:59.000Z

103

Guinea Worm Advance Ghana has passed a milestone in its ef-  

E-Print Network (OSTI)

microfluidic chip) allows for early detection of infectious diseases in resource-limited and remote regions

Adams, Mark

104

Revelations of the world: Transnationalism and the politics of perception in Papua New Guinea  

E-Print Network (OSTI)

transmissiona speech chain (Agha 2003)that followed gendered and genealogical lines. Whether routes

Slotta, James

2014-01-01T23:59:59.000Z

105

--No Title--  

Gasoline and Diesel Fuel Update (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

106

Geothermal Technologies Office: Download GETEM, August 2012 Beta  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Indonesia Irak Iran Ireland Ireland, Northern Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Latvia Lebanon Liberia Liechtenstein Lithuania...

107

Eia.gov BETA - Data - U.S. Energy Information Administration...  

Annual Energy Outlook 2012 (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

108

IEC documents | Department of Energy  

Energy Savers (EERE)

Hungary IADB Iceland IEA IFC India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Latvia Lebanon Lithuania Malaysia Mexico Moldova Mongolia...

109

DEVELOPING SAFETY CULTURE IN NUCLEAR ACTIVITIES Practical Suggestions  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

110

Status of U.S. Nuclear Outages - U.S. Energy Information Administratio...  

Annual Energy Outlook 2012 (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

111

INSAG-15 Key Practical Issues  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

112

E-Print Network 3.0 - austria telekanal hakkab Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

113

E-Print Network 3.0 - austria 25th june-7th Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

114

E-Print Network 3.0 - austria Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Turkey Czech Republic Romania Romania Riga Latvia Luxembourg Luxembourg... Potsdam Germany Austria Hungary Poland Russia Austria Czech ... Source: Applied Algebra Group at Linz...

115

United States and Latvian Governments Sign Agreement to Allow...  

Office of Environmental Management (EM)

Raimonds Vejonis signed the agreement, which will provide for repatriation to Russia of SovietRussian-origin nuclear fuel from Latvia's shutdown research reactors at...

116

The power of the family  

E-Print Network (OSTI)

Denmark, Estonia, Spain, Finland, France, Great Britain,ties Croatia Algeria Finland Sweden Latvia Czech RepublicRep. South Africa (Union of) Finland Korea Mexico Bangladesh

Alesina, Alberto; Giuliano, Paola

2010-01-01T23:59:59.000Z

117

E-Print Network 3.0 - aivars aboltins aigars Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

District Riga, Latvia Source: Massachusetts at Amherst, University of - Center for Energy Efficiency and Renewable Energy, Building Energy Efficiency Program Collection:...

118

Brochure front(2-09)  

NLE Websites -- All DOE Office Websites (Extended Search)

Latvia Lesotho Libyan Arab Jamahiriya Lithuania Madagascar Malawi Mauritius Mexico Nepal The Netherlands New Zealand Nicaragua Nigeria Norway Philippines Poland Portugal...

119

Tax Morale and Conditional Cooperation  

E-Print Network (OSTI)

Latvia, Estonia, Ukraine, Russia, Croatia, Slovakia, Greece,Slovak Republic -0.009 Ukraine Notes: i. The results aree.g. , Russia, Belarus, Ukraine, Lithuania, Estonia or

Frey, Bruno S.; Torgler, Benno

2006-01-01T23:59:59.000Z

120

Nordisk kernesikkerhedsforskning Norrnar kjarnryggisrannsknir  

E-Print Network (OSTI)

such as reprocessed enriched uranium and weapons grade plutonium provided different challenges and there were. Latvian Environment, Geology and Meteorology Centre, Latvia. jberzins at la

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Fusion Electricity A roadmap to the realisation of fusion energy  

E-Print Network (OSTI)

Fusion Electricity A roadmap to the realisation of fusion energy #12;28 European countries signed association EURaToM ­ University of latvia LATVIA lithuanian Energy Institute LITHUANIA Ministry of Education and Research ROMANIA Ministry of Education, science, culture and sport SLOVENIA centro de Investigaciones

122

Inhibition of citric acid- and capsaicin-induced cough by novel TRPV-1 antagonist, V112220, in guinea-pig  

E-Print Network (OSTI)

This is an Open Access article distributed under the terms of the Creative Commons Attribution License

Sum Yee Leung; Akio Niimi; Alison S Williams; Puneeta Nath; Xavier Blanc; Q Thai Dinh; K Fan; Chung Open Access

2007-01-01T23:59:59.000Z

123

Acoustical and flow characteristics of a cough as an index of pulmonary function in the guinea pig.  

E-Print Network (OSTI)

??Human studies have shown that cough sound and flow analysis may be useful for diagnosing pulmonary abnormalities. The purpose of this study was to evaluate (more)

Day, Joshua W.

2004-01-01T23:59:59.000Z

124

An agent-based approach to HIV/AIDS epidemic modeling : a case study of Papua New Guinea  

E-Print Network (OSTI)

Since AIDS was first discovered, mathematical models of the transmission dynamics of HIV have been developed to determine the drivers of the epidemic. It has become apparent that the most profound factor in the proliferation ...

Rhee, Alisa Joy

2006-01-01T23:59:59.000Z

125

Mortality among Human Immunodeficiency Virus Type 2-Positive Villagers in Rural Guinea-Bissau Is Correlated with Viral Genotype  

Science Journals Connector (OSTI)

...levels and viral load) on a given...the clinical data. The observed...statistical power in differentiating...level Viral load gag (0.45...the clinical data for each analysis...due to missing data (see the text...statistical power of the ML statistic...high proviral load or low CD4 count...

Nicholas C. Grassly; Zheng Xiang; Koya Ariyoshi; Peter Aaby; Henrik Jensen; Maarten Schim van der Loeff; Francisco Dias; Hilton Whittle; Judith Breuer

1998-10-01T23:59:59.000Z

126

A clinical study of kuru patients with long incubation periods at the end of the epidemic in Papua New Guinea  

Science Journals Connector (OSTI)

...endocannibalism was suppressed. There were reports of surreptitious eating of the dead in remote hamlets for some years afterwards...Were there any remaining source of infection, whether from surreptitious cannibalism or possible ground contamination (Brown Gajdusek...

2008-01-01T23:59:59.000Z

127

This information sheet is for the care and use of laboratory rodents (including rats, mice, hamsters, guinea pigs & gerbils).  

E-Print Network (OSTI)

This information sheet is for the care and use of laboratory rodents (including rats, mice, transmission is thought to occur by the fecal- oral route through contamination of food or water, or by direct. The source of infection can be from any of the following: rats, mice, voles, hedgehogs, gerbils, squirrels

Wood, Marcelo A.

128

From the Rivers of Guinea to the Valleys of Peru: BECOMING A BRAN DIASPORA WITHIN SPANISH SLAVERY  

E-Print Network (OSTI)

sold en masse into the transatlantic slave trade until thethe Spanish and the transatlantic nomenclature of bran,traded slaves to transatlantic Europeans. The conflict

O'Toole, Rachel S

2007-01-01T23:59:59.000Z

129

Sulfolipid Deficiency Does Not Affect the Virulence of Mycobacterium tuberculosis H37Rv in Mice and Guinea Pigs  

Science Journals Connector (OSTI)

...p. 363-461. In M. Kates (ed.), Handbook of lipid research: glycolipids, phosphoglycolipids...56: 2876-2883. Sulfolipid deficiency does not affect the virulence of Mycobacterium...all expectations, sulfolipid deficiency does not significantly affect the replication...

Ccile Rousseau; Oliver C. Turner; Erik Rush; Yann Bordat; Tatiana D. Sirakova; Pappachan E. Kolattukudy; Shannon Ritter; Ian M. Orme; Brigitte Gicquel; Mary Jackson

2003-08-01T23:59:59.000Z

130

The effects of protein deprivation on alveolar immunity in BCG-vaccinated and non-vaccinated guinea pigs  

E-Print Network (OSTI)

was done using the Amdahl 470 V/6 computer available through the Texas A A N University Computer Center. 25 RESULTS The effect of' dietary treatment on body weight. Body weight was measured as an indicator of nutritional status. At the initiation...

Kimball, Milton Scott

1984-01-01T23:59:59.000Z

131

Effect of ebola virus reinoculations on the time course of immunological parameters  

Science Journals Connector (OSTI)

Three inoculations of live and inactivated Ebola virus to susceptible (guinea pigs) and ... pigs. Similar immunogenicity of live and inactivated Ebola virus for guinea pigs and a higher...

A. A. Chepurnov; A. A. Dadaeva

1999-01-01T23:59:59.000Z

132

U.S. Imports from All Countries  

U.S. Energy Information Administration (EIA) Indexed Site

Egypt El Salvador Equatorial Guinea Estonia Finland France Gabon Georgia, Republic of Germany Ghana Gibralter Greece Guatemala Guinea Hong Kong Hungary India Indonesia Ireland...

133

E-Print Network 3.0 - algeria australia austria Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Guinea Guinea Bissau Guyana Haiti Afghanistan Albania Algeria Andorra Romania Russia Rwanda Samoa Source: Alechina, Natasha - School of Computer Science, University of...

134

MA5Q6 Graduate Algebra Assignment 7  

E-Print Network (OSTI)

such that Lg(u v) = (gu) (gv) for all (u, v) U ? V. (b) Prove Lgh = Lg Lh for all g, h G. Deduce that W

Krammer, Daan

135

Update on the European Weather Radar Network Iwan Holleman, Laurent Delobbe, and Anton Zgonc  

E-Print Network (OSTI)

Meteorological Services". The second phase of OPERA, 2004-2006, has involved a significant renewal of the Program Hungary Iceland Ireland Italy Latvia Luxembourg Netherlands Norway Poland Portugal Romania Slovak Republic

Stoffelen, Ad

136

105(scaled land 215%)7-22-05  

National Nuclear Security Administration (NNSA)

Guatemala Honduras Hungary India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Laos Latvia Lebanon C A N A D A U N I T E D S T A T...

137

Argentina: An Important All-of-the-Above Energy Partner | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of Latvia Deputy Secretary Poneman Statement on Second Meeting of the U.S. - South Africa Bilateral Energy Dialogue Argentina: An Important All-of-the-Above Energy Partner...

138

Perspectives on the United States Health Care System by International students from the newly independent states of the former Soviet Union and a comparison of former Soviet countries' and the United States Health Care Systems  

E-Print Network (OSTI)

of Institutional Studies and Planning, 2001). The research of this thesis was limited to students of the NIS: Armenia, Azerbaijan, Bclarus, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Moldova, Russia, Tajikistan, Turkmenistan, Ukraine... 22 Q-5 In what country were you born? Q-6 1 Armenia 2 Azerbaijan 3 Belarus 4 Georgia 5 Kazakhstan 6 Kyrgyzstan 7 Latvia 8 Lithuania 9 Moldova 10 Russia 11 Tajikistan 12 Turkmenistan 13 Ukraine 14 Uzbekistan 15 Other (Please Specify...

Leuenberger, Larissa Diane

2013-02-22T23:59:59.000Z

139

. 16 (9. ).  

E-Print Network (OSTI)

, Palau, Papua New Guinea, Philippines, Puerto Rico, Rwanda, Samoa, Sierra Leone, Singapore, South Africa

140

Environment and Development http://journals.cambridge.org/EDE  

E-Print Network (OSTI)

, Mauritius, Montser- rat, Nauru, Netherlands Antilles, New Caledonia, Niue, Palau, Papua New Guinea, Puerto

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

The 1996 U.S. Purse Seine Fishery for Tropical Tunas in the Central-Western Pacific Ocean  

E-Print Network (OSTI)

, Kiribati, Marshall Islands, Nauru, New Zealand, Niue, Palau, Papua New Guinea, Solomon Islands, Tonga

142

3. (2) ---(TOEFL ITP)  

E-Print Network (OSTI)

, Mauritius, Namibia, Nauru, New Zealand, Nigeria, Pakistan, Palau, Papua New Guinea, Philippines, Puerto Rico

143

IEEE TRANSACTIONS ON CIRCUITS AND SYSTEMS FOR VIDEO TECHNOLOGY, VOL. 22, NO. 1, JANUARY 2012 77 Modeling and Compressing 3-D Facial Expressions  

E-Print Network (OSTI)

Modeling and Compressing 3-D Facial Expressions Using Geometry Videos Jiazhi Xia, Dao Thi Phuong Quynh present a novel geometry video (GV) framework to model and compress 3-D facial expressions. GV bridges the gap of 3-D motion data and 2-D video, and provides a natural way to apply the well-studied video

Hoi, Steven Chu-Hong

144

L. monocytogenes in Guinea Pig Placenta JID 2005:191 (1 June) 1889 M A J O R A R T I C L E  

E-Print Network (OSTI)

on Microbial Toxins and Path- ogenicity, Andover, New Hampshire, 18­23 July 2004; 42nd annual meeting and Cell Biology and 2 School of Public Health, University of California, Berkeley, and 3 Anatomic Pathology Service, Veterinary Medical Teaching Hospital, University of California, Davis Listeria

Bakardjiev, Anna

145

Effect of external conditions on the structure of scrolled graphene edges M. M. Fogler,1 A. H. Castro Neto,2 and F. Guinea3  

E-Print Network (OSTI)

in many new applications. Fabrication methods of CNSs include arc discharge,1 sonication of graphite,2 therein, and discuss how they can be controlled electrically. Our approach relies on the continuum of the same area has an approximately linear dependence, s - s - s0 g, s s0, 1 on the total arc length s

146

Propagation speed of sound assessment in the layers of the guinea-pig esophagus in vitro by means of acoustic microscopy  

E-Print Network (OSTI)

Clinical Research, Skejby Hospital, Section SKS, Denmark b Center for Sensory-Motor Interaction, Aalborg:001 and in mucosa to 1584 (1566±1603) m/s p

Illinois at Urbana-Champaign, University of

147

Novel H7N9 Influenza Virus Shows Low Infectious Dose, High Growth Rate, and Efficient Contact Transmission in the Guinea Pig Model  

Science Journals Connector (OSTI)

...Soboleski, MR , JD Gabbard, GE Price, JA Misplon, CY Lo, DR Perez...Riel, D , VJ Munster, E de Wit, GF Rimmelzwaan, RA Fouchier...Chutinimitkul, VJ Munster, E de Wit, GF Rimmelzwaan, RA Fouchier...Riel, D , VJ Munster, E de Wit, GF Rimmelzwaan, RA Fouchier...

Jon D. Gabbard; Daniel Dlugolenski; Debby Van Riel; Nicolle Marshall; Summer E. Galloway; Elizabeth W. Howerth; Patricia J. Campbell; Cheryl Jones; Scott Johnson; Lauren Byrd-Leotis; David A. Steinhauer; Thijs Kuiken; S. Mark Tompkins; Ralph Tripp; Anice C. Lowen; John Steel

2013-11-13T23:59:59.000Z

148

Novel H7N9 Influenza Virus Shows Low Infectious Dose, High Growth Rate, and Efficient Contact Transmission in the Guinea Pig Model  

Science Journals Connector (OSTI)

...Chai, S Wang, Y Gao, L Jin, Y Zhang, H Luo, H Yu...60943-5 . 6. Han, J , M Jin, P Zhang, J Liu, L Wang...Q Fang, YZ Shen, XM Xi, Q Gu, XM Zhou, HP Qu...Wu, J Li, Q Xia, ZC Jin, Q Chen, C Tang, ZY...Eisfeld, G Zhong, S Fan, J Ping, EA Maher, A Hanson...

Jon D. Gabbard; Daniel Dlugolenski; Debby Van Riel; Nicolle Marshall; Summer E. Galloway; Elizabeth W. Howerth; Patricia J. Campbell; Cheryl Jones; Scott Johnson; Lauren Byrd-Leotis; David A. Steinhauer; Thijs Kuiken; S. Mark Tompkins; Ralph Tripp; Anice C. Lowen; John Steel

2013-11-13T23:59:59.000Z

149

LIFE CYCLE ASSESSMENTS (LCAs) OF PYROLYSIS-BASED GASOLINE AND DIESEL FROM DIFFERENT REGIONAL FEEDSTOCKS: CORN STOVER, SWITCHGRASS, SUGAR CANE BAGASSE, WASTE WOOD, GUINEA GRASS, ALGAE, AND ALBIZIA.  

E-Print Network (OSTI)

?? Renewable hydrocarbon biofuels are being investigated as possible alternatives to conventional liquid transportation fossil fuels like gasoline, kerosene (aviation fuel), and diesel. A diverse (more)

Mihalek, Matthew J.

2014-01-01T23:59:59.000Z

150

Energy Blog | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5, 2011 5, 2011 "Smart Windows" seen at light and dark settings. | Photo Courtesy of SAGE Electrochromics, Inc., by Susan Fleck Photography Making Smart Windows Smarter This new type of glass that could drastically help you control the temperature of your home. "Smart windows" could save 1 quadrillion BTUs of energy each year - more than 1 percent of the nation's annual energy consumption, or more than $10 billion in annual energy costs. April 4, 2011 Deputy Secretary of Energy Daniel Poneman meets with President Zatlers of Latvia | DOE photo: Ken Shipp Deputy Secretary of Energy Meets with President of Latvia Deputy Secretary of Energy Daniel Poneman met with President Zatlers of Latvia. Read more. April 4, 2011 The Florida International University team | courtesy of the FIU team

151

Price of Elba Island, GA Natural Gas LNG Imports from Equatorial...  

Annual Energy Outlook 2012 (EIA)

Equatorial Guinea (Dollars per Thousand Cubic Feet) Price of Elba Island, GA Natural Gas LNG Imports from Equatorial Guinea (Dollars per Thousand Cubic Feet) Decade Year-0 Year-1...

152

ANOVA-simultaneous component analysis (ASCA): a new tool for analyzing designed metabolomics data  

Science Journals Connector (OSTI)

......al., 1983). Nuclear Magnetic Resonance...Metabolomics datasets are becoming more...providing the guinea pig dataset. REFERENCES Antti...high-resolution proton nuclear magnetic resonance...providing the guinea pig dataset. SUPPLEMENTARY...high-resolution proton nuclear magnetic resonance......

Age K. Smilde; Jeroen J. Jansen; Huub C. J. Hoefsloot; Robert-Jan A. N. Lamers; Jan van der Greef; Marieke E. Timmerman

2005-07-01T23:59:59.000Z

153

CHIMPANZEES TEACH US MAN'S PLACE IN NATURE  

E-Print Network (OSTI)

, Democratic Republic of Congo (DRC, hereafter) and Gabon, are responsible for seventy-seven percent adequately protected. Three countries (Gabon, Equatorial Guinea, and Guinea Bissau) do not have national park

154

THE ECONOMIC IMPACT OF TOURISM IN SPTO MEMBER COUNTRIES  

E-Print Network (OSTI)

......................................................................................................................... 4 2. Methodology Caledonia, Kiribati, Niue, Papua New Guinea, Samoa, Solomon Islands, Tonga, Tuvalu and Vanuatu. The economic

155

THE ROLES OF PRIOR RESIDENCE AND RELATIVE SIZE IN COMPETITION FOR  

E-Print Network (OSTI)

to Papua, New Guinea, and Palau (Johnson 1960; McVey 1975). Usually it is found in fresh and brackish

156

A Review of the South Pacific Tuna Baitfisheries: Small Pelagic  

E-Print Network (OSTI)

at Palau in the Western Caroline Islands (Muller, 1976;Wilson, 1977)and in Papua New Guinea (PNG) (Lewis et

157

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

158

Cellulose Binding Domains of a Phytophthora Cell Wall Protein Are Novel Pathogen-Associated Molecular Patterns  

Science Journals Connector (OSTI)

...except after heat treatment of the medium (Meindl...and neutralized by dialysis against 100 volumes of water at 4C for 16 h...strain GV3101 by electroporation, and transformed...et al. (1980). Electron Microscopy and Immunogold...

Elodie Gaulin; Nani Dramé; Claude Lafitte; Trudy Torto-Alalibo; Yves Martinez; Carine Ameline-Torregrosa; Moustafa Khatib; Honoré Mazarguil; François Villalba-Mateos; Sophien Kamoun; Christian Mazars; Bernard Dumas; Arnaud Bottin; Marie-Thérèse Esquerré-Tugayé; Martina Rickauer

2006-06-09T23:59:59.000Z

159

Four-Wave Mixing Microscopy with Electronic Contrast of Individual Carbon Nanotubes  

E-Print Network (OSTI)

and J. Jiang, in Carbon Nanotubes, edited by A. Jorio, G.V. Perebeinos, in Carbon Nanotubes, edited by A. Jorio, G.and P. Finnie, in Carbon Nanotubes, edited by A. Jorio, G.

Collins, Philip G

2012-01-01T23:59:59.000Z

160

SAND2011-6496  

Office of Scientific and Technical Information (OSTI)

2.1 Model definition Let G(u) be a real-valued Gaussian random field with zero mean, unit variance, and covari- ance function c(u, v) EG(u) G(v), where EX denotes the...

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

45Mem Inst Oswaldo Cruz, Rio de Janeiro, Vol. 96, Suppl.: 45-48, 2001 Recent Studies on Schistosoma intercalatum: Taxonomic  

E-Print Network (OSTI)

. intercalatum are recognized, the Lower Guinea strain and the Congo strain, which differ from each other (localized in Lower Guinea and North East of Democratic Republic of Congo) which correspond to the historical. intercalatum are recognized, the Lower Guinea strain and the Congo strain, which differ from each other

162

Optimal control approach to termination of re-entry waves in cardiac electrophysiology  

E-Print Network (OSTI)

)Ie(t) - c2 (x)Ie(t) in Q (2) v t = · ¯i v + · ¯i u - Iion(v, w) + Itr(x, t) in Q (3) w t = G(v, w) in Q, (4 electrode. The Iion(v, w) is the current density flowing through the ionic channels and the function g(v, w

Kunisch, Karl

163

Subsidy schemes in EU t i M ti ti dcountries: Motivations and  

E-Print Network (OSTI)

FIT - Hungary FIT (feed-in premium) Investment subsidies Latvia FIT (combined with quota obligation support or taxes Bulgaria FIT - Czech FIT (fixed tariff or premium) Investment subsidies Republic Estonia competition for investments in renewables The level of support of FI tariffs and market prices together

164

Job 4459300 Ref.No. Prepd. CHP/GEA  

E-Print Network (OSTI)

Auditing of Buildings and Inspection of Boilers and Air- conditioning Systems Final report Institutional in large buildings 5 2.2 Article 8, Inspection of boilers 6 2.3 Article 9, Inspection of air-conditioning, responsibility for buildings, boilers and air-con systems in Latvia is divided as illustrated below

165

Energy saving policy and emission decreasing  

E-Print Network (OSTI)

,9648,2787,4016,6985,9Electricity consumption E (TWh)3 13,8510,858,1085,7814,32GDP (bill. LVL)2 56765GDP grows (% per year)1Energy saving policy and emission decreasing Latvian experienceLatvian experience Dr. A. Davis, M of fuelNr. Table1. Primary energy consumption in Latvia #12;Introduction Table 2. Formation of pollutants

166

The European tobacco control report 2007  

E-Print Network (OSTI)

Netherlands Republic of Moldova The European tobacco control report 2007 pagepage 9 Latvia, Lithuania, Malta, the Republic of Moldova, Netherlands,Netherlands Norway Poland Portugal Republic of Moldova Romania Russian Federation Serbia Slovakia Slovenia The European tobacco control report 2007 page

World Health Organization

2007-01-01T23:59:59.000Z

167

Dynamical Generation of a Repulsive Vector Contribution to the Quark Pressure  

E-Print Network (OSTI)

Lattice QCD results for the coefficient $c_2$ appearing in the Taylor expansion of the pressure show that this quantity raises with the temperature towards the Stefan-Boltzmann limit. On the other hand, model approximations predict that when a vector repulsion, parametrized by $G_V$, is present this coefficient reaches a maximum just after $T_c$ and then deviates from the lattice predictions. Recently, this discrepancy has been used as a guide to constrain the (presently unknown) value of $G_V$ within the framework of effective models at large-$N_c$ (LN). In the present investigation we show that, due to finite $N_c$ effects, $c_2$ may also develop a maximum even when $G_V=0$ since a vector repulsive term can be dynamically generated by exchange type of radiative corrections. Here we apply the the Optimized Perturbation Theory (OPT) method to the two flavor Polyakov--Nambu--Jona-Lasinio model (at $G_V=0$) and compare the results with those furnished by lattice simulations an by the LN approximation at $G_V=0$...

Restrepo, Tulio E; Pinto, Marcus Benghi; Ferrari, Gabriel N

2014-01-01T23:59:59.000Z

168

The Population Genetic Structure of the Malaria Mosquito Anopheles melas Throughout Its West-African Range  

E-Print Network (OSTI)

for logistical support during field collections in Equatorial Guinea. Additional logistical support was provided by Medical Care Development International Inc. and Marathon Oil Corporation. This study was supported by an operational research grant awarded... and mainland Equatorial Guinea are currently the focus of two malaria control programs implemented by Medical Care Development International (MCDI) in partnership with the Government of Equatorial Guinea and 7 funded by Marathon Oil Corp. (Houston, TX...

Deitz, Kevin

2012-02-14T23:59:59.000Z

169

The influence of diet and vaccination on thymus-dependent (T) lymphocytes in experimental pulmonary tuberculosis  

E-Print Network (OSTI)

hypersensitivity reac- tions to 5 TU PPD in outbred (Hartley Strain) guinea pigs challenged by the respiratory route with virulent M. tuberculosis. . . 36 Influence of dietary protein and N. bovis BCG vaccination on delayed hypersensitivity reac- tions to 100 TU... PPD in outbred (Hartley Strain) guinea pigs challenged by the respiratory route with virulent N. tuberculosis. 37 Delayed hypersensitivity reactions to 100 TU of PPD in tuberculous Strain 2 and Strain 13 guinea pigs fed low protein (LP), control (C...

Bartow, Rebecca Ann

2012-06-07T23:59:59.000Z

170

Re-appraisal and extension of the Gratton-Vargas two-dimensional analytical snowplow model of plasma focus evolution in the context of contemporary research  

E-Print Network (OSTI)

Recent resurgence of interest in applications of dense plasma focus and doubts about the conventional view of dense plasma focus as a purely irrotational compressive flow have re-opened questions concerning device optimization. In this context, this paper re-appraises and extends the analytical snowplow model of plasma focus sheath evolution developed by F. Gratton and J.M. Vargas (GV) (Energy Storage, Compression and Switching, Ed. V. Nardi, H. Sahlin, and W. H. Bostick, Eds., vol. 2. New York: Plenum, 1983, p. 353) and shows its relevance to contemporary research. The GV model enables construction of a special orthogonal coordinate system in which the plasma flow problem can be simplified and a model of sheath structure can be formulated. The LPP plasma focus facility, which reports neutron yield better than global scaling law, is shown to be operating closer to an optimum operating point of the GV model as compared with PF-1000.

Auluck, S K H

2013-01-01T23:59:59.000Z

171

Experimental bound on the charge radius of the electron neutrino  

Science Journals Connector (OSTI)

A limit on the electron-neutrino charge radius |r| is derived from a measurement of the weak-neutral-current vector coupling constant gV obtained in electron-neutrino electron elastic scattering. The 90%-confidence interval for gV is -0.177<gV<0.187, which for sin2?W=0.227 implies that the ?e mean-square charge radius is in the range -2.7410-32

R. C. Allen; H. H. Chen; P. J. Doe; R. Hausammann; W. P. Lee; X. -Q. Lu; H. J. Mahler; M. E. Potter; K. C. Wang; T. J. Bowles; R. L. Burman; R. D. Carlini; D. R. F. Cochran; J. S. Frank; E. Piasetzky; V. D. Sandberg; D. A. Krakauer; R. L. Talaga

1991-01-01T23:59:59.000Z

172

ARM Registration Form  

NLE Websites -- All DOE Office Websites (Extended Search)

Republic of the Congo Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands Faroe Islands...

173

Stump the Scientist Question Form | GE Global Research  

NLE Websites -- All DOE Office Websites (Extended Search)

Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Fiji Finland France Gabon...

174

E-Print Network 3.0 - archipelago tunisia north Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Biology and Medicine 6 Algeria Gambia Nigeria Angola Ghana Reunion Summary: Togo Egypt Mauritius Tunisia Equatorial Guinea Morocco Uganda Eritrea Mozambique Zambia......

175

Ebola-Viruserkrankung  

Science Journals Connector (OSTI)

Die Ebola-Erkrankung ist eine schwere, oft tdlich verlaufende ... . Der folgende Beitrag gibt anlsslich des aktuellen Ebola-Ausbruchs im westafrikanischen Guinea eine allgemeine bersicht...

M. Bundschuh; A. Gerber

2014-07-01T23:59:59.000Z

176

NOAA Fisheries Observers An Integral Part of Observing  

E-Print Network (OSTI)

collection, tag recapture · Fisheries management, resource assessments, and bycatch reduction methodology, Papua New Guinea, Fed. States of Micronesia, Solomon Islands, Kiribati, and Vietnam) #12;11 Northeast

177

E-Print Network 3.0 - arabia sudan syrian Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

MADAGASCAR NEPAL GUINEA ERITREA SUDAN ZAMBIA HAITI BHUTAN MYANMAR GAMBIA BANGLADESH... JORDAN THAILAND LITHUANIA SYRIAN ARAB REPUBLIC IRAQ REUNION TURKEY AZERBAIJAN ARGENTINA MACAU...

178

E-Print Network 3.0 - aquaffin bradsyn peg Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

of Oklahoma Collection: Biology and Medicine 15 Prolonged focal application of polyethylene glycol induces conduction block in guinea pig spinal cord white matter Summary: of...

179

Survey of Biomass Resource Assessments and Assessment Capabilities...  

Open Energy Info (EERE)

South Korea, Malaysia, Mexico, New Zealand, Papua New Guinea, Peru, Philippines, Russia, Chinese Taipei, Thailand, United States, Vietnam Australia and New Zealand,...

180

E-Print Network 3.0 - allergen-induced respiratory dysfunction...  

NLE Websites -- All DOE Office Websites (Extended Search)

guinea pigs, the AHR after the allergen-induced EAR was completely Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of...

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

RICHARD H. GRANT, Professor of Agro-micrometeorology, Department of Agronomy, Purdue University B.S. 1977 Duke University (Distinction) 1974-1977  

E-Print Network (OSTI)

Management Association International Solar Energy Society Gamma Sigma Delta honorary agriculture research, Hungary, India, Japan, Kazakhstan, Mauritania, Mexico, Morroco, Oman, Papua New Guinea, Peoples Republic

Jackson, Scott A.

182

E-Print Network 3.0 - auchenorrhyncha typhlocybinae dikraneurini...  

NLE Websites -- All DOE Office Websites (Extended Search)

of the Ficus trees Source: Basset, Yves - Smithsonian Tropical Research Institute, Panama; New Guinea Binatang Research Center Collection: Environmental Sciences and Ecology 3...

183

U.S. Energy Information Administration (EIA)  

NLE Websites -- All DOE Office Websites (Extended Search)

New Zealand Nicaragua Niger Nigeria Niue Norway Oman Pakistan Palestinian Territories Panama Papua New Guinea Paraguay Peru Philippines Poland Portugal Puerto Rico Qatar Reunion...

184

Albania 00-800-0010 American Samoa  

E-Print Network (OSTI)

-800-01-001 Palau SS Panama 800-0109 {Spanish} 800-2288 Papua New Guinea SS Paraguay Asuncion City 008-11-800 Peru

Fisher, Kathleen

185

A unified model of island biogeography sheds light on the zone of radiation  

E-Print Network (OSTI)

890 50 1 46 43 3 0 Tonga Australia 699 3000 11 15 13 2 0 Palau Papua New Guinea 494 585 4 26 14 12 0

186

E-Print Network 3.0 - acanthospermum australe loelf Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Environmental Sciences and Ecology 17 oceanic response to northwest monsoon winds north of New Guinea Summary: ) and biological consequences of wind forcing variability in...

187

India-Low Emissions Asian Development (LEAD) Program | Open Energy...  

Open Energy Info (EERE)

in up to 11 partner countries: Bangladesh, Cambodia, India, Indonesia, Laos, Malaysia, Nepal, Papua New Guinea, Philippines, Thailand, and Vietnam. References "USAID LEAD...

188

Fast Out of the Gate: How Developing Asian Countries can Prepare...  

Open Energy Info (EERE)

Development (LEAD) program: Bangladesh, Cambodia, India, Indonesia, Laos, Malaysia, Nepal, the Philippines, Papua New Guinea, Thailand, and Vietnam. LEDSGP green logo.png This...

189

Cambodia-Low Emissions Asian Development (LEAD) Program | Open...  

Open Energy Info (EERE)

in up to 11 partner countries: Bangladesh, Cambodia, India, Indonesia, Laos, Malaysia, Nepal, Papua New Guinea, Philippines, Thailand, and Vietnam. USAID LEAD Factsheet LEAD Fact...

190

The Quest for Ultimate Broadband High Power Microwaves  

E-Print Network (OSTI)

Paper describes High Power Microwave research of combining GW peak power to achieve MV/m and GV/m radiated fields in 1 to 500 GHz band. To achieve such fields multiple independently triggered broadband GW sources, supplying power to multiple spatially distributed broadband radiators/antennas are used. Single TW array is used as an ultimate microwave weapon in 1 to 5 GHz range while multiple TW arrays provide GV/m radiating field at plasma frequencies in 300 GHz range leading to fusion power.

Podgorski, Andrew S

2014-01-01T23:59:59.000Z

191

Living and Fossil Macrocyprididae  

E-Print Network (OSTI)

Napoli and for the informal group Paleobenthos." The collections on R.V. Hero cruise 69-5 were made by Roger L. Kaesler (NSF GA-12472), on Hero cruise 71-5 by H. Meade Cadot (NSF GV-25157), on Anton Bruun cruises 7, 8, and 9 by Richard I-I. Benson... Napoli and for the informal group Paleobenthos." The collections on R.V. Hero cruise 69-5 were made by Roger L. Kaesler (NSF GA-12472), on Hero cruise 71-5 by H. Meade Cadot (NSF GV-25157), on Anton Bruun cruises 7, 8, and 9 by Richard I-I. Benson...

Maddocks, R. F.

1990-02-27T23:59:59.000Z

192

Comparative tests of isospin-symmetry-breaking corrections to superallowed 0(+) -> 0(+) nuclear beta decay  

E-Print Network (OSTI)

OF SUPERALLOWED BETA TRANSITIONS Superallowed Fermi beta decay between 0+ states depends uniquely on the vector part of the hadronic weak interaction. 0556-2813/2010/82(6)/065501(8) 065501-1 ?2010 The American Physical Society I. S. TOWNER AND J. C. HARDY.../(mec2)5= (8120.2787? 0.0011)? 10?10 GeV?4 s, GV is the vector coupling constant for semileptonic weak interactions, and MF is the Fermi matrix element. The CVC hypothesis asserts that the vector coupling constant GV is a true constant...

Towner, I. S.; Hardy, John C.

2010-01-01T23:59:59.000Z

193

SpatialSpatialSpatial Spatial Characteristics of Characteristics of  

E-Print Network (OSTI)

Islands 160W 20N 170W 150W 10N Johnston I Palau Papua New Guinea Federated States of Micronesia Gilbert CNMI 160E 180170E Marshall Islands 160W 20N 170W 150W 10N Johnston I Palau Papua New Guinea Federated Northern Marianas Guam Federated States of Micronesia Marshall Islands Johnston Palmyra 10N Palau Papua New

Hawai'i at Manoa, University of

194

Appendix C: Hepatitis B Endemic Countries List Countries considered highly endemic (8% or higher HBsAg prevalence) for hepatitis B  

E-Print Network (OSTI)

Mauritania Federated States of Micronesia Indonesia Burundi Mauritius Fiji North Korea Cameroon Mozambique Trust Territories of the Pacific Islands Saudi Arabia Ghana Swaziland Tuvalu USA (indigenous populations of) Guinea Tanzania (United Republic of) Vanuatu Alaska Guinea-Bissau Togo Wallis and Futuna Islands

MacMillan, Andrew

195

Microsoft Word - TGD Markup 3-25-05 the end.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

G.V. Last, V, E.J. Freeman, K.J. Cantrell, M.J. Fayer, G.W. Gee, W.E. Nichols, B.N. Bjornstad, and D.G. Horton, Vadose Zone Hydrogeology Data Package for the 2004 Composite...

196

Simulations of Magnetic Shields for Spacecraft Simon G. Shepherd  

E-Print Network (OSTI)

Simulations of Magnetic Shields for Spacecraft Simon G. Shepherd Thayer School of Engineering Brian Need GV potentials!! Brehmsstrahlung radiation is potentially lethal #12;Magnetostatic Shields F=qv?B et al. 1997 a = 10 km KE = ?? eV Cst = 5 m I = "transistor radio battery" Note also that: B ~ I : B

Shepherd, Simon

197

UCGE Reports Number 20272  

E-Print Network (OSTI)

2000 (GV2000 Project). To guide policy and practice in complex situations, current research in the area of what are understood to be "best practices" in property valuation and taxation to an integrated, social towards relevant literature in allied fields, which played a critical part in the research design. My

198

Introduction Imaging Models Results 1 Results 2 Model study and comparison for the cardiac electrical  

E-Print Network (OSTI)

dV dt + Iion(V , w) = 0 d w dt = g(V , w) · V = i - e : V trans-membrane potential. · w RN TNNP Bidomain model : statement · Heart electrical activity : in H, C V t + Iion(V , w) = -div (Ge e) w

Pierre, Charles

199

KarlFranzens Universitat Graz Technische Universitat Graz  

E-Print Network (OSTI)

) v t + Iion(v, w) - div i v = Ie for a. a. (x, t) ? [ 0 , T ] ; (1.1) w t + G(v, w) = 0 for a. a. Together with appropriate specifications of the ionic current Iion and the function G within (1

Wagner, Marcus

200

PROCEDURES FOR THE APPOINTMENT AND  

E-Print Network (OSTI)

Page | 1 PROCEDURES FOR THE APPOINTMENT AND RE-APPOINTMENT OF DEANS University Policy No: GV0450 procedures define the method by which the appointment, or review and re-appointment, of deans will be conducted. SCOPE 2.00 These procedures apply to: the appointments of new deans, the review and re

Victoria, University of

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

arXiv:physics/0302084v124Feb2003 Alignment-to-orientation conversion and nuclear quadrupole resonance  

E-Print Network (OSTI)

, California 94720-1460 (Dated: February 24, 2003) The role of alignment-to-orientation conversion (AOC) in nuclear quadrupole resonance (NQR) is discussed. AOC is shown to be the mechanism responsible are drawn between NQR and AOC in atomic physics. PACS numbers: 76.60.Gv, 32.80.Bx Polarization is a generic

Budker, Dmitry

202

Physics of laser-driven plasma-based electron accelerators E. Esarey, C. B. Schroeder, and W. P. Leemans  

E-Print Network (OSTI)

Physics of laser-driven plasma-based electron accelerators E. Esarey, C. B. Schroeder, and W. P Laser-driven plasma-based accelerators, which are capable of supporting fields in excess of 100 GV/m, are reviewed. This includes the laser wakefield accelerator, the plasma beat wave accelerator, the self

Geddes, Cameron Guy Robinson

203

Ultra-High Gradient Dielectric Wakefield Accelerator Experiments  

SciTech Connect

Ultra-high gradient dielectric wakefield accelerators are a potential option for a linear collider afterburner since they are immune to the ion collapse and electron/positron asymmetry problems implicit in a plasma based afterburner. The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. The experiment took advantage of the unique SLAC FFTB electron beam and its ultra-short pulse lengths and high currents (e.g., {sigma}{sub z} = 20 {micro}m at Q = 3 nC). The FFTB electron beam was successfully focused down and sent through short lengths of fused silica capillary tubing (ID = 200 {micro}m/OD = 325 {micro}m). The pulse length of the electron beam was varied to produce a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments being developed for the SLAC SABER and BNL ATF we plan to use the coherent Cerenkov radiation emitted from the capillary tube as a field strength diagnostic and demonstrate GV/m range particle energy gain.

Thompson, M C; Badakov, H; Rosenzweig, J B; Travish, G; Hogan, M; Ischebeck, R; Kirby, N; Siemann, R; Walz, D; Muggli, P; Scott, A; Yoder, R

2006-08-04T23:59:59.000Z

204

Ultra-High Gradient Dielectric Wakefield Accelerator Experiments  

SciTech Connect

Ultra-high gradient dielectric wakefield accelerators are a potential option for a linear collider afterburner since they are immune to the ion collapse and electron/positron asymmetry problems implicit in a plasma based afterburner. The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. The experiment took advantage of the unique SLAC FFTB electron beam and its ultra-short pulse lengths and high currents (e.g., {sigma}z = 20 {mu}m at Q = 3 nC). The FFTB electron beam was successfully focused down and sent through short lengths of fused silica capillary tubing (ID = 200 {mu}m / OD = 325 {mu}m). The pulse length of the electron beam was varied to produce a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments being developed for the SLAC SABER and BNL ATF we plan to use the coherent Cerenkov radiation emitted from the capillary tube as a field strength diagnostic and demonstrate GV/m range particle energy gain.

Thompson, M. C. [Lawrence Livermore National Laboratory, Livermore, California, 90095 (United States); Badakov, H.; Rosenzweig, J. B.; Travis, G. [UCLA Department of Physics and Astronomy, Los Angeles, California, 90095 (United States); Hogan, M.; Ischebeck, R.; Kirby, N.; Siemann, R.; Walz, D. [Stanford Linear Accelerator Center, Stanford, California, 94309 (United States); Muggli, P. [University of Southern California Los Angeles, California, 90089 (United States); Scott, A. [UCSB Department of Physics, Santa Barbara, California, 93106 (United States); Yoder, R. [Manhattan College, Riverdale, New York, 10471 (United States)

2006-11-27T23:59:59.000Z

205

ccsd00000540 Production of Long-Lived Ultracold Li 2 Molecules from a Fermi gas  

E-Print Network (OSTI)

and sign of the scattering length. In bosonic samples, the collapse of Bose-Einstein condensates (BEC a Fermi gas J. Cubizolles 1 , T. Bourdel 1 , S. J. J. M. F. Kokkelmans 1 , G.V. Shlyapnikov 1;2;3 and C-bound Li2 molecules from a degenerate two component Fermi gas by sweeping a magnetic #12;eld across

206

Presence of an Unusual Methanogenic Bacterium in Coal Gasification Waste  

Science Journals Connector (OSTI)

...stoppered bottle and degassing the media at least three times with 80% N2-20% CO2. The media were then reduced with the...using 0.22-p,m- pore-size Millex-GV filter units...autoclave. By equilibrating the media with 0.4 atm (ca. 40...

Francisco A. Tomei; Dwight Rouse; James S. Maki; Ralph Mitchell

1988-12-01T23:59:59.000Z

207

Interactions in Syntrophic Associations of Endospore-Forming, Butyrate-Degrading Bacteria and H2-Consuming Bacteria  

Science Journals Connector (OSTI)

...previously degassed with N2. The media were prepared by mixing all...with 80% N2-20% CO2. The medium was then reduced and dispensed...Millex-GV filter units (pore size, 0.22 ,um; Millipore Corp...sterilized in the autoclave. The medium equilibrated to a pH of 6...

Francisco A. Tomei; James S. Maki; Ralph Mitchell

1985-11-01T23:59:59.000Z

208

Wyoming Water Resources Research Centter Annual Technical Report  

E-Print Network (OSTI)

: Not Applicable Focus Category: Models, Surface Water, None Descriptors: Channel Erosion, Coal Bed Methane, Stable Operators Group Meeting, Casper, WY. #12;Problem and Research Objectives: Coal bed methane (CBM) development. Wilkerson, G.V., J.C. Baxter, J.H. Johnson, and J. Montgomery, Aug 2000. Presentation at the Methane

209

Rainfall-induced carbon dioxide pulses result from sequential resuscitation of phylogenetically clustered microbial groups  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 29 Mukamolova GV Kaprelyants AS Young DI Young M Kell DB ( 1998 ) A bacterial cytokine . Proc Natl Acad Sci USA...

Sarah A. Placella; Eoin L. Brodie; Mary K. Firestone

2012-01-01T23:59:59.000Z

210

The effect of fast and slow motor unit activation on whole-muscle mechanical performance: the size principle may not pose a mechanical paradox  

Science Journals Connector (OSTI)

...thus consuming metabolic energy without significantly...cost, increasing the energy consumed to complete...on initial mechanical efficiency of mouse soleus muscles...distribution within a pool of 300 homonymous motoneurons...GV Lauder. 1994 How swimming fish use slow and fast...

2014-01-01T23:59:59.000Z

211

Proceedings of the 1st Annual Gas Processing Symposium  

E-Print Network (OSTI)

pretreatment units, a gas-fired power plant, a CO2 separation unit and storage tanks. LNG and condensateProceedings of the 1st Annual Gas Processing Symposium H. Alfadala, G.V. Rex Reklaitis and M.M. El. An example of the latter arises if part of the gas output from the separation plant is fed back

Foss, Bjarne A.

212

Gamma-ray lines observed in balloon flights at high rigidity  

Science Journals Connector (OSTI)

Gamma-ray lines at 0.511 MeV and 1.632 MeV have been observed at high rigidity (12.5 GV), and up to 4 g cm?2, during stratospheric balloon flights launched from So Jos dos Campos,...

N. A. Buivan; K. R. Rao; I. M. Martin

213

Publications: 1. N.V. Avramenko, A.L. Mirakyan, M.V. Korobov, E.B. Stukalin, Thermochemistry of  

E-Print Network (OSTI)

, E.B. Stukalin, N.I. Ivanova, N.V. Avramenko, G.V. Andrievsky, DSC study of C60 ­ water system, A.B. Kolomeisky. Coupling of two motor proteins: a new motor can move faster, Phys. Rev. Lett., 94

214

On a theory of search  

Science Journals Connector (OSTI)

......we find that (3-17) can thus be written - [+T f"flf{( a + Af)*} ifc[{(t> - )* + (Ax - A)*}*] d&i c2u. (3-18) i r J -r JO This integral equation along with the boundary conditions g(v) = 0, v =% 2randgr(2r) = k......

J. E. PALOHEIMO

1971-04-01T23:59:59.000Z

215

Proceedings of DETC'03 ASME 2003 Design Engineering Technical Conferences and  

E-Print Network (OSTI)

C cost CH powertrain hybridization cost per unit Cp cost of unit production D diesel fuel price D "normal" level of diesel fuel price fe fuel economy ge vector of enterprise inequality constraints gv volatility of diesel fuel price t monthly period R v tolerance variable for system responses y v tolerance

Papalambros, Panos

216

To appear in International Journal of Hydrogen Energy 1 Sustainable Convergence of Electricity and Transport Sectors in the  

E-Print Network (OSTI)

grid investments such as new power generation installations. Keywords: Hydrogen economy, fuel cell sector based on fuel cell vehicles (FCVs). A comprehensive robust optimization planning model AFV Alternative-Fuel Vehicle. FCV Fuel Cell Vehicle. GV Gasoline Vehicle. HHV Higher Heating Value

Cañizares, Claudio A.

217

Management and monitoring of public buildings through ICT based systems: control rules for energy saving of lighting , J. Virgone2  

E-Print Network (OSTI)

for energy saving of lighting and HVAC Authors C. Aghemo1 , J. Virgone2 , G.V. Fracastoro1 , A. Pellegrino1 strategies to reduce energy consumptions for lighting and air conditioning, are presented. Keywords: energy *, L. Blaso1 , J. Savoyat2 and Kevyn Johannes2 Affiliation 1 Politecnico di Torino, Energy Department

Paris-Sud XI, Université de

218

Physiochemical disparity of mismatched HLA class I alloantigens and risk of acute graft-versus-host disease  

E-Print Network (OSTI)

Leukocyte Infusion (DLI), relapse or second HSCT within 100 days after 94 HSCT and at 100 days after HSCT. Death without ? grade II aGvHD within 100 days after HSCT was 95 treated as a competing risk. Secondary outcomes in the HSCT analysis were incidence...

Kosmoliaptsis, V.; Jris, M. M.; Mallon, D. H.; Lankester, A. C.; von dem Borne, P. A.; Kuball, J.; Bierings, M.; Cornelissen, J. J.; GroenendijkSijnke, M. E.; van der Holt, B.; Bradley, J. A.; Oudshoorn, M.; van Rood, Jon J.; Taylor, C. J.; Claas, F. H. J.

2015-01-26T23:59:59.000Z

219

Myxoma Virus Is a Novel Oncolytic Virus with Significant Antitumor Activity against Experimental Human Gliomas  

Science Journals Connector (OSTI)

...myxoma virus [review]. Viral Immunol 2002;15:229-46. 28 Fenner F, Ross J. Myxomatosis. In: Thompson GV, King CM, editors...presence of interferon. Virology 1963;19:294-301. 41 Fenner F, Ratcliffe FN. Myxomatosis. Cambridge (UK): Cambridge...

Xueqing Lun; Wenqing Yang; Tommy Alain; Zhong-Qiao Shi; Huong Muzik; John W. Barrett; Grant McFadden; John Bell; Mark G. Hamilton; Donna L. Senger; Peter A. Forsyth

2005-11-01T23:59:59.000Z

220

Slide23 | OSTI, US Dept of Energy, Office of Scientific and Technical  

Office of Scientific and Technical Information (OSTI)

Slide23 Slide23 Slide23 Developing Country Access Afghanistan Guatemala Nigeria Albania Guinea Pakistan Algeria Guinea-Bissau Palestinian Territories (West Bank/ Gaza) Angola Guyana Papua New Guinea Armenia Haiti Paraguay Azerbaijan Honduras Peru Bangladesh Indonesia Philippines Belize Iraq Rwanda Benin Jordan Samoa Bhutan Kenya Sao Tome and Principe Bolivia Kiribati Senegal Burkina Faso Kyrgyzstan Sierra Leone Burundi Lao People's Democratic Republic Solomon Islands Cambodia Lesotho Somalia Cameroon Liberia Sri Lanka Cape Verde Macedonia, The Former Yugoslav Republic of Swaziland Central African Republic Madagascar Tajikistan Chad Malawi Tanzania, United Republic of Colombia Maldives Thailand Comoros Mali Timor-Leste Congo Marshall Islands Togo Congo, The Democratic Republic of Mauritania Tonga

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

A study of shin oak (Quercus havardi) poisoning in cattle  

E-Print Network (OSTI)

to 1$ days. Fach guinea oip was fed 20 grams of oak daily, and was fed rabbit nuggets free choice, Feeding Fresh Blossoms, Buds, and heaves of Shin Oak ?o Rabbits Sixty four rabbits were fed fresh shin oak from 5 ?, o 20 days. These rabbits readily...' mothers be'. ttp I'ed risk devt loses sl pns of i linens?but t bey los . weigh i. This also was orobably dtte decrease in mi'k yield by their mothers. Feeding Shin Oak i;o Guinea Pips Table ~tj Five of the seven guinea oigs die t afler being f d oak...

Dollahite, James Walton

2012-06-07T23:59:59.000Z

222

ECOWAS Clean Energy Gateway-Policy/ProgramDesign | Open Energy Information  

Open Energy Info (EERE)

ECOWAS Clean Energy Gateway-Policy/ProgramDesign ECOWAS Clean Energy Gateway-Policy/ProgramDesign Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo Background → Design → Implementation →

223

ECOWAS Clean Energy Gateway-News | Open Energy Information  

Open Energy Info (EERE)

News News Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo Regional News Renewable Energy News Today-West Africa Renewable Energy News Failed to load RSS feed from http://renewableenergy.einnews.com/xml/west-africa/: Error fetching URL: Operation timed out after 5000 milliseconds with 0 bytes received

224

Gateway:ECOWAS Clean Energy Gateway | Open Energy Information  

Open Energy Info (EERE)

ECOWAS Clean Energy Gateway ECOWAS Clean Energy Gateway Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo West Africa Organizations, Programs, and Tools Countries (15)

225

West African Clean Energy Gateway-Software Analysis Tools | Open Energy  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » West African Clean Energy Gateway-Software Analysis Tools Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png

226

ECOWAS Clean Energy Gateway-Transportation | Open Energy Information  

Open Energy Info (EERE)

ECOWAS Clean Energy Gateway-Transportation ECOWAS Clean Energy Gateway-Transportation Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo Introduction→ Step 1 Step 2 Step 3 Step 4

227

ECOWAS Clean Energy Gateway-Help | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » ECOWAS Clean Energy Gateway-Help Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png

228

ECOWAS Clean Energy Gateway-Technology Data | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » ECOWAS Clean Energy Gateway-Technology Data Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png

229

ECOWAS Clean Energy Gateway-About | Open Energy Information  

Open Energy Info (EERE)

ECOWAS Clean Energy Gateway-About ECOWAS Clean Energy Gateway-About Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo The ECOWAS Centre for Renewable Energy and Energy Efficiency (ECREEE) is

230

Energy System and Scenario Analysis Toolkit | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo What analysis tools and methods can I use to study my country's energy system? Understanding approaches

231

ECOWAS Clean Energy Gateway-Organizations and Networks | Open Energy  

Open Energy Info (EERE)

ECOWAS Clean Energy Gateway-Organizations and Networks ECOWAS Clean Energy Gateway-Organizations and Networks Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo Registered Technical and Research Organizations

232

West African Clean Energy Gateway-Resource Assessment | Open Energy  

Open Energy Info (EERE)

African Clean Energy Gateway-Resource Assessment African Clean Energy Gateway-Resource Assessment Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo SWERA-thumb.jpg The SWERA landing page allows for the quick browsing of global data layers.

233

Impact Assessment Toolkit | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » Impact Assessment Toolkit Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png

234

ECOWAS Clean Energy Gateway-Finance | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » ECOWAS Clean Energy Gateway-Finance Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png

235

Category:Economic Community of West African States | Open Energy...  

Open Energy Info (EERE)

Guinea-Bissau I Ivory Coast L Liberia M Mali N Niger Nigeria S Senegal Sierra Leone T Togo Retrieved from "http:en.openei.orgwindex.php?titleCategory:EconomicCommunity...

236

Pandora of Ebola virus: are we ready?  

Science Journals Connector (OSTI)

On 23 March 2014, the ministry of health of Guinea notified WHO of a rapidly spreading outbreak of Ebola virus disease (EVD) in south-eastern... ...http://www.who.int/csr/don/2014_07_31_ebola/en/ ...

Ruifu Yang

2014-11-01T23:59:59.000Z

237

Ebola Virus Disease: Essential Public Health Principles for Clinicians  

E-Print Network (OSTI)

at: at http://www.cdc.gov/vhf/ebola/outbreaks/ guinea/qa-at: http://www.cdc.gov/vhf/ebola/diagnosis/index.html.for Suspected Ebola Cases, 2014. Available at: http://

Koenig, Kristi L.; Majestic, Cassondra; Burns, Michael J

2014-01-01T23:59:59.000Z

238

Supplement 21, Part 7, Parasite-Subject Catalogue, Hosts  

E-Print Network (OSTI)

Caligus malabaricus: Torres Strait off Northern Australia Caligus sp. A: Sierra Leone; Gabon Caligodes laciniatus: Florida; Caribbean Sea; off Mississippi coast; off Surinam; off northern Brazil; Cape Verde Islands; Gulf of Guinea; off Sierra Leone...

Zidar, Judith A; Shaw, Judith H.; Hanfman, Deborah T.; Kirby, Margie D.; Rayburn, Jane D.; Edwards, Shirley J.; Hood, Martha W.

1978-01-01T23:59:59.000Z

239

The Origin and Early Cultivation of Sorghums in Africa.  

E-Print Network (OSTI)

and Domestication of Sorghum ..................................... 8 Race Bicolor .............................. 11 Race Guinea .............................. 12 Race Caudatum ........................... 13 Race Kafir... .................................... 17 Additional Bibliography Dealing with the Origins of Agriculture in Africa ...................................... 19 Archeological Evidence ..................... 19 Domestication/Origins ...................... 20 Climatalogical...

Mann, J.A.; Kimber, C.T.; Miller, F.R.

1983-01-01T23:59:59.000Z

240

Atmos. Chem. Phys., 10, 1101711096, 2010 www.atmos-chem-phys.net/10/11017/2010/  

E-Print Network (OSTI)

and Papua New Guinea, is one of the most heavily populated regions of the world. Biofuel and biomass burning easterly jet. Part of the pollution can reach the tropical tropopause layer, the gate- way

Meskhidze, Nicholas

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Workbook Contents  

U.S. Energy Information Administration (EIA) Indexed Site

Natural Gas Imports From Canada (MMcf)","U.S. Liquefied Natural Gas Imports From Egypt (MMcf)","U.S. Liquefied Natural Gas Imports From Equatorial Guinea (MMcf)","U.S....

242

Microsoft PowerPoint - Session2_Rogers.pptx  

Annual Energy Outlook 2012 (EIA)

2008 - 2015 1,400 ACTUAL FORECAST search Program 1,200 Yemen USA - Kenai Trinidad Russia ACTUAL FORECAST atural Gas Res 1,000 Qatar Peru Papua New Guinea Oman Nameplate...

243

Visa Students by Country of Citizenship -November 2013 Region Undergraduate Graduate Total  

E-Print Network (OSTI)

(Malvinas) 0 0 0 Guinea (French) 0 0 0 Guyana 11 0 11 Paraguay 0 0 0 Peru 3 3 6 Suriname 1 0 1 Uruguay 0 0 0

244

The first fossil leptofoenine wasp (Hymenoptera, Pteromalidae): A new species of Leptofoenus in Miocene amber from the Dominican Republic  

E-Print Network (OSTI)

) northeastern Australia Doddifoenus rex Bou?ek Papua New Guinea Genus Leptofoenus Smith Leptofoenus howardi (Ashmead) Paraguay, Brazil, Surinam Leptofoenus peleciniformis Smith Brazil, Peru, Venezuela, Costa Rica Leptofoenus pittfi eldae Engel sp. n. Dominican...

Engel, Michael S.

2009-06-30T23:59:59.000Z

245

The architecture of the West African mosque : an exegesis of the Hausa and Fulani models  

E-Print Network (OSTI)

This thesis will examine two models of West African architecture-- the Mosque at Zaria, Nigeria and the Mosque at Dingueraye, Guinea. It will also attempt to illustrate implicit patterns of creative expression, both literal ...

Kahera, Akel I. (Akel Ismail)

1987-01-01T23:59:59.000Z

246

The effects of drainage and amendments on the physical and chemical properties of bauxite residue  

E-Print Network (OSTI)

and resistant titanium minerals. These aluminum minerals can be selectively removed and used as a source of aluminum metal. Most of the bauxite processed in the United States comes from Jamaica, Surinam, or Guinea (Farin and Reibsamen, 1969). This thesis...

Thompson, Thomas Lee

2012-06-07T23:59:59.000Z

247

Phylogeny of tropical marine oscillatoria and correlation with biologically active secondary metabolites  

E-Print Network (OSTI)

governments of Curacao, Panama, and Papua New Guinea, forHowever, a strain from Panama that was closely related to1999) and Bocas del Toro, Panama, which are geographically

Chan, Tracy

2011-01-01T23:59:59.000Z

248

Report on Global Environment Competitiveness of Gabon  

Science Journals Connector (OSTI)

Gabon is on the west coast of Central Africa. Gabon is bordered by Equatorial Guinea to the ... evaluation model, the environment competitiveness index of Gabon ranks at 19 in 133 countries.

Li Jianping; Li Minrong; Wang Jinnan

2014-01-01T23:59:59.000Z

249

NOAAlNMFS Developments U.S. and South Pacific Island  

E-Print Network (OSTI)

Islands, Nauru, New Zealand, Niue, Palau, Papua New Guinea, the Solomon Is lands, Tuvalu, Vanuatu Marianas .. Philippines G\\ '; . uam . ~.~ ..·F·il·~;~~~';;::;:;' ....c;:. ;M'''h'''','''''' . : . Palau

250

Insertion Sequence Element Single Nucleotide Polymorphism Typing Provides Insights into the Population Structure and Evolution of Mycobacterium ulcerans across Africa  

Science Journals Connector (OSTI)

...carried out on a Biometra TProfessional thermal cycler under the following conditions...component concentrations and optimizing the thermal PCR profile. We were thus able to deduce...Guinea, Kenya, Liberia, and South Sudan) that have reported a limited number...

Koen Vandelannoote; Kurt Jordaens; Pieter Bomans; Herwig Leirs; Lies Durnez; Dissou Affolabi; Ghislain Sopoh; Julia Aguiar; Delphin Mavinga Phanzu; Kapay Kibadi; Sara Eyangoh; Louis Bayonne Manou; Richard Odame Phillips; Ohene Adjei; Anthony Ablordey; Leen Rigouts; Franoise Portaels; Miriam Eddyani; Bouke C. de Jong

2013-12-02T23:59:59.000Z

251

Independent Losses of Function in a Polyphenol Oxidase in Rice: Differentiation in Grain Discoloration between Subspecies and the Role of Positive Selection under Domestication  

Science Journals Connector (OSTI)

...this study were collected by our own lab or provided by the International Rice Research Institute. In total, 35 japonica lines, 20...New Guinea (three lines), Philippines (one line), Sri Lanka (nine lines), and Thailand (115 lines). In addition...

Yanchun Yu; Tian Tang; Qian Qian; Yonghong Wang; Meixian Yan; Dali Zeng; Bin Han; Chung-I Wu; Suhua Shi; Jiayang Li

2008-11-25T23:59:59.000Z

252

OF AFRICAVOLUME IV HEDGEHOGS, SHREWS AND BATS  

E-Print Network (OSTI)

, Equatorial Guinea including Bioko I. and NE DR Congo (DeVree 1969, Kock 1969b, Jones 1971, EI-Rayah 1981 al. 1998, RMCA). The lack of records from most of the Congolian rainforest in DR Congo might reflect

Richner, Heinz

253

Mitochondrial DNA phylogenetic analysis of Myrmecolacidae (Insecta: Strepsiptera) va  

E-Print Network (OSTI)

Guinea are determined. Methods were developed for extraction, amplification, and sequencing of mitochondrial DNA (mtDNA) from Strepsiptera. High-resolution mtDNA sequences obtained by these methods were used in the phylogenetic analysis of Myrmecolacidae...

Halbert, Natalie Rose

2013-02-22T23:59:59.000Z

254

The Nonlinear Equatorial Kelvin Wave  

Science Journals Connector (OSTI)

Using the method of strained coordinates, a uniformly valid approximation to the nonlinear equatorial Kelvin wave is derived. It is shown that nonlinear effects are negligible for the Kelvin waves associated with the Gulf of Guinea upwelling. The ...

John P. Boyd

1980-01-01T23:59:59.000Z

255

ECOWAS Clean Energy Gateway-Links | Open Energy Information  

Open Energy Info (EERE)

Page Page Edit History Facebook icon Twitter icon » ECOWAS Clean Energy Gateway-Links Jump to: navigation, search Economic Community of West African States (ECOWAS) Clean Energy Gateway Home | About | News | Links | Help | Countries Benin | Burkina Faso | Cape Verde | Gambia | Ghana | Guinea| Guinea-Bissau | Ivory Coast | Liberia | Mali | Niger | Nigeria | Senegal | Sierra Leone | Togo Countries ECREEE light.JPG FBenin.png FBurkinaFaso.png FCapeVerde.png FGambia.png FGhana.png FGuinea.png FGuinea-Bissau.png Benin Burkina Faso Cape Verde Gambia Ghana Guinea Guinea-Bissau FIvoryCoast.png FLiberia.png FMali.png FNiger.png FNigeria.png FSenegal.png FSierraLeone.png FTogo.png Ivory Coast Liberia Mali Niger Nigeria Senegal Sierra Leone Togo

256

Crude Existence: The Politics of Oil in Northern Angola  

E-Print Network (OSTI)

2005. Bassey, Nnimmo. 2000. Oil and Gas in Africa. Paperat the Gulf of Guinea Oil and Gas Conference. February 5 6,Remains Steady Worldwide. Oil and Gas Journal. 101(44):49.

Reed, Kristin

2009-01-01T23:59:59.000Z

257

Flow pattern in the Ombai Strait, Indonesia, and its relationship with the Indonesian throughflow  

E-Print Network (OSTI)

. There are five major islands of Indonesia: Sumatra, Kaliinantan (Borneo), Java, Sulawesi (Celebes) and Irian (the western part of New Guinea). The Greater Sunda Islands (Kalimantan, Java, and Suinatra), the Malay Peninsula, some smaller groups of islands..., the shallow-shelf sea over Sahul Shelf unites New Guinea (Irian) and Australia. Between these two shallow shelf-seas, there are three island groups: (1) Sulawesi (Celebes) located east of Kaliinantan; (2) a semi-circular chain of Kai Islands including Timor...

Pandoe, Wahyu Widodo

2012-06-07T23:59:59.000Z

258

DOE Review  

NLE Websites -- All DOE Office Websites (Extended Search)

Review 2007 Review 2007 AWA Facility Update, High Gradient Wakefield Generation, and Future Upgrades Manoel Conde, Sergey Antipov, Felipe Franchini, Wei Gai, Feng Gao, Chunguang Jing, Richard Konecny, Wanming Liu, Jidong Long, John Power, Haitao Wang, Zikri Yusof Argonne Wakefield Accelerator Group High Energy Physics Division April 25 - 27, 2007 2 Outline Description of AWA Facililty. Wakefield structures built and tested. Measurements and simulations. List of next experiments to be performed. Plans for Facility upgrades. 3 AWA Drive Beamline Drive Gun Linac & Steering Coils Quads Wakefield Structure Experimental Chambers 4.5 m GV GV YAG1 YAG2 Spectrometer YAG5 Dump/ Faraday Cup Slits YAG4 YAG3 ICT1 ICT2 BPM Single bunch operation - Q=1-100 nC - Energy=15 MeV - High Current = 10 kAmp

259

The effects of cold water injection and two-phase flow on skin factor and permeability estimates from pressure falloff analysis  

E-Print Network (OSTI)

and underburden. Governin E uations Oil phase: K K 8 (cnf) (vP -P gvD + O =+t )8, (I) 0 Water phase: K K 8 v ~ (cnf rw w(vP -P gvD) + O = ? t (y8 S ) (2) w Energy: v K vT - v v 8 P H + v 8 P H + Oh = w w w w f f a The following relations are also...-phase high viscosity runs (Table 7). Series 3 has I-day injection period and 0. 8 days falloff. Each series contains four different runs. Run I is an isothermal run, and Runs 2, 3 and 4 have 175, 100 and 50 F injection temperatures, respectively. Table 9...

Linge, Frode

2012-06-07T23:59:59.000Z

260

Silicon buried gratings for dielectric laser electron accelerators  

SciTech Connect

This paper describes design and simulations of dielectric laser electron accelerators that achieve Gigavolt-per-meter (GV/m) accelerating gradients and wide electron channels (>1??m). The accelerator design is based on a silicon buried grating structure that enables flexible phase synchronization, large electron channel fields, and low standing-wave ratio in the material. This design increases the accelerating gradients to more than double those of reported quartz grating accelerators, thereby reducing the input laser fluence by 60% for the same accelerating gradient. With a 100 fs pulsed laser, our silicon buried gratings can achieve a maximum gradient of 1.1 GV/m, indicating that these accelerators have potential for numerous electron-accelerator applications.

Chang, Chia-Ming, E-mail: cachang@alumni.stanford.edu [Bell Labs, Alcatel-Lucent, 791 Holmdel Road, Holmdel, New Jersey 07733 (United States); Solgaard, Olav [E. L. Ginzton Lab., Stanford University, Stanford, California 94305 (United States)

2014-05-05T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

USAID Europe and Eurasia Climate Program | Open Energy Information  

Open Energy Info (EERE)

and Eurasia Climate Program and Eurasia Climate Program Jump to: navigation, search Name USAID Europe and Eurasia Climate Program Agency/Company /Organization U.S. Agency for International Development Sector Energy, Land Focus Area Energy Efficiency, Renewable Energy Topics Policies/deployment programs, Background analysis Website http://www.usaid.gov/our_work/ Country Armenia, Republic of Macedonia, Russia, Ukraine, Poland, Kazakhstan, Hungary, Turkey, Uzbekistan, Turkmenistan, Lithuania, Estonia, Latvia, Azerbaijan, Tajikistan Western Asia, Southern Europe, Eastern Europe, Eastern Europe, Eastern Europe, Central Asia, Eastern Europe, Western Asia, Central Asia, Central Asia, Northern Europe, Northern Europe, Northern Europe, Western Asia, Central Asia References USAID Regional Climate Programs[1]

262

User:GregZiebold/Program Maps | Open Energy Information  

Open Energy Info (EERE)

Maps Maps < User:GregZiebold Jump to: navigation, search Place Coordinates A Low Carbon Economic Strategy for Scotland United Kingdom A Strategy to Engage the Private Sector in Climate Change Adaptation in Bangladesh Bangladesh A Synthesis of Agricultural Policies in Bangladesh Bangladesh ANL Wind Power Forecasting and Electricity Markets ASEAN-GIZ Regional Environmentally Sustainable Cities Programme - RESCP Brunei Cambodia Indonesia Laos Malaysia Myanmar Philippines Singapore Thailand Vietnam ASEAN-IEA Activities Indonesia Malaysia Singapore Thailand Philippines Vietnam Brunei Myanmar Cambodia Laos Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) Belgium Bulgaria Czech Republic Denmark Germany Estonia Ireland Greece Spain France Italy Cyprus Latvia Lithuania

263

Industry turns its attention south  

SciTech Connect

The paper discusses the outlook for the gas and oil industries in the Former Soviet Union and Eastern Europe. Significant foreign investment continues to elude Russia`s oil and gas industry, so the Caspian nations of Kazakhstan and Azerbaijan are picking up the slack, welcoming the flow of foreign capital to their energy projects. Separate evaluations are given for Russia, Azerbaijan, Kazakhstan, Turkmenistan, Ukraine, Armenia, Belarus, Georgia, Lithuania, Latvia, Estonia, Moldova, Tajikstan, Uzbekistan, Albania, Bulgaria, Croatia, Czech Republic, Hungary, Poland, Romania, Slovakia, Slovenia, and Serbia.

Marhefka, D. [Russian Petroleum Investor, Moscow (Russian Federation)

1997-08-01T23:59:59.000Z

264

Presidentialism, Parliamentarism, and Democracy Reconsidered  

E-Print Network (OSTI)

through regular elections and guarantee civil liberties, thereby reducing political violence (Kitschelt 1986). Within a similar line of studies, scholars note that resources are essential to sustain and mobilize violent activities (Dalton, Sickle... Violence Albania 1998 999 1.41 Latvia 1996 1200 1.81 Argentina* 1995 1079 1.68 Lithuania 1997 1009 1.82 Armenia 1997 2000 1.85 Macedonia 1998 995 1.67 Australia 1995 2048 1.63 Moldova 1996 984 2.13 Bangladesh 1996 1525 1.13 New Zealand 1998 1201 1.60 Brazil...

Yeh, Yao-Yuan

2014-06-26T23:59:59.000Z

265

The Cost of Improving Gas Supply Security in the Baltic States  

E-Print Network (OSTI)

to replace a failed compressor station on a transmission pipeline; 12 most disruptions caused by pipeline failures could be repaired in a week or less. A failure of the Latvian underground storage could potentially disrupt supply to Estonia and Latvia... at In?ukalns. Suppliers must store at least 10 days worth of household consumption beginning 1st September 2008, rising by 10 days each year until a 60 day level is reached (REPUBLIC OF LITHUANIA, 2008). The capacity of the pipeline connection between...

Noel, Pierre; Findlater, Sachi; Chyong, Chi Kong

2012-01-23T23:59:59.000Z

266

Photonic laser-driven accelerator for GALAXIE  

SciTech Connect

We report on the design and development of an all-dielectric laser-driven accelerator to be used in the GALAXIE (GV-per-meter Acce Lerator And X-ray-source Integrated Experiment) project's compact free-electron laser. The approach of our working design is to construct eigenmodes, borrowing from the field of photonics, which yield the appropriate, highly demanding dynamics in a high-field, short wavelength accelerator. Topics discussed include transverse focusing, power coupling, bunching, and fabrication.

Naranjo, B.; Ho, M.; Hoang, P.; Putterman, S.; Valloni, A.; Rosenzweig, J. B. [UCLA Dept. of Physics and Astronomy Los Angeles, CA 90095-1547 (United States)

2012-12-21T23:59:59.000Z

267

Tunable Radiation Source by Coupling Laser-Plasma-Generated Electrons to a Periodic Structure  

SciTech Connect

Near-infrared radiation around 1000 nm generated from the interaction of a high-density MeV electron beam, obtained by impinging an intense ultrashort laser pulse on a solid target, with a metal grating is observed experimentally. Theoretical modeling and particle-in-cell simulation suggest that the radiation is caused by the Smith-Purcell mechanism. The results here indicate that tunable terahertz radiation with tens GV/m field strength can be achieved by using appropriate grating parameters.

Jin, Z. [Photon Pioneers Center, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Chen, Z. L.; Kon, A.; Nakatsutsumi, M. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Zhuo, H. B. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); School of Science, National University of Defense Technology, Changsha 410073 (China); Wang, H. B.; Zhang, B. H.; Gu, Y. Q.; Wu, Y. C.; Zhu, B.; Wang, L. [National Key Laboratory of Laser Fusion, CAEP, Mianyang 621900 (China); Yu, M. Y. [Institute for Fusion Theory and Simulation, Zhejiang University, Hangzhou 310027 (China); Institute for Theoretical Physics I, Ruhr University, Bochum D-44780 (Germany); Sheng, Z. M. [Key Laboratory for Laser Plasmas (Ministry of Education) and Department of Physics, Shanghai Jiao Tong University, Shanghai 200240 (China); Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, CAS, Beijing 100080 (China); Kodama, R. [Photon Pioneers Center, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka, 565-0871 (Japan); Institute of Laser Engineering, Osaka University, 2-6 Yamada-oka, Suita, Osaka, 565-0871 (Japan)

2011-12-23T23:59:59.000Z

268

Preliminary Results from the UCLA/SLAC Ultra-High Gradient CerenkovWakefield Accelerator Experiment  

SciTech Connect

The first phase of an experiment to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range has been completed. This experiment takes advantage of the unique SLAC FFTB electron beam and its demonstrated ultra-short pulse lengths and high currents (e.g., {sigma}{sub z} = 20 {micro}m at Q = 3 nC). The FFTB electron beam has been successfully focused down and sent through varying lengths of fused silica capillary tubing with two different sizes: ID = 200 {micro}m/OD = 325 {micro}m and ID = 100 {micro}m/OD = 325 {micro}m. The pulse length of the electron beam was varied in the range 20 {micro}m < {sigma}{sub z} < 100 {micro}m which produced a range of electric fields between 2 and 20 GV/m at the inner surface of the dielectric tubes. We observed a sharp increase in optical emissions from the capillaries in the middle part of this surface field range which we believe indicates the transition between sustainable field levels and breakdown. If this initial interpretation is correct, the surfaced fields that were sustained equate to on axis accelerating field of several GV/m. In future experiments we plan to collect and measure coherent Cerenkov radiation emitted from the capillary tube to gain more information about the strength of the accelerating fields.

Thompson, M.C.; Badakov, H.; Rosenzweig, J.B.; Travish, G.; /UCLA; Hogan, M.; Ischebeck, R.; Kirby, N.; Siemann, R.; Walz, D.; /SLAC; Muggli, P.; /Southern California U.; Scott, A.; /UC, Santa Barbara; Yoder, R.; /Manhattan Coll., Riverdale

2008-02-06T23:59:59.000Z

269

USAID West Africa Climate Program | Open Energy Information  

Open Energy Info (EERE)

West Africa Climate Program West Africa Climate Program Jump to: navigation, search Name USAID West Africa Climate Program Agency/Company /Organization U.S. Agency for International Development Sector Energy, Land Focus Area Energy Efficiency, Renewable Energy, Forestry, Agriculture Topics Background analysis Website http://www.usaid.gov/our_work/ Country Ghana, Togo, Benin, Senegal, Niger, Nigeria, Mali, Liberia, Gambia, Ivory Coast, Burkina Faso, Sierra Leone, Mauritania, Guinea, Guinea-Bissau, Cameroon, Gabon, Equatorial Guinea, Chad, Sao Tome and Principe, Cape Verde Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Middle Africa, Middle Africa, Middle Africa, Middle Africa, Middle Africa, Western Africa

270

Reply to comment | OSTI, US Dept of Energy, Office of Scientific and  

Office of Scientific and Technical Information (OSTI)

Reply to comment Reply to comment Slide23 Submitted by gibsone on Fri, 2013-08-30 06:22 FY2011-hitson Slide23 Developing Country Access Afghanistan Guatemala Nigeria Albania Guinea Pakistan Algeria Guinea-Bissau Palestinian Territories (West Bank/ Gaza) Angola Guyana Papua New Guinea Armenia Haiti Paraguay Azerbaijan Honduras Peru Bangladesh Indonesia Philippines Belize Iraq Rwanda Benin Jordan Samoa Bhutan Kenya Sao Tome and Principe Bolivia Kiribati Senegal Burkina Faso Kyrgyzstan Sierra Leone Burundi Lao People's Democratic Republic Solomon Islands Cambodia Lesotho Somalia Cameroon Liberia Sri Lanka Cape Verde Macedonia, The Former Yugoslav Republic of Swaziland Central African Republic Madagascar Tajikistan Chad Malawi Tanzania, United Republic of Colombia Maldives Thailand Comoros Mali Timor-Leste

271

African Biofuel & Renewable Energy Fund (ABREF) | Open Energy Information  

Open Energy Info (EERE)

Biofuel & Renewable Energy Fund (ABREF) Biofuel & Renewable Energy Fund (ABREF) Jump to: navigation, search Name African Biofuel & Renewable Energy Fund (ABREF) Agency/Company /Organization African Biofuel & Renewable Energy Compnay (ABREC) Sector Energy Focus Area Renewable Energy, Biomass, - Biofuels Website http://www.bidc-ebid.com/en/fo Country Benin, Burkina Faso, Cape Verde, Ivory Coast, Gambia, Ghana, Guinea, Guinea-Bissau, Liberia, Mali, Niger, Nigeria, Senegal, Sierra Leone, Togo Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa, Western Africa References African Biofuel & Renewable Energy Fund (ABREF)[1]

272

National Action Programmes on Desertification | Open Energy Information  

Open Energy Info (EERE)

Programmes on Desertification Programmes on Desertification Jump to: navigation, search Name National Action Programmes on Desertification Agency/Company /Organization United Nations Convention to Combat Desertification Sector Land Focus Area Forestry, Agriculture Topics Co-benefits assessment, GHG inventory, Policies/deployment programs, Background analysis Resource Type Publications Website http://www.unccd.int/actionpro Country Algeria, Benin, Botswana, Burkina Faso, Burundi, Cameroon, Cape Verde, Chad, Democratic Republic of Congo, Djibouti, Egypt, Equatorial Guinea, Eritrea, Ethiopia, Gabon, Gambia, Ghana, Guinea, Kenya, Lesotho, Madagascar, Malawi, Mali, Mauritania, Morocco, Mozambique, Namibia, Niger, Nigeria, Senegal, South Africa, Sudan, Swaziland, Tanzania, Togo, Tunisia, Uganda, Zambia, Zimbabwe

273

The effect of dietary vitamin D level on the generation of protective cellular immunity against pulmonary tuberculosis  

E-Print Network (OSTI)

-deficient, and severely vitamin D-deficient diets. Animals were sacrificed three weeks following pulmonary infection with M, ~tube G)lid~ 41 Concanavalin A (Con A) -induced proliferation in ~v' r of blood lymphocytes of guinea pigs maintained on control, moderately... vitamin D-deficient, and severely vitamin D-deficient diets. Animals were sacrificed four weeks following pulmonary intect'o th M, '~tt 42 Concanavalin A (Con A)-induced proliferation in ~v'tro of blood lymphocytes of guinea pigs maintained on control...

Hernandez-Frontera, Evaurely

2012-06-07T23:59:59.000Z

274

Forest Carbon Partnership Facility | Open Energy Information  

Open Energy Info (EERE)

Forest Carbon Partnership Facility Forest Carbon Partnership Facility Jump to: navigation, search Logo: Forest Carbon Partnership Facility Name Forest Carbon Partnership Facility Agency/Company /Organization World Bank Sector Land Focus Area Forestry Topics Co-benefits assessment, Finance Resource Type Lessons learned/best practices, Training materials Website http://www.forestcarbonpartner Country Argentina, Bolivia, Cambodia, Cameroon, Central African Republic, Chile, Colombia, Costa Rica, Democratic Republic of Congo, El Salvador, Equatorial Guinea, Ethiopia, Gabon, Ghana, Guatemala, Guyana, Honduras, Indonesia, Kenya, Laos, Laos, Liberia, Madagascar, Mexico, Moldova, Mozambique, Nepal, Nicaragua, Panama, Papua New Guinea, Paraguay, Peru, Republic of the Congo, Suriname, Tanzania, Thailand, Uganda, Vanuatu, Vietnam

275

High power couplers for Project X  

SciTech Connect

Project X, a multi-megawatt proton source under development at Fermi National Accelerator Laboratory. The key element of the project is a superconducting (SC) 3GV continuous wave (CW) proton linac. The linac includes 5 types of SC accelerating cavities of two frequencies.(325 and 650MHz) The cavities consume up to 30 kW average RF power and need proper main couplers. Requirements and approach to the coupler design are discussed in the report. New cost effective schemes are described. Results of electrodynamics and thermal simulations are presented.

Kazakov, S.; Champion, M.S.; Yakovlev, V.P.; Kramp, M.; Pronitchev, O.; Orlov, Y.; /Fermilab

2011-03-01T23:59:59.000Z

276

An evaluation of Cerium-144 as an indigestible marker  

E-Print Network (OSTI)

OF TABLES AND FIGURE Table 144 Retention of Ce With Different Feedstuff s. Page 18 IV. Level of Adsorption and Tenacity of Binding of 144Ce 144 Distribution of Ce by Particle Size After a Marked Fraction of Alfalfa Hay (fine) Was Incubated...: CUNULATIVE FECAL EXCRETION OF Ce FOLLOWING SINGLE DOSE 100 g a e w SO 40 m 0 gv Oy yV V OV 5 8 0 0 0 v~ 20 60 Hours Foi1ow1nS Administration Q Sheep number 1 Sheep number 2 Q Sheep number 3 100 (Castle, 1956) did not reveal significant...

Huston, James Edward

2012-06-07T23:59:59.000Z

277

The Vibration?Rotation Emission Spectrum of Gaseous HZnCl  

Science Journals Connector (OSTI)

The Vibration?Rotation Emission Spectrum of Gaseous HZnCl ... A least-squares fit was performed separately for each of the five observed bands and the lines were fitted using the simple energy level expression15 where G(v1, v2, v3) is the vibrational energy of the (v1, v2, v3) state relative to the zero point energy (ZPE), G(0, 0, 0). ... (16)?Wilson, E. B.; Decius, J. C., Jr.; Cross, P. C. Molecular Vibrations; McGraw-Hill:? New York, 1955. ...

Shanshan Yu; Alireza Shayesteh; Dejian Fu; Peter F. Bernath

2005-04-14T23:59:59.000Z

278

United States and Latvian Governments Sign Agreement to Allow  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Latvian Governments Sign Agreement to Allow Latvian Governments Sign Agreement to Allow Nonproliferation and Threat Reduction Cooperation United States and Latvian Governments Sign Agreement to Allow Nonproliferation and Threat Reduction Cooperation April 25, 2005 - 12:25pm Addthis WASHINGTON, D.C. - As part of the Bush administration's ongoing efforts to secure vulnerable nuclear materials worldwide, the Department of Energy (DOE) and the Latvian Ministry of Environment signed an agreement today that will allow collaboration in nonproliferation and threat reduction areas. Secretary of Energy Samuel W. Bodman and Latvian Minister of Environment Raimonds Vejonis signed the agreement, which will provide for repatriation to Russia of Soviet/Russian-origin nuclear fuel from Latvia's shutdown research reactors at Salaspils; security enhancement of the reactor site

279

NEWTON, Ask a Scientist at Argonne National Labs  

NLE Websites -- All DOE Office Websites (Extended Search)

Internal Battery Resistance Change During Use Internal Battery Resistance Change During Use Name: Mikus Status: student Grade: 9-12 Country: Latvia Date: Spring 2012 Question: Does the internal resistance of a battery change if the battery is being discharged? Replies: Yes. Batteries play a lot of messy games with their internal resistance. The resistance can depend on temperature, percent-of-charge-remaining, recent history of current drain, and battery aging. Each kind of battery (lithium, alkaline, lead-acid, Ni-Cd, NiMH) has a different set of behaviors. I have seen a lithium battery, when suddenly asked to push a large load, allow its output voltage to drop a lot at first, because its internal resistance was high, because the battery was cold. Then the large current flowing through that internal resistance warmed up the battery, and the voltage delivered actually increased with time, for a little while.

280

Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) | Open  

Open Energy Info (EERE)

Plan for Forest Law Enforcement Governance and Trade (FLEGT) Plan for Forest Law Enforcement Governance and Trade (FLEGT) Jump to: navigation, search Name Action Plan for Forest Law Enforcement Governance and Trade (FLEGT) Agency/Company /Organization European Union Sector Land Focus Area Forestry Topics Policies/deployment programs Resource Type Lessons learned/best practices Website http://eur-lex.europa.eu/smart Country Belgium, Bulgaria, Czech Republic, Denmark, Germany, Estonia, Ireland, Greece, Spain, France, Italy, Cyprus, Latvia, Lithuania, Luxembourg, Hungary, Malta, Netherlands, Austria, Poland, Portugal, Romania, Slovenia, Slovakia, Slovenia, Finland, Sweden, United Kingdom Western Europe, Eastern Europe, Eastern Europe, Northern Europe, Western Europe, Northern Europe, Northern Europe, Southern Europe, Southern Europe, Western Europe, Southern Europe, Western Asia, Northern Europe, Northern Europe, Western Europe, Eastern Europe, Southern Europe, Western Europe, Western Europe, Eastern Europe, Southern Europe, Eastern Europe, Southern Europe, Eastern Europe, Southern Europe, Northern Europe, Northern Europe, Northern Europe

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

International Energy Outlook 2006  

Gasoline and Diesel Fuel Update (EIA)

Regional Definitions Regional Definitions The six basic country groupings used in this report (Figure J1) are defined as follows: *OECD (18 percent of the 2006 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2006 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2006 world population)-Albania, Armenia, Azer- baijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Romania, Russia, Serbia and Montenegro, Slovenia,

282

Greenhouse Gas Emission Trends and Projections in Europe 2009 | Open Energy  

Open Energy Info (EERE)

Greenhouse Gas Emission Trends and Projections in Europe 2009 Greenhouse Gas Emission Trends and Projections in Europe 2009 Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Greenhouse Gas Emission Trends and Projections in Europe 2009 Agency/Company /Organization: European Environment Agency Topics: Baseline projection, GHG inventory, Background analysis Resource Type: Maps Website: www.eea.europa.eu/publications/eea_report_2009_9 Country: Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Italy, Latvia, Lithuania, Luxembourg, Malta, Netherlands, Poland, Portugal, Ireland, Romania, Slovakia, Slovenia, Spain, Sweden, United Kingdom UN Region: "Western & Eastern Europe" is not in the list of possible values (Eastern Africa, Middle Africa, Northern Africa, Southern Africa, Western Africa, Caribbean, Central America, South America, Northern America, Central Asia, Eastern Asia, Southern Asia, South-Eastern Asia, Western Asia, Eastern Europe, Northern Europe, Southern Europe, Western Europe, Australia and New Zealand, Melanesia, Micronesia, Polynesia, Latin America and the Caribbean) for this property.

283

Appendix K: Regional Definitions  

Gasoline and Diesel Fuel Update (EIA)

K K Regional Definitions The six basic country groupings used in this report (Figure K1) are defined as follows: *OECD (18 percent of the 2008 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2008 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2008 world population)-Albania, Armenia, Azerbaijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Montenegro, Romania, Russia, Serbia, Slovenia,

284

International Energy Outlook 1999 - Notes and Sources  

Gasoline and Diesel Fuel Update (EIA)

sources.gif (4045 bytes) sources.gif (4045 bytes) [1] Turkey and Belarus are Annex I nations that have not ratified the Framework Convention on Climate Change and did not commit to quantifiable emissions targets under the Kyoto Protocol. [2] The Annex I countries under the Framework Convention on Climate Change are Australia, Austria, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Lithuania, Luxembourg, the Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, the Ukraine, the United Kingdom, and the United States. Turkey and Belarus are also considered Annex I countries, but neither has agreed to any limits on greenhouse gas emissions.

285

International Energy Outlook 2007  

Gasoline and Diesel Fuel Update (EIA)

K K Regional Definitions The six basic country groupings used in this report (Figure K1) are defined as follows: *OECD (18 percent of the 2007 world population): North America-United States, Canada, and Mexico; OECD Europe-Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxem- bourg, the Netherlands, Norway, Poland, Portugal, Slovakia, Spain, Sweden, Switzerland, Turkey, and the United Kingdom. OECD Asia-Japan, South Korea, Australia, and New Zealand. *Non-OECD (82 percent of the 2007 world popula- tion): - Non-OECD Europe and Eurasia (5 percent of the 2007 world population)-Albania, Armenia, Azerbaijan, Belarus, Bosnia and Herzegovina, Bulgaria, Croatia, Estonia, Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, Macedonia, Malta, Moldova, Montenegro, Romania, Russia, Serbia, Slovenia,

286

Liquid metal MHD experimental activities for LLCB TBM development  

Science Journals Connector (OSTI)

Abstract In Indian Lead Lithium cooled Ceramic Breeder (LLCB) blanket concept, LeadLithium (PbLi) liquid metal is used to extract heat from its own bulk volume and also from the neighboring solid breeder zones. The moderate flow velocity of PbLi inside the module can be significantly modified due to MHD effects, which arise because of the presence of strong toroidal magnetic field. Recently, two MHD experiments have been jointly carried out at Institute of Physics, University of Latvia (IPUL) with hot PbLi (?350?C) as the working fluid under a strong transverse magnetic field of up to ?4.0T. The uncoated test sections are made of SS316L material and consist of LLCB TBM relevant flow geometries, such as rectangular and circular flow cross-sections, 90? bends, rectangular to circular flow transition region. The details of the liquid metal MHD experimental set up and experimental results are discussed in this paper.

Rajendraprasad Bhattacharyay; Anita Patel; Rajendrakumar Ellappan; Pravat K. Swain; Polepalle Satyamurthy; Sushil Kumar; Sergei Ivanov; Andrew Shishko; Erik Platacis; Anatoli Ziks

2013-01-01T23:59:59.000Z

287

A Parkinsonian Syndrome in Methcathinone Users and the Role of Manganese  

Science Journals Connector (OSTI)

...antibodies, CD4 lymphocyte counts, and liver function. In addition, serum ceruloplasmin and copper levels were measured. MRI was performed with a General Electric 1.0T Signa Horizon LX high-speed system with head coil and a standardized magnetic resonance examination protocol; sagittal, axial, and coronal T1... In this case series of 23 adults in Latvia who were injection users of methcathinone (a drug manufactured by users from readily available pharmaceutical agents such as pseudoephedrine), patients had an extrapyramidal syndrome, elevated serum manganese levels, and MRI abnormalities in the basal ganglia. These findings suggest that methcathinone use can result in neurologic toxic effects from manganese contained in the methcathinone solution.

Stepens A.; Logina I.; Liguts V.

2008-03-06T23:59:59.000Z

288

Electricity consumption and economic growth in transition countries: A revisit using bootstrap panel Granger causality analysis  

Science Journals Connector (OSTI)

Abstract The purpose of this paper is to revisit the Granger causal relationship between electricity consumption and economic growth for 15 transition economies for the period 19752010 using a bootstrap panel causality approach that allows for both cross-sectional dependency and for heterogeneity across countries. Applying this approach, we found a unidirectional causality running from electricity consumption to economic growth only in Belarus and Bulgaria; from economic growth to electricity consumption in the Czech Republic, Latvia, Lithuania and the Russian Federation; bidirectional causality only in Ukraine while no Granger causality in any direction in Albania, Macedonia, Moldova, Poland, Romania, Serbia, Slovak Republic and Slovenia. These results show that there is a limited support for the electricity-led growth hypothesis. Nevertheless these different findings provide important implications for energy strategies and policies for transition countries.

Yemane Wolde-Rufael

2014-01-01T23:59:59.000Z

289

Commercial Viability of Strategic Choice on Green Energy Business: Hydro Power versus Wind Power (Latvian case)  

Science Journals Connector (OSTI)

Development of green energy, especially such types as hydropower and wind power, presents great opportunities for companies growth. The aim of the paper is to investigate commercial viability of green energy business to make an investment choice for Latvian privately owned small sized hydropower producer and seller LLCGreen Energy Solutions (GES). Firstly the paper investigated theoretical and practical application of such concept of commercial viability of a strategy as a SFA: suitability, feasibility and acceptability. Then the latest trends of Green Energy Business in EU and in Latvia have been explored and strategic suitability has been defined. Secondly, to confirm or disprove investments in a hydropower station or wind turbine, Equivalent annual annuities of each alternative investment project have been calculated and financial feasibility has been discussed. Finally, recommendations for stakeholders regarding further growth of company GES and acceptability of given strategic choice have been reviewed in detail.

Andrejs ?irjevskis; Jekaterina Novikova

2012-01-01T23:59:59.000Z

290

Dual fuel study for the Liepaja Thermal Power Plant. Final report. Export trade information  

SciTech Connect

This study, conducted by Burns and Roe Company, was funded by the U.S. Trade and Development Agency. The report presents the results of engineering studies performed for Latvenergo-the National Electric Utility of Latvia. The work performed is a supplement to a previous study, completed in January, 1994, that defined the basic plant design and site selection for the 300 MW coal-fired plant. The current study expands on the previous work in two main areas; the technical and economic feasibility of integrating natural gas firing technologies into the plant design, and aspects of additional plant site not previously considered. The report is divided into the following sections: (1) Introduction; (2) Technical and Economic Aspects of Plant Design For Dual Capability; (3) Assessment of Natural Gas Supplies; (4) Evaluation of Candidate Sites. Appendices A-C follows.

NONE

1996-04-01T23:59:59.000Z

291

UNFCCC-Global Map-Annex 1 | Open Energy Information  

Open Energy Info (EERE)

UNFCCC-Global Map-Annex 1 UNFCCC-Global Map-Annex 1 Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Global Map-Annex 1 Agency/Company /Organization: United Nations Framework Convention on Climate Change, United Nations Environment Programme Sector: Climate Topics: Baseline projection, Co-benefits assessment, GHG inventory Resource Type: Maps, Software/modeling tools User Interface: Website Website: maps.unfccc.int/di/map/ Country: Australia, Austria, Belarus, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Monaco, Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, Turkey, Ukraine, United Kingdom, United States

292

International Energy Outlook 2000 - Notes & Sources  

Gasoline and Diesel Fuel Update (EIA)

To International Forecasting Home Page To International Forecasting Home Page To Annual Energy Outlook 2000 bullet1.gif (843 bytes) To Forecasting Home Page bullet1.gif (843 bytes) EIA Homepage [1] Turkey and Belarus are Annex I nations that have not ratified the Framework Convention on Climate Change and did not commit to quantifiable emissions targets under the Kyoto Protocol. [2] The Annex I countries under the Framework Convention on Climate Change are Australia, Austria, Belgium, Bulgaria, Canada, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Lithuania, Luxembourg, the Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Slovakia, Slovenia, Spain, Sweden, Switzerland, the Ukraine, the United Kingdom, and the United States. Turkey and Belarus are also considered Annex I countries, but neither has agreed to any limits on greenhouse gas emissions.

293

Marine Biodiversity Hotspots and Conservation Priorities for Tropical Reefs  

Science Journals Connector (OSTI)

...Green,World Atlas of Coral Reefs...D. E. , Sea Wind 5 , 14...south to Perth 3 Gulf of Guinea Islands...of Aqaba and Suez, and inner part of Gulf of Aden...Green, World Atlas of Coral Reefs...McAllister, Sea Wind 5, 14 (1991...

Callum M. Roberts; Colin J. McClean; John E. N. Veron; Julie P. Hawkins; Gerald R. Allen; Don E. McAllister; Cristina G. Mittermeier; Frederick W. Schueler; Mark Spalding; Fred Wells; Carly Vynne; Timothy B. Werner

2002-02-15T23:59:59.000Z

294

DVR Rates Fiscal Year 2014 Division of Veterinary Resources  

E-Print Network (OSTI)

Rodent & Rabbit Services ­ Bethesda & NIHAC Species Description Price Mice Rack Only - SPF Clean (effective rack $/cage-day) $1.34 Mice Rack Only - Bio-Hazard (effective rack $/cage-day) $1.85 Mice Per Diem.71 Mice Sterile Cage Set-up (per cage-day) $0.04 Rats, Guinea Pigs Rack Only - SPF Clean (effective rack

Bandettini, Peter A.

295

HARVARD UNIVERSITY Office of the Provost  

E-Print Network (OSTI)

monitoring the reports of outbreaks of the Ebola virus disease in the West African nations of Sierra Leone, Guinea and Liberia, and of cases of Ebola infection in nearby Nigeria. In order to protect the health be aware that during the incubation period for Ebola virus disease, which is estimated to last for 2

Chou, James

296

August 18, 2014 Dear Members of the Tufts Community  

E-Print Network (OSTI)

of Ebola hemorrhagic fever in several West African countries--currently Liberia, Sierra Leone, Guinea) and the Massachusetts Department of Public Health, the likelihood of the arrival of someone with Ebola virus disease the virus and international travel is helpful. Transmission and Symptoms of Ebola Unlike many other

Dennett, Daniel

297

Ebola Virus Disease The current outbreak of Ebola Virus Disease (EVD) in West Africa has involved the  

E-Print Network (OSTI)

Ebola Virus Disease The current outbreak of Ebola Virus Disease (EVD) in West Africa has involved the countries of Sierra Leone, Liberia, Guinea, and Nigeria. This has become the largest outbreak of Ebola want to make sure you have the most accurate information about this illness. What is Ebola Virus

MacAdam, Keith

298

VIRAL EVOLUTION Genomic surveillance elucidates  

E-Print Network (OSTI)

VIRAL EVOLUTION Genomic surveillance elucidates Ebola virus origin and transmission during the 2014,12,13 � Robert F. Garry,8 � S. Humarr Khan,3 � Pardis C. Sabeti1,2 � In its largest outbreak, Ebola virus disease is spreading through Guinea, Liberia, Sierra Leone, and Nigeria. We sequenced 99 Ebola virus genomes from 78

Napp, Nils

299

Nitrosamines: Scientists on the Trail of Prime Suspect in Urban Cancer  

Science Journals Connector (OSTI)

...energy R & D. That plan seemed to treat solar energy and fusion on a par with the breeder...well in hand, but we've never built a solar generating station or a fusion reactor...and has three heads of state (those of Tanzania, Zambia, and Papua New Guinea) among...

DEBORAH SHAPLEY

1976-01-23T23:59:59.000Z

300

Ministerie van Verkeer en Waterstaat KNMI-publicatie 183-1  

E-Print Network (OSTI)

of Rainfall Year ',.::..'- ......\\47·· S It mm 1 3000-4000 4000-5000 > 5000 Area o Go 5' S - · - - - - · - Une of 1000 m above sealevel + Top above 3000 m o 50 100 150km Mean Amount (New Guinea), to investigate the opportunities for a salt extraction enterprise in that area, in Dutch

Stoffelen, Ad

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

International Orientation Report 2013  

E-Print Network (OSTI)

Mexico 5 Sri Lanka 1 Bangladesh 3 Guatemala 3 Nepal 1 Swaziland 1 Barbados 1 Guinea 1 Netherlands 2 students to resources on the ISSS website and campus partners to help them prepare in the time leading up to their arrival at Vanderbilt. A special section of the ISSS website is devoted to resources for Life

Bordenstein, Seth

302

Supplement 18, Part 6, Parasite-Subject Catalogue: Subject Headings And Treatment  

E-Print Network (OSTI)

parasites of Dutch soldiers who travelled from West New Guinea through Surinam to the Netherlands Arthritis Reddy, C.R.R.M.; and Sivara- [Dracunculus medinensis], mappa, M., 1968 a human (knee joint) Arthritis Woodard, J. C., I968 a Pneumonyssus...

Walker, Martha L.; Rayburn, Jane D.; Humphrey, Judith M.; Segal, Dorothy B.

1973-01-01T23:59:59.000Z

303

A Mechanistic Study of Atlantic Meridional Overturning Circulation Changes on Tropical Atlantic Climate  

E-Print Network (OSTI)

of the northern subtropical gyre enter the equatorial zone, giving rise to a prominent warming in the Gulf of Guinea and off the coast of Africa. Sensitivity experiments further show that the SST response behaves nonlinearly to AMOC changes. The rate of SST...

Wen, Caihong

2010-10-12T23:59:59.000Z

304

THE SEATTLE MEETING OF THE PACIFIC DIVISION. II  

Science Journals Connector (OSTI)

...desensitization in the treatment of tuberculous guinea...One dealing with the water content of spores and...no differences in the water content of spores and...behavior of mag-nesium in electrodialysis of soil colloids was...concentration of the water soluble arsenic in the...

J. Murray Luck

1936-08-21T23:59:59.000Z

305

West Coast (PADD 5) Total Crude Oil and Products Imports  

Annual Energy Outlook 2012 (EIA)

Finland 12 58 99 1995-2013 France 534 493 156 1995-2013 Gabon 1,523 550 1995-2013 Germany 140 950 4 5 2 178 1995-2013 Greece 1995-2003 Guatemala 118 2005-2012 Guinea 1995-2002...

306

Mechanisms underlying postjunctional synergism between responses of the vas deferens to noradrenaline and ATP  

E-Print Network (OSTI)

to noradrenaline and ATP Neil C.E. Smith, Geoffrey Burnstock* Autonomic Neuroscience Institute, Royal Free of postjunctional synergism between adenosine 5V-triphosphate (ATP) and noradrenaline were studied in isolated guinea pig vas deferens. Whereas prior exposure to ATP had no significant effect on noradrenaline

Burnstock, Geoffrey

307

Z .Marine Chemistry 64 1999 229252 The chemical composition of shallow-water hydrothermal fluids  

E-Print Network (OSTI)

; accepted 1 September 1998 Abstract Z .Submarine, hydrothermal venting occurs at Tutum Bay in shallow 5­10 m in Tutum Bay, Ambitle Island, Papua New Guinea and their effect on ambient seawater Thomas Pichler a,) , Jan Veizer a,b , Gwendy E.M. Hall c a Ottawa-Carleton Geoscience Centre, Uni?ersity of Ottawa, Ottawa

Pichler, Thomas

308

2004 01 12 2004 11 26  

E-Print Network (OSTI)

. Liu, T. K., Y. G. Chen, W. S. Chen, and S. H. Jiang 2000 "Rates of CoolingandDenudationofthe Early-Glacial Sea-Level Rise from a Coral Recordat HounPeninsula,Papua New Guinea." Nature 349: 147-149. Chen, W. S 1 2 3 #12; 41 () (regression) (transgression) 1 0.5 (Liu et al., 2000, 2001

Chen, Wen-Shan

309

ISSN1834-3937 Sydney FeStival  

E-Print Network (OSTI)

668 812 John Malkovich in The Giacomo Variations Concert Hall, Sydney Opera House, January 20ISSN1834-3937 summer Sydney FeStival highlightS shanghai expo kids' Lit new guinea hot air Long swims design Where art & Science meet: vivian chan ShaW & anne SchoField SYDNEY ALUMNI MAgAzINE NOVEMb

Viglas, Anastasios

310

Scaling laws for capillary vessels of mammals at rest and in exercise  

Science Journals Connector (OSTI)

...mammal mass kg) 11/12ths power law shrew mouse rat guinea-pig...giraffegazelle wildebeest water buck zebu cattle cow horse...as mammal mass to the power 5/6 (0.83) according...larger mammals. Analysis car- ried out for the present...10.1 kg, the scaling power is 0.920 0.023 (n...

2003-01-01T23:59:59.000Z

311

The shape and tempo of language evolution  

Science Journals Connector (OSTI)

...chain ran for 10 million generations, and burn-in was set to 5 million generations after...chain, leaving a total of 1000 post-burn-in trees. By constraining the tree topology...Alamblak (from Papua New Guinea), Awa Pit (from Colombia), Quechua (from Ecuador...

2010-01-01T23:59:59.000Z

312

ELSEVIER Earth and Planetary Science Letters 136 (1995) 575-590 Recent changes in climate in the far western equatorial Pacific  

E-Print Network (OSTI)

, Madang, Papua New Guinea Scottish Uniaersities Research and Reactor Centre, East Kilbride, Glasgow G74 are presented on changes in the climate of this region over the past 70 yr, based on analysis of the stable and inter-annual changes in temperature means that the coral skeletal 6 "0 record may be reliably

313

Mycobacterium.  

Science Journals Connector (OSTI)

...status of these strains was not given. In general, their radiation response was said to be correlated with the size of their...of eliciting. The model of this kind of immunologi- cal detection is found in the guinea pig experi- mentally infected with...

L Barksdale; K S Kim

1977-03-01T23:59:59.000Z

314

Antibody-mediated neutralization of virus is abrogated by mycoplasma.  

Science Journals Connector (OSTI)

...uninfected), whereas the same virus stock showed no significant differ- ence when neutralized by the guinea pig anti- VSVIdi.. sexo,, serum. The latter serum was not as effective in neutralization as the sheep immunoglobulin since a low, residual, non-neu...

C Dickson; J Elkington; A Hales; R Weiss

1980-06-01T23:59:59.000Z

315

Afring News 34(1) 31 Report on the 2003-2004 ringing year  

E-Print Network (OSTI)

African countries, namely Sao Tome, Equatorial Guinea, Zambia, An- gola, Seychelles and Gabon. The top Swaziland 96 21 2 48 Gabon 89 24 1 89 Afring News (2005) 34: 31-33 #12;32 2005 Table 4. Top 20 ringed

de Villiers, Marienne

316

pidmiologie 210 A. Grolla, A. Lucht, D. Dick et al.  

E-Print Network (OSTI)

de Centre Afrique (RCA), le Cameroun, le Tchad, le Congo, le Gabon et la Guinée-Equatoriale. Depuis'étude des récentes manifestations épidémiques et épizootiques du VEBO au Gabon et pays avoisinants, l, Gabon and Equatorial Guinea. Since 1992, ELISA antibody test along with a RT-PCR have been used

Paris-Sud XI, Université de

317

2011 Korean Government Scholarship Program Guideline for International Students  

E-Print Network (OSTI)

, Egypt, Ethiopia, Fiji, France, Gabon, Georgia, Ghana, Greece, Guatemala, Guinea, Honduras, Hungary, Iran, Bangladesh, Democratic Republic of the Congo, Egypt, Fiji, Gabon, Greece, Guatemala, Kenya, Kuwait, Malaysia-Leste, Ecuador, El Salvador, Egypt, Ethiopia, Fiji, France, Gabon, Germany, Greece, Hungary, Iran, Jamaica

Auckland, University of

318

Acetylcholine-Like Molecular Arrangement in Psychomimetic Anticholinergic Drugs  

Science Journals Connector (OSTI)

...phencyclidine derivatives Striated Smooth muscle muscle (frog (guinea rectus Mam- Central pig abdom- malian nervous R ileum)a inis)- b eye" system0 Ref. 300 0.028 +++ +++ 37 IT~s 200 0.044 +++ +++ 37 (>)-CH2- - 0.072 + - 37 Clue 300...

Saul Maayani; Harel Weinstein; Sasson Cohen; Mordechai Sokolovsky

1973-01-01T23:59:59.000Z

319

Forestry Driver Mapping Project  

E-Print Network (OSTI)

· Borneo · Congo Basin1 · Mekong Region2 · Southern Chile. The project also assesses the role of China Report 1 The Congo Basin includes the nations of Cameroon, the Central African Republic, the Democratic Republic of the Congo, Equatorial Guinea, Gabon and the Republic of the Congo. 2 The Mekong Region includes

320

Dynamics of an Equatorial River Plume: Theory and Numerical Experiments Applied to the Congo Plume Case  

Science Journals Connector (OSTI)

The Congo River has the second largest rate of flow in the world and is mainly responsible for the broad tongue of low-salinity water that is observed in the Gulf of Guinea. Despite their importance, near-equatorial river plumes have not been ...

Clment Vic; Henrick Berger; Anne-Marie Trguier; Xavier Couvelard

2014-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Capacity Building in Wind Energy for PICs  

E-Print Network (OSTI)

1 Capacity Building in Wind Energy for PICs Presentation of the project Regional Workshop Suva hydropower is relatively important (Papua New Guinea, Fiji and Samoa · The traditional use of wind energy has indicates that significant wind energy potential exists. · A monitoring project showed that in Rarotonga

322

Secreted Phosphoproteins Associated with Neoplastic Transformation: Close Homology with Plasma Proteins Cleaved during Blood Coagulation  

Science Journals Connector (OSTI)

...induced hepatomas. Cancer Res., 35: 253-263, 1975. 7. DenOtter, W., DeGroot, J. W., Van Basten, C. D. H., Rademakers, L., DeWeger, R., and Pels, E. Brewer thioglycolate medium induces different ex dalesin guinea pigs and mice. Exp...

Donald R. Senger; Carole A. Perruzzi; Catherine F. Gracey; Ageliki Papadopoulos; Daniel G. Tenen

1988-10-15T23:59:59.000Z

323

Western Greenbrier Co-Production Demonstration Project Draft Environmental Impact Statement  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Figure S-1. Figure S-1. General Location Map U.S. Department of Energy National Energy Technology Lab Western Greenbrier Co-Production Demonstration Project DEIS November 2006 WV 20 S 12 S 63 WV 39 Proposed Co- Production Facility Anjean and Joe Knob Coal Refuse Piles U S 6 0 U S 6 0 US 219 WV 20 WV 39 AN1 AN2 AN3 DN1 DN2 GV W V 2 0 U S 6 0 C R 1 Figure 1-1. General Location Map U.S. Department of Energy National Energy Technology Lab Western Greenbrier Co-Production Demonstration Project DEIS November 2006 WV 20 S 12 S 63 WV 39 Proposed Co- Production Facility Anjean and Joe Knob Coal Refuse Piles U S 6 0 U S 6 0 US 219 WV 20 WV 39 AN1 AN2 AN3 DN1 DN2 GV W V 2 0 U S 6 0 C R 1 S 63 Rainelle Anjean Quinwood Charmco Lewisburg Savannah Quarry Greystone Quarry Boxley Quarry Anjean and Joe Knob Coal Refuse Piles Green Valley Coal Refuse Pile

324

SPECTRA OF COSMIC-RAY PROTONS AND HELIUM PRODUCED IN SUPERNOVA REMNANTS  

SciTech Connect

Data obtained in the Advanced Thin Ionization Calorimeter (ATIC-2), Cosmic Ray Energetics and Mass (CREAM), and Payload for Antimatter Matter Exploration and Light-nuclei Astrophysics (PAMELA) experiments suggest that the elemental interstellar spectra of cosmic rays below the knee at a few times 10{sup 6} GeV are not simple power laws, but that they experience hardening at a magnetic rigidity of about 240 GV. Another essential feature is the difference between proton and helium energy spectra, such that the He/p ratio increases by more than 50% in the energy range from 10{sup 2} to 10{sup 4} GV. We consider the concavity of the particle spectrum resulting from the nonlinear nature of diffusive shock acceleration in supernova remnants (SNRs) as a possible reason for the observed spectrum hardening. The increase of the helium-to-proton ratio with energy can be interpreted as a consequence of cosmic-ray acceleration by forward and reverse shocks in SNRs. The contribution of particles accelerated by reverse shocks makes the concavity of the produced overall cosmic-ray spectrum more pronounced. The spectra of protons and helium nuclei accelerated in SNRs and released into the interstellar medium are calculated. The derived steady-state interstellar spectra are in reasonably good agreement with observations.

Ptuskin, Vladimir; Zirakashvili, Vladimir [Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radio Wave Propagation of the Russian Academy of Science (IZMIRAN), Troitsk, Moscow Region 142190 (Russian Federation)] [Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radio Wave Propagation of the Russian Academy of Science (IZMIRAN), Troitsk, Moscow Region 142190 (Russian Federation); Seo, Eun-Suk [Department of Physics and Institute of Physical Science and Technology, University of Maryland, College Park, MD 20742 (United States)] [Department of Physics and Institute of Physical Science and Technology, University of Maryland, College Park, MD 20742 (United States)

2013-01-20T23:59:59.000Z

325

Search of Axions from a Nuclear Power Reactor with a High-Purity Germanium Detector  

E-Print Network (OSTI)

A search of axions produced in nuclear transitions was performed at the Kuo-Sheng Nuclear Power Station with a high-purity germanium detector of mass 1.06 kg at a distance of 28 m from the 2.9 GW reactor core. The expected experimental signatures were mono-energetic lines produced by their Primakoff or Compton conversions at the detector. Based on 459.0/96.3 days of Reactor ON/OFF data, no evidence of axion emissions were observed and constraints on the couplings $\\gagg$ and $\\gaee$ versus axion mass $m_a$ within the framework of invisible axion models were placed. The KSVZ and DFSZ models can be excluded for 10^4 eV < m_a < 10^6 ~eV. Model-independent constraints on \\gagg \\gv1 < 7.7 X 10^{-9} GeV^{-2} for m_{a} < 10^5 eV and \\gaee \\gv1 < 1.3 X 10^{-10} for m_{a} < 10^6 eV at 90% confidence level were derived. This experimental approach provides a unique probe for axion mass at the keV--MeV range not accessible to the other techniques.

H. M. Chang; TEXONO Collaboration

2006-09-01T23:59:59.000Z

326

The GALAXIE all-optical FEL project  

SciTech Connect

We describe a comprehensive project, funded under the DARPA AXiS program, to develop an all-optical table-top X-ray FEL based on dielectric acceleration and electromagnetic undulators, yielding a compact source of coherent X-rays for medical and related applications. The compactness of this source demands that high field (>GV/m) acceleration and undulation-inducing fields be employed, thus giving rise to the project's acronym: GV/m AcceLerator And X-ray Integrated Experiment (GALAXIE). There are numerous physics and technical hurdles to surmount in this ambitious scenario, and the integrated solutions include: a biharmonic photonic TW structure, 200 micron wavelength electromagnetic undulators, 5 {mu}m laser development, ultra-high brightness magnetized/asymmetric emittance electron beam generation, and SASE FEL operation. We describe the overall design philosophy of the project, the innovative approaches to addressing the challenges presented by the design, and the significant progress towards realization of these approaches in the nine months since project initialization.

Rosenzweig, J. B.; Arab, E.; Andonian, G.; Cahill, A.; Fitzmorris, K.; Fukusawa, A.; Hoang, P.; Jovanovic, I.; Marcus, G.; Marinelli, A.; Murokh, A.; Musumeci, P.; Naranjo, B.; O'Shea, B.; O'Shea, F.; Ovodenko, A.; Pogorelsky, I.; Putterman, S.; Roberts, K.; Shumail, M. [Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); Dept. of Mechanical and Nuclear Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); and others

2012-12-21T23:59:59.000Z

327

Theoretical study of thorium monoxide for the electron electric dipole moment search, II: Electronic properties of $H^3\\Delta_1$ in ThO  

E-Print Network (OSTI)

Recently an improved limits on the electron electric dipole moment, \\eEDM, and dimensionless constant, $k_{T,P}$, characterizing the strength of the T,P-odd pseudoscalar$-$scalar electron$-$nucleus neutral current interaction in the $H^3\\Delta_1$ state of ThO molecule were obtained by ACME collaboration [Science 343, 269 (2014)]. The interpretation of the experiment in terms of fundamental quantities \\eEDM\\ and $k_{T,P}$ is based on the results of theoretical study of appropriate ThO characteristics, the effective electric field acting on electron, \\Eeff, and a parameter of the T,P-odd pseudoscalar$-$scalar interaction, $W_{T,P}$, given in [J.Chem.Phys.\\ 139, 221103 (2013)] by St.Petersburg group. To reduce the uncertainties of the given limits we report improved calculations of the molecular state$-$specific quantities \\Eeff, 81.5~GV/cm, and $W_{T,P}$, 112~kHz, with the uncertainty within 7\\% of the magnitudes. Thus, the values recommended to use for the upper limits of the quantities are 75.8~GV/cm and 104~...

Skripnikov, L V

2014-01-01T23:59:59.000Z

328

Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Resilience (PPCR) Resilience (PPCR) Jump to: navigation, search Name Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Bangladesh, Bolivia, Cambodia, Dominica, Grenada, Haiti, Jamaica, Mozambique, Nepal, Niger, Papua New Guinea, Saint Lucia, Saint Vincent and the Grenadines, Samoa, Tajikistan, Tonga, Yemen, Zambia UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea

329

Additional file 4a. References of the African populations compiled in the databases. Country Population  

E-Print Network (OSTI)

] 99 Egypt Arab MT 83 [25] 100 Egypt Arab MT 101 [26] 101 Egypt Arab Y 20 [7] 102 Egypt Berber Siwa MT 78 [27] 103 Egypt Copte MT 9 [25] 104 Egypt Copte MT 101 [27] 105 Egypt Misc. MT 32 [28] 106 Egypt Misc. Y 19 [17] 107 Egypt Misc.Upper Egypt MT 24 [28] 108 Egypt Nubia MT 11 [25] 109 Equatorial Guinea

Paris-Sud XI, Université de

330

Geological Modeling of Dahomey and Liberian Basins  

E-Print Network (OSTI)

eastern Ivory Coast, off Benin and western Nigeria, and off the Brazilian conjugates of these areas), while large areas were subjected to transform rifting (northern Sierra Leone, southern Liberia, Ghana and the Brazilian conjugates of these areas...). The future Demerara-Guinea marginal plateaus were also progressively subjected to this new rifting event. Stage 2: In Aptian times, the progress of rifting resulted in the creation of small divergent Basins (off northern Liberia, eastern Ivory Coast, Benin...

Gbadamosi, Hakeem B.

2010-01-16T23:59:59.000Z

331

The problem of living in a world contaminated with chemicals  

SciTech Connect

The proliferation of xenobiotic chemicals in the global environment poses living problems for each of us aboard {open_quotes}spaceship earth.{close_quotes} Seven case studies are presented that illustrate the magnitude of the problem that can result from waiting to identify toxic hazards until there have been decades of {open_quotes}human guinea pig{close_quotes} exposure. 25 refs., 5 tabs.

Metcalf, R.L. [Univ. of Illinois, Urbana (United States)

1990-12-31T23:59:59.000Z

332

Paleotopography of glacial-age ice sheets  

SciTech Connect

This is technical comment and response to the subject of paleotophography of glacial age ice sheets. The model presented by Peltier reconstructing the paleotopography of glacial age ice sheets has implications for atmospheric general circulation models of ice age climate. In addition, the model suggests that the glacial-age Antarctic Ice Sheet was significantly larger than today`s. The commentor, Edwards, suggests there is a discrepancy between data from Papua New Guinea and the model results.

Edwards, R.L. [Univ. of Minnesota, Minneapolis, MN (United States)

1995-01-27T23:59:59.000Z

333

Global Health: Disease Eradication  

Science Journals Connector (OSTI)

...have been considered as potential candidates for eradication, but the World Health Organization (WHO) has targeted only two other diseases for global eradication after smallpox. In 1986, WHO's policymaking body, the World Health Assembly, adopted the elimination of dracunculiasis (guinea worm disease)... The most cost-effective intervention for certain infectious diseases is to eliminate them entirely. This article reviews the characteristics of potentially eradicable diseases and surveys current eradication methods.

Hopkins D.R.

2013-01-03T23:59:59.000Z

334

Averting biodiversity collapse in tropical forest protected areas  

E-Print Network (OSTI)

xico, Veracruz 95701, Mexico. 13Columbia University, New York, New York 10027, USA. 14Nordic Foundation for Development and Ecology, DK-1159 Copenhagen, Denmark. 15Bart De Dijn Environmental Consultancy, Paramaribo, Suriname. 16Florida International University...Republic. 126University ofWashington, Seattle, Washington 98195, USA. 127PNG Institute of Biological Research, Goroka, Papua New Guinea. 128University of Suriname, Paramaribo, Suriname. 129113-3885 Richet Rd, Prince George, British Columbia V2K 2J2, Canada. 130...

Laurence, William F.

2012-08-01T23:59:59.000Z

335

Africa: Prosperous times  

SciTech Connect

Political instability and corruption is the rule, rather than the exception, in Africa`s main producing regions, but exploration and production prospects there are bright and attractive to foreign operators. The paper discusses exploration, drilling, resource development, and production in Nigeria, Libya, Algeria, Egypt, Angola, Congo, Gabon, and Tunisia. The other countries of Africa are briefly mentioned, i.e., Cameroon, Cote D`Ivoire, South Africa, Sudan, Namibia, Equatorial Guinea, Eritrea, Zaire, Mozambique, Ghana, Niger, and Seychelles.

NONE

1996-08-01T23:59:59.000Z

336

U.S. Department of the Interior U.S. Geological Survey  

E-Print Network (OSTI)

i n e B a s i n PALAU TRENCH 200 60 60 200 60 F F' E' E D D' C' C G' G A A' Victoria Quezon City Mariana Islands Irian Jaya New Guinea Birds Head Peninsula Sulawesi Palau Islands HALMAHERA TRENCH P A C IOcean Honshu Kyushu Shikoku Kuyushu -Palau Ridge D a i t o R i d g e Okinawa Miyako Jima Iriomote Jima Luzon

Fleskes, Joe

337

Environmental Assessment of the CIESOL Solar Building after Two Years Operation  

Science Journals Connector (OSTI)

Weighed average according to percentage of imports to Spain from Norway, Trinidad and Tobago, Qatar, Oman, Algeria, Nigeria, Egypt, Lybia and Equatorial Guinea. ... results from field tests of a part load solar energized cooling system for typical Spanish houses in Madrid during summer are presented. ... Rosiek, S.; Batlles, F. J. Integration of the solar thermal energy in the construction: Analysis of the solar-assisted air-conditioning system installed in CIESOL building Renewable Energy 2009, 34, 1423 1431 ...

Francisco J. Batlles; Sabina Rosiek; Ivan Muoz; Amadeo R. Fernndez-Alba

2010-03-22T23:59:59.000Z

338

Problem-Solving with Orangutans (Pongo pygmaeus and Pongo abelii) and Chimpanzees (Pan troglodytes): Using the IPAD to Provide Novel Enrichment Opportunities  

E-Print Network (OSTI)

palm nut cracking in Bossou, Guinea (Biro and Inoue-Nakamura, 2003), hunting prosimians in Fongoli, Senegal (Pruetz and Bertolani, 2007), and termite fishing in Gombe National Park, Tanzania (Lonsdorf, 2005). Orangutans also engage in tool use... and engage in tool use. Female chimpanzees have a higher frequency, efficiency, and duration of tool use for termite fishing than male chimpanzees in Gombe (Lonsdorf, 2005). Other enrichment studies have also found that juveniles spend more time...

Boostrom, Helen

2013-12-16T23:59:59.000Z

339

Technology adoption: who is likely to adopt and how does the timing affect the benefits?  

E-Print Network (OSTI)

of the adoption of improved rice varieties in Guinea find age to relate positively to adoption, as do Comer et al. in their study of sustainable practices in Tennessee and McNamara et al. in their study of IPM adoption by peanut producers in Georgia. Other... concentration and technology adoption needs to be further studied. Location. Location has been said to be important because of information spillovers. Baptista (p. 516) says, ?Geographical proximity stimulates networking between firms, thereby facilitating...

Rubas, Debra Joyce

2004-11-15T23:59:59.000Z

340

Data:479bdbf6-c343-445a-b54d-893f27908180 | Open Energy Information  

Open Energy Info (EERE)

bdbf6-c343-445a-b54d-893f27908180 bdbf6-c343-445a-b54d-893f27908180 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: South Carolina Pub Serv Auth Effective date: 2012/12/01 End date if known: Rate name: GV-12 (Seasonal General Service) Sector: Commercial Description: Applicability: This Schedule is applicable to all commercial customers of the Authority meeting the eligibility requirements of the Authority's Medium General Service Rate Schedule, or its successor. Service hereunder applies to all service of the same voltage and character supplied to the Customer's premises through a single delivery point. Energy and power taken under this Schedule may not be resold or shared with others.

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Data:5d6fa5d7-b4c0-4b93-b400-eea4e517fc36 | Open Energy Information  

Open Energy Info (EERE)

d7-b4c0-4b93-b400-eea4e517fc36 d7-b4c0-4b93-b400-eea4e517fc36 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Public Service Co of NH Effective date: 2012/01/01 End date if known: Rate name: Rate GV, Commercial and Industrial INDUSTRIAL Sector: Commercial Description: Source or reference: http://www.psnh.com/RatesTariffs/Business/Small-Business-Rates.aspx Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

342

bns_for_NLC.dvi  

NLE Websites -- All DOE Office Websites (Extended Search)

2, 10/02/99 2, 10/02/99 KEK -aaa-bbb SLAC - www-xxx BNS Profiles and Sensitivity of Beam Orbit of the NLC Linac February 10, 1999 G.V. Stupakov Stanford Linear Accelerator Center Stanford, CA, USA Abstract: Using the computer program LIAR we simulate different BNS regimes in the main NLC linac. The energy overhead for each regime is determined, and both the orbit sensitivity for a small quadrupole offset, and ATL-type ground motion are calculated. A single bunch emittance growth caused by initial offset, slope and tilt of the bunch is also simulated.. BNS Pro les and Sensitivity of Beam Orbit in the NLC Linac G. V. Stupakov, SLAC 0.1 BNS Pro les Using simulation code LIAR 1 , we calculated the emittance growth of a single bunch in the NLC linac due to short-range wake eld a= = 0:18 for the lattice

343

Microsoft Word - Voronina_OthHyd_PE_NEW.rtf  

National Nuclear Security Administration (NNSA)

Aminov, Y.A. et al. 1 Aminov, Y.A. et al. 1 NUMERICAL SIMULATION OF EXPERIMENTS WITH COMMERCIAL EXPLOSIVES Y.A. Aminov, N.S. Eskov, G.V. Kovalenko, Y.R. Nikitenko, V.I. Volkov, V.P. Voronina Russian Federal Nuclear Center - Zababakhin Institute of Technical Physics (RFNC-VNIITF) Snezhinsk, Russia The presentation discusses numerical modeling of experiments [1] aimed at testing the properties of the commercial explosive PZhV-20U. Calculations were made with MACH code [2] that models complex 2D flows with account for physical and chemical transformations. A unique approach was used to describe experiments aimed to characterize: - detonation velocity versus diameter for cylindrical explosive charges; - the expansion of detonation-propelled copper sheathes; and

344

Precinct of Woodsville | Open Energy Information  

Open Energy Info (EERE)

Precinct of Woodsville Precinct of Woodsville Jump to: navigation, search Name Precinct of Woodsville Place New Hampshire Utility Id 20980 Utility Location Yes Ownership M NERC Location NPCC NERC NPCC Yes Activity Buying Transmission Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Rate D Commercial Rate G (Consolidated Electric Tariff General Service) Commercial Rate G (Consolidated Electric Tariff General Service)(3.0 kW OR greater) Commercial Rate GV Consolidated Electric Tariff Industrial General At Primary Voltage Commercial Average Rates Residential: $0.1650/kWh

345

Linear Collider Collaboration Tech Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

Notes Notes LCC - 0018, 15/06/99 Rev B, June 2002 Correct Account of RF Deflections in Linac Acceleration June 15, 1999 G.V. Stupakov Stanford Linear Accelerator Center Stanford, California Abstract: During acceleration in the linac structure, the beam not only increases its longitudinal momentum, but also experiences a transverse kick from the accelerating mode which is linear in accelerating gradient. This effect is neglected in such computer codes as LIAR and TRANSPORT. We derived the Hamiltonian equations that describe the effect of RF deflection into the acceleration process and included it into the computational engine of LIAR. By comparing orbits for the NLC main linac, we found that the difference between the two algorithms is about 10\%. The effect will be more pronounced at smaller

346

LBA-ECO Image and Land Cover Transition Data Sets Published  

NLE Websites -- All DOE Office Websites (Extended Search)

Image and Land Cover Transition Data Sets Published Image and Land Cover Transition Data Sets Published The ORNL DAAC announces the publication of image and land cover transition data sets for Mato Grosso, Brazil, for the years 2000-2001 and 2003-2004. These data sets were prepared by D.A. Roberts, I. Numata, K.W. Holmes, G.T. Batista, T. Krug, A.L. Monteiro, R.L. Powell, and O.A. Chadwick. LBA-ECO ND-01 Fractional Land Cover Images, Rondonia, Brazil: 1984-2000. This data set provides fractional land cover type images for shade, green vegetation (GV), non-photosynthetic vegetation (NPV), and soil for the regions of JiParana, PortoVelho, Luiza, Ariquemes, and Cacoal in the state of Rondonia, Brazil, for the period 1984 to 2000. The images were derived with a spectral mixture analysis (SMA) of Landsat Thematic Mapper (TM) time

347

Grouting at the Idaho National Laboratory Tank Farm Facility, R. Mark Shaw  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Grouting at the Grouting at the Idaho National Laboratory Tank Farm Facility R. Mark Shaw, U. S. Department of Energy safety v performance v cleanup v closure M E Environmental Management Environmental Management 2 Topics/Agenda * Tank Farm Overview * Tank and Vault Grouting * Cooling Coil and Transfer Line Grouting safety v performance v cleanup v closure M E Environmental Management Environmental Management 3 INTEC TANK FARM CLOSURE INTEC TANK FARM CLOSURE VES-WM-103 VES-WM-104 VES-WM-105 VES-WM-106 182 183 185 186 187 189 190 188 184 181 180 Tank Farm Facility Octagon Vaults: WM-180, WM-181 Pillar and Panel Vaults: WM-182, WM-183, WM-184, WM-185, WM-186 Square Vaults: WM-187, WM-188, WM-189, WM-190 GV99 0008 safety v performance v cleanup v closure M E Environmental Management

348

NECDC Word Style Guide (U)  

National Nuclear Security Administration (NNSA)

Eulerian Numerical Techniques EGAK and TREK for Simulation of Eulerian Numerical Techniques EGAK and TREK for Simulation of Multidimensional Multimaterial Flows Yanilkin Yu.V., Belyaev S.P., Bondarenko Yu.A., Gavrilova E.S., Goncharov E.A., Gorbenko A.D., Gorodnichev A.V., Gubkov E.V., Guzhova A.R., Degtyarenko L.I., Zharova G.V., Kolobyanin V.Yu., Sofronov V.N., Stadnik A.L., Khovrin N.A., Chernysheva O.N., Chistyakova I.N., Shemyakov V.N. Russian Federal Nuclear Center, Sarov The paper presents overview of main algorithms underlying Lagrangian-Eulerian techniques EGAK and TREK for simulation of 2D and 3D multimaterial flows with large deformations, including the turbulent mixing phase. Some results of computations are presented that give an estimate of the technique accuracy and efficiency. Introduction

349

Jacob P. Fugal, Scott Spuler Earth Observing Laboratory NCAR, Boulder, CO USA  

NLE Websites -- All DOE Office Websites (Extended Search)

airborne digital holographic airborne digital holographic instrument for measuring the spatial distribution and local size distributions of cloud particles: Holographic Detector for Clouds 2 (HOLODEC 2) Jacob P. Fugal, Scott Spuler Earth Observing Laboratory NCAR, Boulder, CO USA & Raymond A. Shaw Physics Department, michigan Tech Houghton, MI USA C-130 Hercules Q HIAPER Gulfstream GV HOLODEC (Holographic Detector for Clouds) is an airborne instrument that measures the size, shape, and relative 3D position of cloud particles using digital in- line holography. Science Questions for HOLODEC 2 * How do local cloud particle size distributions vary inside cloud regions (edge, top, core, base), by cloud age, cloud type? * How are cloud particles spatially distributed on sub-cm scales due to mixing, entrainment, and

350

AMS-02 Results Support the Secondary Origin of Cosmic Ray Positrons  

Science Journals Connector (OSTI)

We show that the recent AMS-02 positron fraction measurement is consistent with a secondary origin for positrons and does not require additional primary sources such as pulsars or dark matter. The measured positron fraction at high energy saturates the previously predicted upper bound for secondary production, obtained by neglecting radiative losses. This coincidence, which will be further tested by upcoming AMS-02 data at higher energy, is a compelling indication for a secondary source. Within the secondary model, the AMS-02 data imply a cosmic ray propagation time in the Galaxy of <106??yr and an average traversed interstellar matter density of ?1??cm-3, comparable to the density of the Milky Way gaseous disk, at a rigidity of 300GV.

Kfir Blum; Boaz Katz; Eli Waxman

2013-11-20T23:59:59.000Z

351

A study of soap stock from cotton seed oil as influenced by variations in the cooking temperature of the cotton seed meats  

E-Print Network (OSTI)

Bel2 Be 23 V, OG 10 ~ 63 Be 15 '/ ~ QU BeO? Se32 8, 35 9 F 00 8 77 10 ~ O'7 Qel4 Be 81 9%06 QeOS Qe38 Bs92 Bs75 9 ~ GV 'I ~ 93 V ~ 50 8. 9. Be 91 8, 90 Bs60 Qe08 7, 46 Veb4 VS 15 F 85 Ge 90 Be45 5sbV Ge30 6 ~ 15 6e40... li?9 c. '0 e 4 14 ~ 1 14sb xl?v llsi 14s '7 10. ~ J ~ J 1" ~ D 10 ~ J B, B lbsl Be 0 14 ~ ~ 10 ~ . - V ~ J I 9 ' 0 '7 ~ 9 1D ~ J 0. 1 7. 3 0 ~ 1 U ~ b 9 ~ 6 5 ~ 9 51. 9 "9 ' 1 "7 ' 9 60 ~ ': ~ 6 L9 ~ 0 60 ~ J P7 ~ e "7...

North, Harvey Steinle

2012-06-07T23:59:59.000Z

352

The Neutron Lifetime  

E-Print Network (OSTI)

The decay of the free neutron into a proton, electron, and antineutrino is the prototype semileptonic weak decay and the simplest example of nuclear beta decay. The nucleon vector and axial vector weak coupling constants G_V and G_A determine the neutron lifetime as well as the strengths of weak interaction processes involving free neutrons and protons that are important in astrophysics, cosmology, solar physics and neutrino detection. In combination with a neutron decay angular correlation measurement, the neutron lifetime can be used to determine the first element of the CKM matrix Vud. Unfortunately the two main experimental methods for measuring the neutron lifetime currently disagree by almost 4 sigma. I will present a brief review of the status of the neutron lifetime and prospects for the future.

Wietfeldt, F E

2014-01-01T23:59:59.000Z

353

The Neutron Lifetime  

E-Print Network (OSTI)

The decay of the free neutron into a proton, electron, and antineutrino is the prototype semileptonic weak decay and the simplest example of nuclear beta decay. The nucleon vector and axial vector weak coupling constants G_V and G_A determine the neutron lifetime as well as the strengths of weak interaction processes involving free neutrons and protons that are important in astrophysics, cosmology, solar physics and neutrino detection. In combination with a neutron decay angular correlation measurement, the neutron lifetime can be used to determine the first element of the CKM matrix Vud. Unfortunately the two main experimental methods for measuring the neutron lifetime currently disagree by almost 4 sigma. I will present a brief review of the status of the neutron lifetime and prospects for the future.

F. E. Wietfeldt

2014-11-13T23:59:59.000Z

354

Preliminary results obtained with an apparatus for studying the effect of carbon dioxide on consumption of oxygen by respiring cotton roots  

E-Print Network (OSTI)

emg@-:; = '. ;, . -;. - -;, -. ;, ::. :;, , :-"::-'::--'. ke. . of. :. o~ esg5i one end/4x'~to~'ee' et'@~ oh'=exp~ ? -4R=:~:-+&~-;-~=4~~~~4-'M ~ ='-%=. 4cnv y--'; ? ? ' '-~$8'. othe';:hef44j't ? &Cc'0 -i4'-':-458!:$lcsfk... ELECTROOE. ~ f ! ~CC4~ V5 4'1'gV' X7CNC'0~ SCAN3;Al ClWCCX'CHK@s ge. . vive':~. ". 5m'~e;4~4' jXe54'f jy'" ~y. 6f'M@ &a@, ' . , ' '; "' '=. , ::. "", '. "' ' f9~ '4B 4+C5ANg@!. @XA~~lid XCtl8~ ?~@8&''SQL485lp' 4@4}4 rl W fr'B, 6185QQC@ %C'5@X' CCb...

Hinesly, Thomas Daniel

2012-06-07T23:59:59.000Z

355

Effects of implantation of Synovex (progesterone-estradiol) and castration in Holstein and Brown Swiss bull calves for beef production  

E-Print Network (OSTI)

~ caLG care+". ~iaa Be~a~ . ". a ~mLL~;~ii Uhoy' SaLCQ GLoaLakma phmp5ace A~~ZQ==' Za& ~~ ee e~W chic. "~ ~ eaa eaaeecbsd a@8 Rent FG~ eel @4PgelN4'aoL sc&mmcaLll' aa ecgisLhLc4 Haal@sssmaca. II@ -':~~ w4~ and 4ia@e- ~ eel 44~XRy -- whee eiii4...~~~~~ QF XL~%M'~JISM GP GV~i: ~ (K~%'~~HG-8SVRPPEfQ AGO CKS~ZXKl m mmmm . m n'-zz kaae wu. e. ~~ms sm ~ ewm~~ Ey F~QQ de t'A760 ~ L: irk ' 5 ~Qe4 4e Ae skate Oellega et che 'Zemi PAR Snivel, ey 4o ~roast aaaueeac oe m i;~us:. ~re xor...

Vergara, Francisco de Patino

2012-06-07T23:59:59.000Z

356

Convergence and divergence of Fourier series  

E-Print Network (OSTI)

of Theorem 26, in euob gros@ of terse cormsgonaing to Q ~ f cs /~ Ie g substitute C ~ X for g ~ Vc bEIFQ e, series ~ Pt~ &J l~g' ~ ~ es before~ ecgi p~~ 4 ~ m ghenevey 'I gAgf' - &. &~j-c+& ~ 4 gA, k. . -- f, ZA~&g; The serums stiD. oonverges nnifon...myles"aqua~, c~pcpg apop CXQFtQSQ $2VXQ8 M 'eKISR) go eexPop cap. cog. e~~bax s~j go qu~g~ ~~ ~ ssxag go alloy ~c~s, ", pnr ~g~~y s~ ~ jacuzzi ~seps~g a~ oq. ~~ng l @amuse aa~gv ~u m~ ao ~~~ucTsa e &, so. , '3 '3 t &~% ~Q pQO ~EBS 0$ SQ...

Bryant, Jack Douglas

2012-06-07T23:59:59.000Z

357

Positron acceleration by plasma wake fields driven by a hollow electron beam  

E-Print Network (OSTI)

A scheme of wake field generation for positron acceleration using hollow or donut shaped electron driver beams is studied. An annular shaped, electron free region forms around a hollow driver beam creating a favorable region (longitudinal field is accelerating and transverse field is focusing and radially linear) for positron acceleration. Accelerating gradients of the order of 10 GV/m are produced by a hollow electron beam driver with FACET like parameters. The peak accelerating field increases linearly with the total charge in the beam driver while the axial size of the favorable region ($\\sim$ one plasma wavelength) remains approximately fixed. The radial size drops with the total charge but remains large enough for the placement of a witness positron beam. We simulate an efficient acceleration of a 23 GeV positron beam to 35.4 GeV with a maximum energy spread of 0.4\\% and very small emittance over a plasma length of 140 cm.

Jain, Neeraj; Palastro, J P

2014-01-01T23:59:59.000Z

358

Optimization-Based Network Analysis with Applications in Clustering and Data Mining  

E-Print Network (OSTI)

of vertices that need to 1 be deleted from G in order to obtain a disconnected or a trivial graph. The density (G) of G is given by (G) = jEj= jV j 2 . A complete graph Kn on n vertices is a graph that contains all possible edges, i.e, (Kn) = 1...; v0)] = P1(v; v0) and G[V2(v; v0)] = P2(v; v0) then C is called a partitionable cycle. If, in addition, jV1(v; v0)j 6= jV2(v; v0)j then the partitionable cycle C is called asymmetric. Mahdavi and Balasundaram [80] have proved that if no subset of 5...

Shahinpour, Shahram

2013-07-22T23:59:59.000Z

359

Langevin Equation and the ac Conductivity of Non-Maxwellian Plasmas  

Science Journals Connector (OSTI)

The use of the Langevin equation {dvdt+gv=(qm)[E0ei?t+(vc)H]} to describe the electrical conductivity of a non-Maxwellian plasma (a weakly ionized gas in which the average electron collision frequency is temperature dependent) may be in error unless it is understood that the dissipative term, g, is complex. In the limiting cases of either high or low pressures the imaginary part of g is negligible. The real and imaginary parts of g are evaluated for these limiting cases, for four different gases; air, helium, Maxwellian gas, and water. The real part of g is shown to be the average collision frequency multiplied by a numerical factor, the size of which depends on the nature of the gas and the pressure limit.

P. Molmud

1959-04-01T23:59:59.000Z

360

Slide 1  

NLE Websites -- All DOE Office Websites (Extended Search)

ARM-funded IOP Measurement Priorities ARM-funded IOP Measurement Priorities * Model Forcing Dataset Sounding network Appropriate for determining continuous forcing dataset * 4D Atmospheric state description Soundings (Array and soundings of opportunity) Radar Refractivity Surface Observations * 4D Cloud and Precipitation characteristics CASA, CIRPAS 9.4 Ghz Phased-Array, McGill scanning 94- GHz, ARM SBIR scanning 35-GHz * Updraft/Downdraft dynamics CASA, 915 MHz wind profilers, cloud radars Walt Petersen, GPM GV, MC3E , 23-24 February 2009, Norman, Oklahoma 6 NASA-Provided Infrastructure Ka-Ku Scanning Transportable Dual-Polarimetric Radar (dual-aperture) * Match DPR frequencies, direct link to PIA and dual-wavelength vs. dual-pol methods * Extension to clouds, light precipitation, and improved sampling of ice, snow, mixed phase

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Gravity-driven structures and rift basin evolution: Rio Muni Basin, offshore equatorial West Africa  

SciTech Connect

Offshore Equatorial Guinea, west Africa, gravity-driven nappes, more than 1 km thick and 15 km from head to toe, provide key evidence in reconstructing the late synrift: evolution of this part of the South Atlantic margin basin system. Furthermore, Aptian-Cenomanian carbonate and clastic rocks in the nappes` allochthonous hanging walls are attracting interest as a new exploration play in west Africa. The nappes exhibit a range of geometries that suggest they share many of the same deformation processes as thin-skin thrust and linked extensional fault systems. Not only are these structures significant in their own right, representing a rare example of gravity tectonics in the virtual absence of major halokinesis, but their presence may record an other-wise undetectable process active during the transition from a rift basin to a passive continental margin. A review of Equatorial Guinea in its pre-Atlantic configuration, alongside neighboring basins in Brazil (the Sergipe-Alagoas basin) and Gabon, suggests that gravity gliding was sustained by a relatively steep, westward paleoslope promoted by east-ward offset of the locus of thermal uplift from the rift basin (i.e., a simple shear model of basin formation). In contrast to gravity-driven structures in most postrift settings, the Equatorial Guinea nappes developed at the close of the Aptian-Albian synrift episode in response to a growing bathymetric deep caused by rapid subsidence outpacing restricted sedimentation.

Turner, J.P. [Univ. of Birmingham (United Kingdom)

1995-08-01T23:59:59.000Z

362

Light Curves of Dwarf Plutonian Planets and other Large Kuiper Belt Objects: Their Rotations, Phase Functions and Absolute Magnitudes  

E-Print Network (OSTI)

(Abridged) I report new light curves and determine the rotations and phase functions of several large Kuiper Belt objects, including the dwarf planet Eris (2003 UB313). (120348) 2004 TY364 shows a light curve which if double-peaked has a period of 11.70+-0.01 hours and peak-to-peak amplitude of 0.22+-0.02 magnitudes. (84922) 2003 VS2 has a well defined double-peaked light curve of 7.41+-0.02 hours with a 0.21+-0.02 magnitude range. (126154) 2001 YH140 shows variability of 0.21+-0.04 magnitudes with a possible 13.25+-0.2 hour single-peaked period. The seven new KBOs in the sample which show no discernible variations within the uncertainties on short rotational time scales are 2001 UQ18, (55565) 2002 AW197, (119979) 2002 WC19, (120132) 2003 FY128, (136108) Eris 2003 UB313, (90482) Orcus 2004 DW, and (90568) 2004 GV9. The three medium to large sized Kuiper Belt objects 2004 TY364, Orcus and 2004 GV9 show fairly steep linear phase curves (~0.18 to 0.26 mags per degree) between phase angles of 0.1 and 1.5 degrees. The extremely large dwarf planet Eris (2003 UB313) shows a shallower phase curve (0.09+-0.03 mags per degree) which is more similar to the other known dwarf planet Pluto. It appears the surface properties of the largest dwarf planets in the Kuiper Belt maybe different than the smaller Kuiper Belt objects. This may have to do with the larger objects ability to hold more volatile ices as well as sustain atmospheres. The absolute magnitudes obtained using the measured phase slopes are a few tenths of magnitudes different from those given by the MPC.

Scott S. Sheppard

2007-04-13T23:59:59.000Z

363

Transition from metallic to tunneling-type conductance in metal-metal and normal-metalsuperconductor point contacts  

Science Journals Connector (OSTI)

We have investigated the microshorttotunneling crossover in normal-normal (N-N) and normal-metalsuperconductor (N-S) point-contact junctions at 4.2 K as the junction conductance (G0) is varied. The microshort (or metallic) point contact with the dynamic conductance G (V) having a negative derivative with respect to bias V (i.e., ?G/?V0 when G0?35 mS. We show that this is the region where the contact radius ? is a few times kF-1 (kF is the Fermi wave vector) and the crossover in the sign of ?G/?V occurs due to electron confinement in a length scale comparable to kF-1. The effect of confinement is to make the electrons crossing the constriction evanescent in nature as the junction size is reduced progressively and the energy for lateral confinement becomes comparable to EF. We argue that in this extreme ballistic regime, the classical Sharvin approach breaks down as quantum effects due to electron confinement takes over. This happens much before single-atom contact is reached which signals the onset of vacuum tunneling. As a further test of the electron confinement effects in point contacts, we investigated clean N-S microshorts showing near-ideal Andreev reflection. We find that in N-S junctions, the Andreev reflection (which is a manifestation of superconductivity) gradually vanishes when the contact radius ??0.1? (? is the coherence length) and the energy cost of electron confinement is larger than the superconducting energy gap ?.

H. Srikanth and A. K. Raychaudhuri

1992-12-01T23:59:59.000Z

364

Global analysis of data on the spin-orbit-coupled A {sup 1{Sigma}}{sub u}{sup +} and b {sup 3{Pi}}{sub u} states of Cs{sub 2}  

SciTech Connect

We present experimentally derived potential curves and spin-orbit interaction functions for the strongly perturbed A {sup 1{Sigma}}{sub u}{sup +} and b {sup 3{Pi}}{sub u} states of the cesium dimer. The results are based on data from several sources. Laser-induced fluorescence Fourier transform spectroscopy (LIF FTS) was used some time ago in the Laboratoire Aime Cotton primarily to study the X {sup 1{Sigma}}{sub g}{sup +} state. More recent work at Tsinghua University provides information from moderate resolution spectroscopy on the lowest levels of the b {sup 3{Pi}}{sub 0u}{sup {+-}} state as well as additional high-resolution data. From Innsbruck University, we have precision data obtained with cold Cs{sub 2} molecules. Recent data from Temple University was obtained using the optical-optical double resonance polarization spectroscopy technique, and finally, a group at the University of Latvia has added additional LIF FTS data. In the Hamiltonian matrix, we have used analytic potentials (the expanded Morse oscillator form) with both finite-difference (FD) coupled-channel and discrete variable representation (DVR) calculations of the term values. Fitted diagonal and off-diagonal spin-orbit functions are obtained and compared with ab initio results from Temple and Moscow State universities.

Bai, Jianmei; Ahmed, E. H.; Beser, B.; Guan, Y.; Kotochigova, S.; Lyyra, A. M.; Ashman, S.; Wolfe, C. M.; Huennekens, J.; Xie, Feng; Li, Dan; Li, Li; Tamanis, M.; Ferber, R.; Drozdova, A.; Pazyuk, E.; Stolyarov, A. V.; Danzl, J. G.; Naegerl, H.-C.; Bouloufa, N. [Physics Department, Temple University, Philadelphia, Pennsylvania 19122 (United States); Department of Physics, Lehigh University, Bethlehem, Pennsylvania 18015 (United States); Department of Physics and Key Lab of Atomic and Molecular Nanoscience, Tsinghua University, Beijing 100084 (China); Laser Center, Department of Physics, University of Latvia, 19 Rains Blvd., Riga LV-1586 (Latvia); Department of Chemistry, Moscow State University, GSP-2 Leninskie gory 1/3, Moscow RU-119992 (Russian Federation); Institut fuer Experimentalphysik und Zentrum fuer Quantenphysik, Universitaet Innsbruck, Technikerstrasse 25, A-6020 Innsbruck (Austria); Laboratoire Aime Cotton, CNRS, Universite Paris-Sud, Bat. 505, F-91405 Orsay Cedex (France); Department of Physics and Astronomy, SUNY, Stony Brook, New York 11794-3800 (United States)

2011-03-15T23:59:59.000Z

365

Tenure in REDD | Open Energy Information  

Open Energy Info (EERE)

in REDD in REDD Jump to: navigation, search Name Tenure in REDD Agency/Company /Organization International Institute for Environment and Development Sector Land Focus Area Forestry Topics Implementation, Policies/deployment programs, Resource assessment, Background analysis Resource Type Presentation Website http://www.cbd.int/doc/meeting Country Brazil, Cameroon, Democratic Republic of Congo, Guyana, Indonesia, Malaysia, Papua New Guinea South America, Middle Africa, Middle Africa, South America, South-Eastern Asia, South-Eastern Asia, Melanesia References Tenure in REDD[1] Tenure in REDD Screenshot Background "This report aims to take the debate forward by identifying: a typology of tenure regimes in rainforest countries and some of the challenges they

366

Brief Report: Clinical Care of Two Patients with Ebola Virus Disease in the United States  

Science Journals Connector (OSTI)

...8 hours after the infusion of the monoclonal antibody cocktail. In addition, the extent of the rash decreased, and the patient reported that his energy level had increased to the point that he was able to walk. On day 10, he was transferred to the Serious Communicable Diseases Unit (SCDU) at Emory... The largest outbreak of EVD in history began in December 2013 in Guinea, a country in West Africa.1 By late March, Liberia had reported seven cases. By the end of May, the epidemic had spread to Sierra Leone. As of November 5, 2014, a total of 13,042 ...

2014-11-12T23:59:59.000Z

367

Taxonomic revision and phylogeny of the genus Cetiocyon and its discovery in the Neotropical region (Insecta: Coleoptera: Hydrophilidae)  

E-Print Network (OSTI)

, resulting in the fi rst record of the genus in the Neotropical Region and recognition of eight species in New Guinea. One new species, Cetiocyon incantatus new species, is described from Suriname, and four new species from the central mountain range of New... to as Gondwanan genera in recent papers (e.g., FIK?EK 2007, 2010) and its monophyly is currently tested (ongoing work by M. Fik?ek). In 2005, we discovered an aberrant specimen of Megasternini collected in Suriname. Although the spe- cies was clearly...

Fiká ?ek, Martin; Short, Andrew E. Z.

2010-03-11T23:59:59.000Z

368

An investigation of the potentiating effects of ethanol on a chronic exposure of rats to 1,1,1-trichloroethane  

E-Print Network (OSTI)

in industry is calcu- lated to be as high as 3't of the American working force (5&6&7). During the course of the experiment 350ppm 1, 1, 1- trichloroethane, the TLV& was administered through inhalation to rats 24 hours each day for 56 days. Ethanol... of 500 mg/kg to the skin of rabbits caused no effect other than reversible local irritation. A series of inhalation exposures was also conducted on various laboratory animals at 500& 1, 000, 2, 000 and 10, 000ppm. Rabbits, guinea pigs, rats...

Walker, DeWayne Harold

2012-06-07T23:59:59.000Z

369

The morphological and chemical characteristics of respirable mineral wool fibers  

E-Print Network (OSTI)

glass-plastic dust were published between 1955 and 1959, All four papers reported that fiber glass dust caused no 15-18 fibrosis in rats, guinea pigs, rabbi ts, and monkeys that inhaled or were injected intratracheally with the dust. However... reported that an1mal inhalation experiments using rats and 24 hamsters exposed to f1brous glass concentrat1ons of approximately 100 milligrams per cubic meter (mg/m ) for 24 months, had shown that 3 fibrous glass fibers were not cytotoxic...

Butler, Donnie Ray

2012-06-07T23:59:59.000Z

370

Clinical Illness and Outcomes in Patients with Ebola in Sierra Leone  

Science Journals Connector (OSTI)

...used Fisher's exact test to analyze hypotheses involving dichotomous variables. For cases in which a categorical variable was based on more than two categories, we used ordinary logistic regression to perform multiple comparisons. Hypotheses involving continuous variables were tested with the use of the... The largest and most widespread outbreak of Ebola virus disease (EVD) continues to spread through West Africa, with more than 10,100 cases reported in Guinea, Sierra Leone, Liberia, Senegal, Nigeria, and Mali as of October 25, 2014.1 The possibility of ...

2014-10-29T23:59:59.000Z

371

Brief Report: A Case of Severe Ebola Virus Infection Complicated by Gram-Negative Septicemia  

Science Journals Connector (OSTI)

...stool were already negative on the first day of testing (day 18). However, urine samples remained positive for EBOV RNA until day 30, and RNA extracts from sweat remained positive throughout the observation period until day 40. In addition, to test for the infectivity of the specimens in cell culture... Since December 2013, a Zaire ebolavirus (EBOV) epidemic of unprecedented scale has ravaged West Africa, with a focus on Guinea, Sierra Leone, and Liberia.14 The current epidemic has led to a public health emergency in the region, exacerbated by high ...

2014-10-22T23:59:59.000Z

372

Potential causes for slope instabilities of under-consolidated marine sediments  

SciTech Connect

Offshore studies have been completed in the Gulf of Guinea, off West Africa. An area has been selected over the Gabon continental slope. A morpho-sedimentological zonation is made regarding acoustic data and geotechnical characteristics of sampled sediments. An old slide has been considered as a criteria for estimating realistic slope failure conditions. Both drained and undrained formulations tend to prove that fluid escape is the most realistic explanation for slides occurrence. Regional hazard charts also allow them to present unstable zones and build up criteria for structures implantation.

Quemeneur, P.; Tisot, J.P. [ENSG, Vandoeuvre-les-Nancy (France). Laboratoire de Geomecanique; Cochonat, P.; Bourillet, J.F.; d`Oultremont, V. [IFREMER, Plouzane (France); Colliat, J.L.; Tofani, R. [Elf Aquitaine Production, Pau (France)

1995-12-31T23:59:59.000Z

373

A toxological study of 3,6-BIS(3,5-Dimethyl-1-1-Pyrazolyl)1,2-Dihydro-1,2,4,5-Tetrazine  

SciTech Connect

The acute oral LD[sub 30/50] values for 3,6-BIS(3,5-Dimethyl-1-Pyrazolyl)-1,2-Dihydro-1,2,4,5-Tetrazine BIS(DMP)DHT are greater than 5g/kg. According to classical guidelines, the material would be considered only slightly toxic or practically nontoxic in both rats and mice. The sensitization study in the guinea pig did not show BIS(DMP)SHT to have potential sensitizing effects. Skin application studies on the rabbit demonstrated the material was cutaneously nonirritating. This material was also nonirritating in the rabbit eye application studies.

London, J.E.

1993-03-01T23:59:59.000Z

374

A toxological study of 3,6-BIS(3,5-Dimethyl-1-1-Pyrazolyl)1,2-Dihydro-1,2,4,5-Tetrazine  

SciTech Connect

The acute oral LD{sub 30/50} values for 3,6-BIS(3,5-Dimethyl-1-Pyrazolyl)-1,2-Dihydro-1,2,4,5-Tetrazine BIS(DMP)DHT are greater than 5g/kg. According to classical guidelines, the material would be considered only slightly toxic or practically nontoxic in both rats and mice. The sensitization study in the guinea pig did not show BIS(DMP)SHT to have potential sensitizing effects. Skin application studies on the rabbit demonstrated the material was cutaneously nonirritating. This material was also nonirritating in the rabbit eye application studies.

London, J.E.

1993-03-01T23:59:59.000Z

375

Incidence-Males Incidence-Females All sites but skin (All ages)  

E-Print Network (OSTI)

.6 123.2 7.2 64 2764 72.4 116.6 8.0 76 3065 Congo Brazzaville 41.0 64.9 4.4 39 644 59.9 88.1 6.6 61 980 Congo 81.8 154.6 9.2 85 22100 75.7 125.1 8.6 83 20764 *Equatorial Guinea 76.4 124.4 7.3 63 182 80.0 115

Barthelat, Francois

376

Podnahz  

E-Print Network (OSTI)

se" - a $2.50 guinea Pia: disguised a.e a ehinch1l1a ? A The oldest adolescent and his l etter jacket. e The efficient . buffalo gun. YOU'll see dayllght through the average criminal. J"1?D~ C The status symbol memoria 1 . fishing...-bean 50U\\ to raise tl ,mt e. Clam chowder. \\.]111 - cut a game of hide-and-seek short. - physique went to ourth season .. ----- ---- PODNAHZ Su.rsky & Hutch 6 The Sound of Distant Drums by Teri White fWith drums and guns And guns and drums...

Multiple Contributors

1996-01-01T23:59:59.000Z

377

Asian Development Outlook 2010 | Open Energy Information  

Open Energy Info (EERE)

Asian Development Outlook 2010 Asian Development Outlook 2010 Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Asian Development Outlook 2010: Macroeconomic Management Beyond the Crisis Agency/Company /Organization: Asian Development Bank Sector: Energy Topics: Market analysis, Resource assessment Resource Type: Publications Website: www.adb.org/Documents/Books/ADO/2010/ado2010.pdf Country: Armenia, Azerbaijan, Georgia (country), Kazakhstan, Kyrgyzstan, Tajikistan, Turkmenistan, Uzbekistan, China, South Korea, Mongolia, Afghanistan, Bangladesh, Bhutan, India, Maldives, Pakistan, Sri Lanka, Nepal, Cambodia, Indonesia, Malaysia, Laos, Vietnam, Singapore, Thailand, Philippines, Myanmar, Fiji, Papua New Guinea, Timor-Leste UN Region: Central Asia, Eastern Asia, South-Eastern Asia

378

ClimateWorks Low Carbon Growth Planning Support | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search Jump to: navigation, search Name Low Carbon Growth Planning Support Agency/Company /Organization ClimateWorks, Project Catalyst, McKinsey and Company Sector Energy, Land Topics Background analysis, Low emission development planning, Policies/deployment programs Country Brazil, China, Democratic Republic of Congo, Egypt, Ethiopia, Guyana, India, Indonesia, Kenya, Malaysia, Mexico, Papua New Guinea South America, Eastern Asia, Middle Africa, Northern Africa, Eastern Africa, South America, Southern Asia, South-Eastern Asia, Eastern Africa, South-Eastern Asia, Central America, Melanesia References LCGP support[1] Low Carbon Growth Plans Advancing Good Practice, August 2009[2] Overview "Achieving development goals depends on enabling poorer countries to

379

An electron microscopy study of ground-nut poisoning in turkey poults  

E-Print Network (OSTI)

condition. Similar toxic effects in ducklings, chickens, rats, guinea pigs, cows and pigs have also been reported. In general, there is little available information about how and where tbe toxic principles of any kind act in the cells structures. Also... an interpretation of the most significant ultrastructure changes, which sre found in liver cells 1n experimental poults on tox1c Brasilian ground-nut meal, and to correlate the observed change in ultrastructura with the ultrastructure of normal poults anc ~1th...

Martin, Alcides Amilcar

2012-06-07T23:59:59.000Z

380

Studies of leukemia and thyroid disease among Chernobyl clean-up workers from the Baltics  

SciTech Connect

Following the reactor accident at Chernobyl in late April of 1986, hundreds of thousands of men from throughout the former Soviet Union were sent to Chernobyl to entomb the damaged reactor, remove radioactive debris, and help decontaminate the local environment. They remained for an average of three months and were allowed to accumulate up to 25 cGy of radiation before being sent home. Doses for some workers may have exceeded the allowable limit. The experience of Chernobyl clean-up workers is potentially informative about cancer risk associated with protracted exposure to low levels of radiation. Cohorts of clean-up workers from the Baltic Republics were assembled for study, based on military records and other lists. The study population includes 4,833 men from Estonia 5,709 from Latvia and at least 5,446 from Lithuania, where a pilot study is underway. They are being monitored for cancer incidence through linkages with the corresponding national cancer registries. Biodosimetric assays, including fluorescent in situ hybridization (FISH) for chromosome translocation analysis and the glycophorin A (GPA) somatic cell mutation assay, are being used to supplement information about radiation doses from worker records and questionnaires. Thyroid screening examinations, including palpation, ultrasound and, selectively, fine-needle aspiration biopsies were performed on nearly 2,000 workers in the Estonian cohort (mean age, 40 y) during the spring of 1995, nine years after the reactor accident. The study is still in progress. Work began first in Estonia, and results presented here pertain to this subgroup except as otherwise noted. The average age at the time of arrival at Chernobyl was 31 years. 62% were sent in 1986. Possible reasons for the apparent absence or rarity of radiation-induced thyroid nodules include low and protracted doses, low susceptibility among men exposed as adults, and insufficient passage of time since the accident.

Inskip, P.D. [National Cancer Institute, Rockville, MD (United States); Tekkel, M.; Rahu, M. [Institute of Experimental and Clinical Medicine, Tallinn (Estonia)] [and others

1997-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Sustainable energy in Baltic States  

Science Journals Connector (OSTI)

Integration of New Member States to the European Union has created a new situation in the frame of implementation of the Lisbon strategy and EU Sustainable Development. The closure of Ignalina NPP is the biggest challenge to the energy sector development of the Baltic States. The Baltic States have quite limited own energy resources and in the Accession agreement with the EU Lithuania, Latvia and Estonia have verified their targets to increase the share of electricity produced from renewable energy sources (RES-E) by the year 2010. A wider use of renewable energy and increase of energy efficiency can make a valuable contribution to meeting the targets of sustainable development. The article presents a detailed overview of the present policies and measures implemented in the Baltic States, aiming to support the use of RES and the increase of energy efficiency. The review of possibilities to use the EU Structural Funds (SF) for the implementation of sustainable energy projects in the Baltic States was performed.The use of regional socialeconomicenvironmental indicators is the main key to integrate sustainable energy development at the program deployment level. The indicators to be used should describe the contribution of energy programs to the sustainable development, medium- and long-term trends and inter-relationship between them and the typical energy indicators (saved toe, improved energy efficiency, percentage of RES). Municipalities may play a considerable role by promoting sustainable energy since local authorities are fulfilling their functions in the energy sector via a number of roles. The Netherlands example shows that municipalities may act as facilitators by implementing national environmental policy and increasing energy efficiency in an integral part of these activities. The guidelines for Lithuanian local sustainable energy development using the SF co-financing have been presented.

Valentinas Klevas; Dalia Streimikiene; Ramute Grikstaite

2007-01-01T23:59:59.000Z

382

Poverty and Forests Linkages | Open Energy Information  

Open Energy Info (EERE)

Poverty and Forests Linkages Poverty and Forests Linkages Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Poverty and Forests Linkages Agency/Company /Organization: World Bank Partner: Program on Forests Sector: Land Focus Area: Forestry Topics: Co-benefits assessment, Background analysis Resource Type: Publications, Lessons learned/best practices Website: www.profor.info/profor/Documents/pdf/livelihoods/PovertyForestsLinkage Country: India, Nepal, Papua New Guinea, Guinea, Laos, Tanzania Southern Asia, Southern Asia, Melanesia, Western Africa, South-Eastern Asia, Eastern Africa Coordinates: 28.86°, 81.56° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":28.86,"lon":81.56,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

383

Chimeric human parainfluenza virus bearing the Ebola virus glycoprotein as the sole surface protein is immunogenic and highly protective against Ebola virus challenge  

SciTech Connect

We generated a new live-attenuated vaccine against Ebola virus (EBOV) based on a chimeric virus HPIV3/{delta}F-HN/EboGP that contains the EBOV glycoprotein (GP) as the sole transmembrane envelope protein combined with the internal proteins of human parainfluenza virus type 3 (HPIV3). Electron microscopy analysis of the virus particles showed that they have an envelope and surface spikes resembling those of EBOV and a particle size and shape resembling those of HPIV3. When HPIV3/{delta}F-HN/EboGP was inoculated via apical surface of an in vitro model of human ciliated airway epithelium, the virus was released from the apical surface; when applied to basolateral surface, the virus infected basolateral cells but did not spread through the tissue. Following intranasal (IN) inoculation of guinea pigs, scattered infected cells were detected in the lungs by immunohistochemistry, but infectious HPIV3/{delta}F-HN/EboGP could not be recovered from the lungs, blood, or other tissues. Despite the attenuation, the virus was highly immunogenic, and a single IN dose completely protected the animals against a highly lethal intraperitoneal challenge of guinea pig-adapted EBOV.

Bukreyev, Alexander [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)], E-mail: abukreyev@nih.gov; Marzi, Andrea; Feldmann, Friederike [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Zhang Liqun [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Yang Lijuan; Ward, Jerrold M. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Dorward, David W. [Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Hamilton, Montana (United States); Pickles, Raymond J. [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Murphy, Brian R. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Feldmann, Heinz [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Department of Medical Microbiology, University of Manitoba (Canada); Collins, Peter L. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)

2009-01-20T23:59:59.000Z

384

Geology of the Douala basin, offshore Cameroon, West Africa  

SciTech Connect

The Douala basin is predominantly an offshore basin extending from the Cameroon volcanic line in the north to the Corisco arch in the south near the Equatorial Guinea-Gabon border. The basin lies wholly within the territorial borders of Cameroon and Equatorial Guinea. The Douala basin is one of a series of divergent margin basins occurring along the southwest African coastline resulting from the rifting of Africa from South America. Continental rifting in the Doula basin was initiated at least by Aptian-Albian time and possibly as early as Jurassic. The rift stage persisted until Albian time when the onset of drifting occurred. The sedimentary section in the basin has a maximum thickness of 8-10 km, based on exploration drilling and gravity and magnetics modeling. The synrift section consists of Aptian-Albian sands and shales, deposited primarily as submarine fans, fan-deltas, and turbidite deposits. These are overlain by salt, thought to be equivalent to the Ezagna salt of Aptian age in the Gabon basin to the south. The synrift section is separated from the overlying postrift shale sequence of Late Cretaceous and Tertiary age by a major late Albian unconformity. The Douala basin has been explored for hydrocarbons intermittently over the last 25 years. Results show a distinct tendency for gas-proneness. The largest field recorded to date is the Sanaga Sud gas field, discovered in 1979, offshore, near the coastal city of Kribi.

Pauken, R.J.; Thompson, J.M.; Schumann, J.R. (Mobil New Exploration Ventures Co., Dallas, TX (United States)); Cooke, J.C. (Mobil Exploration and Production Services Inc., Dallas, TX (United States))

1991-03-01T23:59:59.000Z

385

DOE Roadmap: Chapter 3  

NLE Websites -- All DOE Office Websites (Extended Search)

3. Human Radiation Experiments Associated With DOE and Its Predecessors 3. Human Radiation Experiments Associated With DOE and Its Predecessors Introduction This section contains a listing, description, and selected references for documented human radiation experiments sponsored, supported, or performed by the Department of Energy or its predecessors. The list represents work completed by the Office of Human Radiation Experiments through December 1994, and is a work in progress. Additional experiments will be added as they are identified, documented, and confirmed. The experiment list is available on the Internet and will be updated over time. This list includes experiments released at Secretary O'Leary's June 1994 press conference, as well as additional studies identified during the six months that followed. Cross-references are provided for experiments originally released at the press conference. Some of the 48 experiments released in June 1994 are not listed here, as continuing research is necessary. In the interest of assembling the most comprehensive information possible, a list of experiments described in the 1986 congressional report entitled American Nuclear Guinea Pigs: Three Decades of Radiation Experiments on U.S. Citizens is provided as an appendix. It should be noted that information about some studies in American Nuclear Guinea Pigs has been updated and included in the current DOE list; further update efforts are ongoing.

386

wprime_s056210-web.dvi  

NLE Websites -- All DOE Office Websites (Extended Search)

May May 2012 by G. Brooijmans (Columbia University), M.-C. Chen (UC Irvine) and B.A. Dobrescu (Fermilab). The W ' boson is a hypothetical massive particle of electric charge ±1 and spin 1, which is predicted in various extensions of the Standard Model. W ' couplings to quarks and leptons. The Lagrangian terms describing couplings of a W '+ boson to fermions are given by W '+ µ √ 2 u i C R q ij P R +C L q ij P L γ µ d j +ν i C R l ij P R +C L l ij P L γ µ e j . (1) Here u, d, ν and e are the Standard Model fermions in the mass eigenstate basis, i, j = 1, 2, 3 label the fermion generation, and P R,L = (1 ± γ 5 )/2. The coefficients C L q ij , C R q ij , C L l ij , C R l ij are complex dimensionless parameters. If C R l ij = 0, then the ith generation includes a right-handed neutrino. Using this notation, the Standard Model W couplings are C L q = gV CKM , C L l = g and C R q = C R l = 0. Unitarity considerations imply that the W ' is a gauge boson

387

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays. Results from AMS-01  

E-Print Network (OSTI)

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper the relative abundances of the light nuclei lithium, beryllium, boron and carbon are presented. The secondary to primary ratios Li/C, Be/C and B/C have been measured in the kinetic energy range 0.35-45 GeV/nucleon. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3 GV. The secondary to secondary ratios Li/Be, Li/B and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model....

Aguilar, M; Allaby, J; Alpat, B; Ambrosi, G; Anderhub, H; Ao, L; Arefiev, A; Arruda, L; Azzarello, P; Basile, M; Barao, F; Barreira, G; Vartoloni, A; Battiston, R; Becker, R; Becker, U; Bellagamba, L; Bene, P; Berdugo, J; Berges, P; Bertucci, B; Biland, A; Bindi, V; Boella, G; Boschini, M; Bourquin, M; Bruni, G; Buenerd, M; Burger, J D; Burger, W J; Cai, X D; Cannarsa, P; Capell, M; Casadei, D; Casaus, J; Castellini, G; Cernuda, I; Chang, Y H; Chen, H F; Chen, H S; Chen, Z G; Chernoplekov, N A; Chiueh, T H; Choi, Y Y; Cindolo, F; Commichau, V; Contin, A; Cortina-Gil, E; Crespo, D; Cristinziani, M; Dai, T S; Dela Guia, C; Delgado, C; Di Falco, S; Djambazov, L; D'Antoine, I; Dong, Z R; Duranti, M; Engelberg, J; Eppling, F J; Eronen, T; Extermann, P; Favier, J; Fiandrini, E; Fisher, P H; Flugge, G; Fouque, N; Galaktionov, Y; Gervasi, M; Giovacchini, F; Giusti, P; Grandi, D; Grimm, O; Gu, W Q; Haino, S; Hangarter, K; Hasan, A; Hermel, V; Hofer, H; Hungerford, W; Ionica, M; Jongmanns, M; Karlamaa, K; Karpinski, W; Kenney, G; Kim, D H; Kim, G N; Kim, K S; Kirn, T; Klimentov, A; Kossakowski, R; Kounine, A; Koutsenko, V; Kraeber, M; Laborie, G; Laitinen, T; Lamanna, G; Laurenti, G; Lebedev, A; Lechanoine-Leluc, C; Lee, M W; Lee, S C; Levi, G; Lin, C H; Liu, H T; Lu, G; Lubelsmeyer, K; Luckey, D; Lustermann, W; Mana, C; Margotti, A; Mayet, F; McNeil, R R; Menichelli, M; Mihul, A; Mujunen, A; Oliva, A; Palmonari, F; Park, H B; Park, W H; Pauluzzi, M; Pauss, F; Pereira, R; Perrin, E; Pevsner, A; Pilo, F; Pimenta, M; Plyaskin, V; Pojidaev, V; Pohl, M; Produit, N; Quadrani, L; Rancoita, P G; Rapin, D; Ren, D; Ren, Z; Ribordy, M; Richeux, J P; Riihonen, E; Ritakari, J; Ro, S; Roeser, U; Sagdeev, R; Santos, D; Sartorelli, G; Sbarra, C; Schael, S; Schultz von Dratzig, A; Schwering, G; Seo, E S; Shin, J W; Shoumilov, E; Shoutko, V; Siedenburg, T; Siedling, R; Son, D; Song, T; Spada, F R; Spinella, F; Steuer, M; Sun, G S; Suter, H; Tang, X W; Ting, Samuel C C; Ting, S M; Tomassetti, N; Tornikoski, M; Torsti, J; Trumper, J; Ulbricht, J; Urpo, S; Valtonen, E; Vandenhirtz, J; Velikhov, E; Verlaat, B; Vetlitsky, I; Vezzu, F; Vialle, J P; Viertel, G; Vite, D; Von Gunten, H; Waldmeier Wicki, S; Wallraff, W; Wang, J Z; Wiik, K; Williams, C; Wu, S X; Xia, P C; Xu, S; Xu, Z Z; Yan, J L; Yan, L G; Yang, C G; Yang, J; Yang, M; Ye, S W; Zhang, H Y; Zhang, Z P; Zhao, D X; Zhou, F; Zhou, Y; Zhu, G Y; Zhu, W Z; Zhuang, H L; Zichichi, A; Zimmermann, B; Zuccon, P

2010-01-01T23:59:59.000Z

388

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays. Results from AMS-01  

E-Print Network (OSTI)

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper the relative abundances of the light nuclei lithium, beryllium, boron and carbon are presented. The secondary to primary ratios Li/C, Be/C and B/C have been measured in the kinetic energy range 0.35-45 GeV/nucleon. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3 GV. The secondary to secondary ratios Li/Be, Li/B and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model. A 10-15% overproduction of Be is found in the model predictions and can be attributed to uncertainties in the production cross-section data.

The AMS-01 Collaboration

2010-08-30T23:59:59.000Z

389

X-ray driven channeling acceleration in crystals and carbon nanotubes  

SciTech Connect

Acceleration of particles channeling in a crystal by means of diffracted x-rays via Bormann anomalous transmission was conceived for heavy ions and muons by Tajima and Cavenago [Phys. Rev. Lett. 59, 1440 (1987)], which potentially offers an appreciably high field gradient on the order of GV/cm. The theoretical model of the high gradient acceleration has been studied in two kinds of atomic structure, crystals and carbon nanotubes (CNTs), with analytic calculations and electromagnetic eigenmode simulations. A range of acceleration gradients and cutoffs of the x-ray power (the lowest power limit to overcome the Bremsstrahlung radiation losses) are characterized in terms of the lattice constants, unit cell sizes, and photon energies. The parametric analysis indicates that the required x-ray power can be reduced to an order of megawatt by replacing crystals with CNTs. Eventually, the equivalent dielectric approximation of a multi-wall nanotube shows that 250810 MeV muons can be synchronously coupled with x-rays of 0.651.32 keV in the accelerating structure.

Shin, Young-Min [Department of Physics, Northern Illinois Center for Accelerator and Detector Development (NICADD), Northern Illinois University, Dekalb, Illinois 60115 (United States) [Department of Physics, Northern Illinois Center for Accelerator and Detector Development (NICADD), Northern Illinois University, Dekalb, Illinois 60115 (United States); Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States); Still, Dean A.; Shiltsev, Vladimir [Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States)] [Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States)

2013-12-15T23:59:59.000Z

390

An asymmetric emittance electron source for the GALAXIE dielectric-laser accelerator injector  

SciTech Connect

The GALAXIE project is a program to develop an all-optical, very high field accelerator and undulator integrated SASE FEL system based on dielectric laser-excited structures that support >GV/m fields. These structures are very wide in one direction to allow adequate charge given beam loading considerations, but also having small (subwavelength) apertures in the narrow direction. Such small vertical dimensions yield strict restrictions on the emittance in this direction, while no such constraint exists in the wide transverse direction. However, the overall beam brightness is restricted by the performance requirements on the FEL. To meet these demands, we are studying a very high field gun with a magnetized cathode, yielding a beam with angular momentum content. This beam is then subject to a skew-quad triplet that splits the emittances; this process is reversed to give a round beam after acceleration. This symmetric emittance beam avoids gain-degrading multiple-transverse-mode operation of the FEL, which also demands that the effects of the angular momentum in the beam be mitigated. In this paper we discuss the RF design of an X-band gun to be operated at {approx}200 MV/m peak field giving a 1 pC magnetized beam with unprecedented brightness. We examine the design of the focusing and skew-quad systems, investigating the associated beam dynamics and efficacy of emittance splitting.

Valloni, A.; Cahill, A.; Fukusawa, A.; Musumeci, P.; Spataro, B.; Yakub, A.; Rosenzweig, J. B. [Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States); Accelerator Division, Laboratori Nazionali di Frascati (INFN-LNF), Via E. Fermi 40, Frascati (RM) 00044 (Italy); Dept. of Physics and Astronomy, University of California, Los Angeles, 405 Hilgard Ave., Los Angeles, CA 90034 (United States)

2012-12-21T23:59:59.000Z

391

Study of laser plasma interactions in the relativistic regime  

SciTech Connect

We discuss the first experimental demonstration of electron acceleration by a laser wakefield over instances greater than a Rayleigh range (or the distance a laser normally propagates in vacuum). A self-modulated laser wakefield plasma wave is shown to have a field gradient that exceeds that of an RF linac by four orders of magnitude (E => 200 GV/m) and accelerates electrons with over 1-nC of charge per bunch in a beam with space-charge-limited emittance (1 mm-mrad). Above a laser power threshold, a plasma channel, created by the intense ultrashort laser pulse (I approx. 4 x1018 W/CM2, gamma = 1 micron, r = 400 fs), was found to increase the laser propagation distance, decrease the electron beam divergence, and increase the electron energy. The plasma wave, directly measured with coherent Thomson scattering is shown to damp-due to beam loading-in a duration of 1.5 ps or approx. 100 plasma periods. These results may have important implications for the proposed fast ignitor concept.

Umstadter, D.

1997-08-13T23:59:59.000Z

392

Evidences of high energy protons with energies beyond 0.4 GeV in the solar particle spectrum as responsible for the cosmic rays solar diurnal anisotropy  

E-Print Network (OSTI)

Analysis on the daily variations of cosmic ray muons with $E_{\\mu}\\geq 0.2 GeV$ based on the data of two directional muon telescopes at sea level and with a rigidity of response to cosmic proton spectrum above 0.4 GV is presented. The analysis covers two months of observations and in 60% of days, abrupt transitions between a low to a high muon intensity and vice-verse is observed, the period of high muon intensity is from $\\sim 8.0h$ up to $\\sim 19.0h$ (local time) and coincides with the period when the interplanetary magnetic field (IMF) lines overtake the Earth. This behavior strongly suggest that the high muon intensity is due to a contribution of solar protons (ions) on the muon intensity produced by the galactic cosmic rays, responsible for the low muon intensity. This implies that the solar particle spectrum extends to energies beyond 1 GeV. We show that this picture can explain the solar daily variation origin, and it is a most accurate scenario than the assumption of corotating galactic cosmic ray with the IMF lines, specially in the high rigidity region. Obtained results are consistent with the data reported in others papers. Some aspects on the sensitivity of our muon telescopes are also presented.

C. E. Navia; C. R. A. Augusto; M. B. Robba; K. H. Tsui

2007-06-26T23:59:59.000Z

393

A study of the influence of vitamins, antibiotics and amino acids in the diet on the amino acid content of the plasma of chicks  

E-Print Network (OSTI)

'ead of Department ^Student Advisor) TUDO F HEINL CV EM, BPVKI,Ph, CV eBEFsBPHi FPEBbBCEBhH FPN FsBPC FhBNH BP EM, NB,E Cy EM, FsBPC FhBN hCPE,PE CV EM, nKFHsF CV hMBhyH F EG.lal AS Kocc kp brvordt( ac HfmAa}}.' }d }G. k^v'fv}. HtGddr du }G. F)^atfr}f^vr vc...' s.tGvcatvr hdrr.). du E.7vl ac ?v^}avr ufruarrA.c} du }G. ^.wfa^.A.c}l ud^ }G. '.)^.. du NChECg CV nMBKCHCnML TUDO badtG.Aal}^o vc' Pf}^a}adc FhyPCo?K,Nk,s,PEH EG. vf}Gd^ 1alG.l }d .7?^.ll Gal v??^.tav}adc vc' }Gvc(l }d Kp gp gatGv^'ldc ud^ Gal...

Blaylock, Lynn

2013-10-04T23:59:59.000Z

394

Relative Composition and Energy Spectra of Light Nuclei in Cosmic Rays: Results from AMS-01  

Science Journals Connector (OSTI)

Measurement of the chemical and isotopic composition of cosmic rays is essential for the precise understanding of their propagation in the galaxy. While the model parameters are mainly determined using the B/C ratio, the study of extended sets of ratios can provide stronger constraints on the propagation models. In this paper, the relative abundances of light-nuclei lithium, beryllium, boron, and carbon are presented. The secondary-to-primary ratios Li/C, Be/C, and B/C have been measured in the kinetic energy range 0.35-45GeVnucleon1. The isotopic ratio 7Li/6Li is also determined in the magnetic rigidity interval 2.5-6.3GV. The secondary-to-secondary ratios Li/Be, Li/B, and Be/B are also reported. These measurements are based on the data collected by the Alpha Magnetic Spectrometer AMS-01 during the STS-91 space shuttle flight in 1998 June. Our experimental results are in substantial agreement with other measurements, where they exist. We describe our light-nuclei data with a diffusive-reacceleration model. A 10%-15% overproduction of Be is found in the model predictions and can be attributed to uncertainties in the production cross-section data.

M. Aguilar; J. Alcaraz; J. Allaby; B. Alpat; G. Ambrosi; H. Anderhub; L. Ao; A. Arefiev; L. Arruda; P. Azzarello; M. Basile; F. Barao; G. Barreira; A. Bartoloni; R. Battiston; R. Becker; U. Becker; L. Bellagamba; P. Bn; J. Berdugo; P. Berges; B. Bertucci; A. Biland; V. Bindi; G. Boella; M. Boschini; M. Bourquin; G. Bruni; M. Bunerd; J. D. Burger; W. J. Burger; X. D. Cai; P. Cannarsa; M. Capell; D. Casadei; J. Casaus; G. Castellini; I. Cernuda; Y. H. Chang; H. F. Chen; H. S. Chen; Z. G. Chen; N. A. Chernoplekov; T. H. Chiueh; Y. Y. Choi; F. Cindolo; V. Commichau; A. Contin; E. Cortina-Gil; D. Crespo; M. Cristinziani; T. S. Dai; C. dela Guia; C. Delgado; S. Di Falco; L. Djambazov; I. D'Antone; Z. R. Dong; M. Duranti; J. Engelberg; F. J. Eppling; T. Eronen; P. Extermann; J. Favier; E. Fiandrini; P. H. Fisher; G. Flgge; N. Fouque; Y. Galaktionov; M. Gervasi; F. Giovacchini; P. Giusti; D. Grandi; O. Grimm; W. Q. Gu; S. Haino; K. Hangarter; A. Hasan; V. Hermel; H. Hofer; W. Hungerford; M. Ionica; M. Jongmanns; K. Karlamaa; W. Karpinski; G. Kenney; D. H. Kim; G. N. Kim; K. S. Kim; T. Kirn; A. Klimentov; R. Kossakowski; A. Kounine; V. Koutsenko; M. Kraeber; G. Laborie; T. Laitinen; G. Lamanna; G. Laurenti; A. Lebedev; C. Lechanoine-Leluc; M. W. Lee; S. C. Lee; G. Levi; C. H. Lin; H. T. Liu; G. Lu; Y. S. Lu; K. Lbelsmeyer; D. Luckey; W. Lustermann; C. Maa; A. Margotti; F. Mayet; R. R. McNeil; M. Menichelli; A. Mihul; A. Mujunen; A. Oliva; F. Palmonari; H. B. Park; W. H. Park; M. Pauluzzi; F. Pauss; R. Pereira; E. Perrin; A. Pevsner; F. Pilo; M. Pimenta; V. Plyaskin; V. Pojidaev; M. Pohl; N. Produit; L. Quadrani; P. G. Rancoita; D. Rapin; D. Ren; Z. Ren; M. Ribordy; J. P. Richeux; E. Riihonen; J. Ritakari; S. Ro; U. Roeser; R. Sagdeev; D. Santos; G. Sartorelli; C. Sbarra; S. Schael; A. Schultz von Dratzig; G. Schwering; E. S. Seo; J. W. Shin; E. Shoumilov; V. Shoutko; T. Siedenburg; R. Siedling; D. Son; T. Song; F. R. Spada; F. Spinella; M. Steuer; G. S. Sun; H. Suter; X. W. Tang; Samuel C. C. Ting; S. M. Ting; N. Tomassetti; M. Tornikoski; J. Torsti; J. Trmper; J. Ulbricht; S. Urpo; E. Valtonen; J. Vandenhirtz; E. Velikhov; B. Verlaat; I. Vetlitsky; F. Vezzu; J. P. Vialle; G. Viertel; D. Vit; H. Von Gunten; S. Waldmeier Wicki; W. Wallraff; J. Z. Wang; K. Wiik; C. Williams; S. X. Wu; P. C. Xia; S. Xu; Z. Z. Xu; J. L. Yan; L. G. Yan; C. G. Yang; J. Yang; M. Yang; S. W. Ye; H. Y. Zhang; Z. P. Zhang; D. X. Zhao; F. Zhou; Y. Zhou; G. Y. Zhu; W. Z. Zhu; H. L. Zhuang; A. Zichichi; B. Zimmermann; P. Zuccon

2010-01-01T23:59:59.000Z

395

Muon Capture in Gaseous Hydrogen  

Science Journals Connector (OSTI)

An experiment to measure the muon nuclear capture rate in ultrapure gaseous hydrogen (8 atm, 293K) has been performed using a special target in which a system of gas proportional counters, working with the pure hydrogen of the target itself, were operating. Neutrons from the capture reactions were detected using a scintillation-counter technique, and the ?-ray background was eliminated by pulse-shape discrimination. The working conditions ensured that the captures were taking place in ?p atomic systems in a singlet total-spin state. The experimental result is ?expt=65157 sec-1, which has to be compared with the theoretical rate ?s,theor=62626 sec-1. From the experimental capture rate, and within the framework of the currently accepted theory, we have obtained for the induced pseudoscalar coupling constant gp=(-7.33.7)gV. The results of the present experiment are analyzed, together with results obtained from stopping negative muons in liquid hydrogen.

A. Alberigi Quaranta; A. Bertin; G. Matone; F. Palmonari; G. Torelli; P. Dalpiaz; A. Placci; E. Zavattini

1969-01-25T23:59:59.000Z

396

Recent Advances in Plasma Acceleration  

SciTech Connect

The costs and the time scales of colliders intended to reach the energy frontier are such that it is important to explore new methods of accelerating particles to high energies. Plasma-based accelerators are particularly attractive because they are capable of producing accelerating fields that are orders of magnitude larger than those used in conventional colliders. In these accelerators a drive beam, either laser or particle, produces a plasma wave (wakefield) that accelerates charged particles. The ultimate utility of plasma accelerators will depend on sustaining ultra-high accelerating fields over a substantial length to achieve a significant energy gain. More than 42 GeV energy gain was achieved in an 85 cm long plasma wakefield accelerator driven by a 42 GeV electron drive beam in the Final Focus Test Beam (FFTB) Facility at SLAC. Most of the beam electrons lose energy to the plasma wave, but some electrons in the back of the same beam pulse are accelerated with a field of {approx}52 GV/m. This effectively doubles their energy, producing the energy gain of the 3 km long SLAC accelerator in less than a meter for a small fraction of the electrons in the injected bunch. Prospects for a drive-witness bunch configuration and high-gradient positron acceleration experiments planned for the SABER facility will be discussed.

Hogan, Mark

2007-03-19T23:59:59.000Z

397

Ecological factors affecting growth and formation of sclerotia in Sclerotium rolfsii  

E-Print Network (OSTI)

L I B R A R Y A ft M COLLEGE OF TEXAS AftMtCOfLM ELfGFAT LXXAfGOSC CPtaG; LSe gtPcLGOtS tX TfMAhtGOL OP TfGiGAcurGGG2I PtMGTnn osg StAcLS el XMLetT L e2ddpgv*v2lr T3o02vvp! vl vHp Cg*!3*vp TJHll- lI vHp Lmg2J3-v3g*- *r! cpJH*r2J*- fl--pmp l...I GpD*d 2r 5*gv2*- I3-I2--0prv lI vHp gp132gp0prvd Ilg vHp !pmgpp lI etfGth t. .;OMtTt.;4 c*6 8)7? c*slg T3ospJv, .-*rv .*vHl-lm6 MOPhLh4

Flados, Norman D.

2013-10-04T23:59:59.000Z

398

A study of conception rates resulting from natural and artificial breeding of dairy cattle in Texas  

E-Print Network (OSTI)

? CCG89p-KXXt ji8X'ge't 8 4X"~ pt85CQ't sty:"M (Q) N8888X'L8$Cj vjt9 &ptttjXljeiLOXt8 ping'? Azmef. M Nm xt't 88888in X~z&88&81 RreeM@g P~ytx8 . , 'iitxt . 'txteett~ PA 48 Sag hatt 3, X+g, 8Xt8 f888 m~t Xg~ 294$ 'CXt QX8t~jtey Q? lQV, XA 'M ~i "8G...~33 'R, + gQ~QQ 6s. ? 5455 Q~, M 6g. & Wa Y9 5&~ ~9 Ui3& vp. M &6, 6'7 V2 y97 VQ~QV 78m, gV 6QyQg V2, N 27 I ZP M 83 B. ~J)8 TAKE XX 6 CG;K&~~ QF P% CERT RN-RET~ SY-~88 FUR CERTAIN BRTXFEXLX ~XM kQSQCXNXQM 3~ ~w, XEZXGD CCT~ 1, 1@gg...

Burleson, Richard Earl

2012-06-07T23:59:59.000Z

399

Farm and home television viewing habits and preferences of Caldwell County residents in 1955  

E-Print Network (OSTI)

vievigg '@le Qi'ogP@n. on en Qv@X'age of R, pl ti9nee:yex' nonuh, She, 70 m'henites who vptche5 the. yyogj'en eav iti on en GvQx'apB' Qf 2'~'g '69@os yex' PAnCh& 'Qh&&8 She 8( , :, , " LIHRARV. . A 4 IR CGt:L'AGE 'GF 7'g. ". AS. I 1$ gjgbXe 4, $'ejg... $$ mye. Wm. ~~@~ ~;@j:. 1 &@~O~@QP@', @QV 5g"; '~jj ~~@8jj:, '~$4I, ~q ~ t@ 8~4&4 Cy 6'~4. " 0~~~%4 FBS~W8: ~~ pg . , eU~tgg~ 4 ~:pC@ ~~8 M 5~4 @8~~ ~~. , ;"gg~ gQ, @ %et'e4 &e @~a~ X 4?~ve X4ee4 M CeX4xeX3, , 6~8;~ gg ~~~ 44~~'P~Q, p AQUA, . cv 4...

Sloan, Jack Thomas

2012-06-07T23:59:59.000Z

400

Controlled Electron Injection into Plasma Accelerators and SpaceCharge Estimates  

SciTech Connect

Plasma based accelerators are capable of producing electron sources which are ultra-compact (a few microns) and high energies (up to hundreds of MeVs) in much shorter distances than conventional accelerators. This is due to the large longitudinal electric field that can be excited without the limitation of breakdown as in RF structures.The characteristic scale length of the accelerating field is the plasma wavelength and for typical densities ranging from 1018 - 1019 cm-3, the accelerating fields and scale length can hence be on the order of 10-100GV/m and 10-40 mu m, respectively. The production of quasimonoenergetic beams was recently obtained in a regime relying on self-trapping of background plasma electrons, using a single laser pulse for wakefield generation. In this dissertation, we study the controlled injection via the beating of two lasers (the pump laser pulse creating the plasma wave and a second beam being propagated in opposite direction) which induce a localized injection of background plasma electrons. The aim of this dissertation is to describe in detail the physics of optical injection using two lasers, the characteristics of the electron beams produced (the micrometer scale plasma wavelength can result in femtosecond and even attosecond bunches) as well as a concise estimate of the effects of space charge on the dynamics of an ultra-dense electron bunch with a large energy spread.

Fubiani, Gwenael J.

2005-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

X-ray study of the electric double layer at the n-hexane/nanocolloidal silica interface  

E-Print Network (OSTI)

The spatial structure of the transition region between an insulator and an electrolyte solution was studied with x-ray scattering.The electron density profile across the n-hexane/silica sol interface (solutions with 5-nm, 7-nm, and 12-nm colloidal particles) agrees with the theory of the electrical double layer and shows separation of positive and negative charges. The interface consists of three layers, i.e., a compact layer of Na+, a loose monolayer of nanocolloidal particles as part of a thick diffuse layer, and a low-density layer sandwiched between them. Its structure is described by a model in which the potential gradient at the interface reflects the difference in the potentials of "image forces" between the cationic Na+ and anionic nanoparticles and the specific adsorption of surface charge. The density of water in the large electric field (1-10 GV/m) of the transition region and the layering of silica in the diffuse layer is discussed.

Aleksey M. Tikhonov

2006-09-11T23:59:59.000Z

402

X:\ARM_19~1\P113-137.WPD  

NLE Websites -- All DOE Office Websites (Extended Search)

7 7 C/day, 1.5 C/day m 2 55 C 45 C 45 C 65 C Session Papers 125 Figure 1. Map showing analysis domain for GMS OLR data. Basic spatial units are five by five latitude-longitude areas, four of which are shown outlined by solid lines in the area north of Papau New Guinea; the large dot on the equator at 140 E shows the approximate satellite sub-point and the large area outlined between 150E to 180, 20 N to 20 S is the subject of analyses in Figures 2 and 3. Shading shows areas of intense convection at 00Z during July 1985. Variability of Radiatively Forced Diurnal Cycle of Intense Convection in the Tropical West Pacific W. M. Gray, J. D. Sheaffer, and W. B. Thorson Colorado State University Fort Collins, Colorado Introduction Strong differences occur in daytime versus nighttime

403

Responsible Asia Forest Trade (RAFT) Program | Open Energy Information  

Open Energy Info (EERE)

Responsible Asia Forest Trade (RAFT) Program Responsible Asia Forest Trade (RAFT) Program Jump to: navigation, search Name Responsible Asia Forest Trade (RAFT) Program Agency/Company /Organization U.S. Agency for International Development Sector Land Focus Area Forestry Topics Policies/deployment programs Resource Type Lessons learned/best practices Website http://www.responsibleasia.org Country Cambodia, China, Indonesia, Laos, Malaysia, Papua New Guinea, Thailand, Vietnam UN Region Central Asia, Eastern Asia, South-Eastern Asia References Responsible Asia Forest Trade (RAFT) Program[1] "The Responsible Asia Forestry and Trade (RAFT) is a five-year program funded by the U.S. Agency for International Development Regional Development Mission for Asia (USAID RDMA) in Bangkok. RAFT is managed by

404

Saint Vincent and the Grenadines-Pilot Program for Climate Resilience  

Open Energy Info (EERE)

Saint Vincent and the Grenadines-Pilot Program for Climate Resilience Saint Vincent and the Grenadines-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Saint Vincent and the Grenadines-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Saint Vincent and the Grenadines UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan

405

Copenhagen Accord NAMA Submissions Implications for the Transport Sector |  

Open Energy Info (EERE)

Copenhagen Accord NAMA Submissions Implications for the Transport Sector Copenhagen Accord NAMA Submissions Implications for the Transport Sector Jump to: navigation, search Tool Summary Name: Bridging the Gap: Copenhagen Accord NAMA Submissions Agency/Company /Organization: GTZ, Institute for Transportation and Development Policy (ITDP), Transport Research Laboratory(TRL), International Association for Public Transport (UITP), Veolia Transport Sector: Energy Focus Area: Transportation Topics: Low emission development planning Resource Type: Case studies/examples Website: www.transport2012.org/bridging/ressources/files/1/586,NAMA-submissions Country: Armenia, Botswana, Costa Rica, Democratic Republic of Congo, Ethiopia, Indonesia, Jordan, Republic of Macedonia, Madagascar, Marshall Islands, Mexico, Mongolia, Morocco, Papua New Guinea, Sierra Leone, Singapore

406

moran-99.PDF  

NLE Websites -- All DOE Office Websites (Extended Search)

Signal Processing Techniques Used in the Signal Processing Techniques Used in the ARM 8-mm Cloud Radars K. P. Moran, R. Lataitis, M. J. Post, B. E. Martner, and D. Welsh National Oceanic and Atmospheric Administration Environmental Technology Laboratory Boulder, Colorado D. Strauch Cooperative Institute for Research in the Environmental Sciences Boulder, Colorado K. B. Widener Pacific Northwest National Laboratory Richland, Washington Introduction The Atmospheric Radiation Measurement (ARM) Program's Millimeter Wavelength Cloud Radars (MMCRs) are a new generation of research tools designed to provide high temporal and spacial resolution measurements of the clouds above the Cloud and Radiation Testbed (CART) sites. The last of the four field sites for the MMCRs, located on Manus Island, Papau New Guinea, will be operating in

407

Microsoft Word - table_09.doc  

Gasoline and Diesel Fuel Update (EIA)

20 20 Table 9. Summary of U.S. Natural Gas Imports and Exports, 2004-2008 Imports Volume (million cubic feet) Pipeline Canada a .................................................... 3,606,543 3,700,454 3,589,995 3,782,708 3,589,221 Mexico ...................................................... 0 9,320 12,749 54,062 43,314 Total Pipeline Imports............................. 3,606,543 3,709,774 3,602,744 3,836,770 3,632,535 LNG Algeria....................................................... 120,343 97,157 17,449 77,299 0 Australia.................................................... 14,990 0 0 0 0 Egypt......................................................... 0 72,540 119,528 114,580 54,839 Equatorial Guinea .....................................

408

Event:Expanded Constituency Workshop for West Africa | Open Energy  

Open Energy Info (EERE)

Expanded Constituency Workshop for West Africa Expanded Constituency Workshop for West Africa Jump to: navigation, search Calendar.png Expanded Constituency Workshop for West Africa: on 2012/09/04 The Global Environment Facility (GEF) is holding an Expanded Constituency Workshop (ECW) for West Africa, as part of the GEF Country Support Programme, including participants from Benin, Cote D'Ivoire, Ghana, Liberia, Nigeria, Sierra leone, Guinea and Togo. The workshop will bring together representatives from civil society, the GEF Secretariat and GEF Agencies, with focal points of the biodiversity, desertification, climate change, and chemicals conventions to discuss activities with global environmental benefits. Civil society organizations are invited to register at the meeting website. Runs September 4 - 6

409

1  

NLE Websites -- All DOE Office Websites (Extended Search)

Western Pacific 2000 Western Pacific 2000 W. E. Clements, F. J. Barnes, L. Jones, and A. Haruta University of California Los Alamos National Laboratory Los Alamos, New Mexico M. Ivey Sandia National Laboratories Albuquerque, New Mexico P. Lefale South Pacific Regional Environment Programme Apia, Samoa Introduction The Atmospheric Radiation Measurement (ARM) Program's Tropical Western Pacific (TWP) Program is currently operating two Atmospheric Radiation and Cloud Stations (ARCS) in the TWP locale. The first ARCS site was installed on Los Negros Island in Manus Province, Papua New Guinea (PNG), in October 1996. The Tropical Western Pacific Program Office (TWPPO) and the PNG National Weather Service (NWS) have collaborated in operating the Manus site since its installation. Located on Nauru

410

Property:EnergyAccessYearInitiated | Open Energy Information  

Open Energy Info (EERE)

EnergyAccessYearInitiated EnergyAccessYearInitiated Jump to: navigation, search Property Name EnergyAccessYearInitiated Property Type Date Description Year Initiated Pages using the property "EnergyAccessYearInitiated" Showing 10 pages using this property. B Benin: Increased Access to Modern Energy Project + 2009 + Burkina Faso Energy Access Project + 2007 + E Ethiopia Energy Access Project + 2005 + G Ghana Energy Development and Access Project (GEDAP) + 2007 + M Mongolia Renewable Energy and Rural Electricity Access Project + 2006 + P Papua New Guinea Improved Energy Access for Rural Communities + 2012 + R Republic of Yemen Energy Access Project + 2006 + S Sri Lanka Credit to Connect + 2011 + T Tanzania Energy Development and Access Expansion Project + 2007 + V Viet Nam Rural Electrification + 2009 +

411

Darwin: The Third DOE ARM TWP ARCS Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Darwin: The Third DOE ARM TWP ARCS Site Darwin: The Third DOE ARM TWP ARCS Site W. E. Clements and L. Jones Los Alamos National Laboratory, Los Alamos, New Mexico T. Baldwin Special Services Unit Australian Bureau of Meteorology Melbourne, Australia K. Nitschke South Pacific Regional Environment Programme Apia, Samoa Introduction The U.S. Department of Energy's (DOE's) Atmospheric Radiation Measurement (ARM) Program began operations in its Tropical Western Pacific (TWP) locale in October 1996 when the first Atmospheric Radiation and Cloud Station (ARCS) began collecting data on Manus Island in Papua New Guinea (PNG). Two years later, in November 1998 a second ARCS began operations on the island of Nauru in the Central Pacific. Now a third ARCS has begun collecting data in Darwin, Australia. See Figure 1 for

412

Section 50  

NLE Websites -- All DOE Office Websites (Extended Search)

Data from the First Tropical Western Pacific Data from the First Tropical Western Pacific Atmospheric Radiation and Cloud Station J. H. Mather and T. P. Ackerman Pennsylvania State University University Park, Pennsylvania W. E. Clements and F. J. Barnes Los Alamos National Laboratory Los Alamos, New Mexico M. D. Ivey Sandia National Laboratories Albuquerque, New Mexico L. D. Hatfield Pacific Northwest National Laboratory Richland, Washington R. M. Reynolds Brookhaven National Laboratory Upton, New York Introduction The first Atmospheric Radiation and Cloud Station (ARCS) was installed during September 1996 in Manus Province, Papua New Guinea. The site is located at 2.06 south, 147.42 east in the heart of the Western Pacific warm pool region. This region is characterized by strong solar heating, high water vapor concentrations, and active convection. The sea

413

ARM - TWP Nauru Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Nauru Site Nauru Site TWP Related Links Facilities and Instruments Manus Island Nauru Island Darwin, AUS ES&H Guidance Statement Operations Science Field Campaigns Year of Tropical Convection Visiting the Site TWP Fact Sheet Images Information for Guest Scientists Contacts TWP Nauru Site Location: 0° 31' 15.6" S, 166° 54' 57.60" E Altitude: 7.1 meters The Nauru facility was established in November 1998 as the second TWP climate research station. It is situated in the Denigomodu district on Nauru Island, the Republic of Nauru, which is located in the western South Pacific, approximately 1,200 miles northeast of Papua New Guinea. The ARM Program selected this location because it is on the eastern edge of the Pacific warm pool under La Niña conditions, which affect weather patterns

414

Survey of Biomass Resource Assessments and Assessment Capabilities in APEC  

Open Energy Info (EERE)

Assessments and Assessment Capabilities in APEC Assessments and Assessment Capabilities in APEC Economies Jump to: navigation, search Logo: Survey of Biomass Resource Assessments and Assessment Capabilities in APEC Economies Name Survey of Biomass Resource Assessments and Assessment Capabilities in APEC Economies Agency/Company /Organization National Renewable Energy Laboratory Sector Energy Focus Area Biomass Topics Resource assessment Website http://www.nrel.gov/internatio Country Australia, Brunei, Canada, Chile, China, Indonesia, Japan, South Korea, Malaysia, Mexico, New Zealand, Papua New Guinea, Peru, Philippines, Russia, Chinese Taipei, Thailand, United States, Vietnam Australia and New Zealand, South-Eastern Asia, Northern America, South America, Eastern Asia, South-Eastern Asia, Eastern Asia, Eastern Asia, South-Eastern Asia, Central America, Australia and New Zealand, Melanesia, South America, South-Eastern Asia, Eastern Europe, , South-Eastern Asia, Northern America, South-Eastern Asia

415

Asia-Pacific Regional Climate Change Adaptation Assessment | Open Energy  

Open Energy Info (EERE)

Asia-Pacific Regional Climate Change Adaptation Assessment Asia-Pacific Regional Climate Change Adaptation Assessment Jump to: navigation, search Tool Summary Name: Asia-Pacific Regional Climate Change Adaptation Assessment Agency/Company /Organization: U.S. Agency for International Development Sector: Energy Topics: Adaptation, Co-benefits assessment, Policies/deployment programs Resource Type: Publications Website: www.usaid.gov/rdma/documents/RDMA_Asia-Pacific_Climate_Change_Adaptati Country: China, Bangladesh, India, Indonesia, Laos, Marshall Islands, Federated States of Micronesia, Philippines, Thailand, Vietnam, Cambodia, Maldives, Mongolia, Nepal, Papua New Guinea, Timor-Leste, Solomon Islands, Sri Lanka, Vanuatu UN Region: Central Asia, Eastern Asia, South-Eastern Asia References: Asia-Pacific Adaptation Assessment[1]

416

Lowering Emissions in Asia's Forests (LEAF) | Open Energy Information  

Open Energy Info (EERE)

Lowering Emissions in Asia's Forests (LEAF) Lowering Emissions in Asia's Forests (LEAF) Jump to: navigation, search Name Lowering Emissions in Asia's Forests (LEAF) Agency/Company /Organization United States Agency for International Development Sector Climate, Land Focus Area Biomass, Forestry Topics GHG inventory, Low emission development planning, -LEDS Resource Type Training materials Website http://www.snvworld.org/en/sec Country Cambodia, Laos, Malaysia, Papua New Guinea, Thailand, Vietnam South-Eastern Asia, South-Eastern Asia, South-Eastern Asia, Melanesia, South-Eastern Asia, South-Eastern Asia References LEAF[1] "Lowering Emissions in Asia's Forests (LEAF), supported by USAID/RDMA, aims to strengthen the capacity of target countries to achieve meaningful and sustained reductions in GHG emissions from the forestry-land use sector

417

ARM - Visiting the TWP  

NLE Websites -- All DOE Office Websites (Extended Search)

PacificVisiting the TWP PacificVisiting the TWP TWP Related Links Facilities and Instruments Manus Island Nauru Island Darwin, AUS ES&H Guidance Statement Operations Science Field Campaigns Year of Tropical Convection Visiting the Site TWP Fact Sheet Images Information for Guest Scientists Contacts Visiting the TWP Nauru Island from the air. Nauru Island from the air. The Tropical Western Pacific site consists of three diverse climate research facilities in Papua New Guinea, the Republic of Nauru, and Australia. Each facility has its own operating procedures and health and safety issues. Safety First! Before visiting any of the three TWP facilities, you must do the following: Submit a Site and Computer Access Request Form Read the Safety Plan for the facility you plan to visit: TWP Site Visit Safety Procedure

418

Category:Countries | Open Energy Information  

Open Energy Info (EERE)

Countries Countries Jump to: navigation, search This category contains sovereign nations and uses the form Country. Pages in category "Countries" The following 200 pages are in this category, out of 211 total. (previous 200) (next 200) A Afghanistan Albania Algeria Andorra Angola Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan B Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegovina Botswana Brazil Brunei Bulgaria Burkina Faso Burundi C Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Colombia Comoros Cook Islands Costa Rica Croatia Cuba Cyprus Czech Republic D Democratic Republic of Congo Denmark Djibouti Dominica Dominican Republic E Ecuador Egypt El Salvador Equatorial Guinea

419

ARM - Blog Article  

NLE Websites -- All DOE Office Websites (Extended Search)

4, 2013 [Blog] 4, 2013 [Blog] Recycling: A Lesson from Manus Island Bookmark and Share Guest post and photos by Chad Baldi, Project Engineer, ProSensing Inc. Three of us from ProSensing recently made a trip to Manus Island in Papua New Guinea to perform some upgrades to two ARM radars. We made a few interesting discoveries. In 2011, the ARM zenith cloud radar Ka-band antenna was replaced, and the old antenna was scrapped. As seen in the picture, the local villagers salvaged the scrapped antenna and are now using it to collect rain water for the community. The rain water drains off the roof of the house into the antenna, serving as a catch basin. When we told the property owner what a brand new antenna costs, he had a good laugh. The other photo is a picture of wood-crafted shed. This is an office/study

420

Research Highlight  

NLE Websites -- All DOE Office Websites (Extended Search)

A Tall Order: Climate Models Fall Short in Predicting African Sahel A Tall Order: Climate Models Fall Short in Predicting African Sahel Rainfall Download a printable PDF Submitter: Roehrig, R., Meteo-France CNRM/GMME/MOANA Area of Research: General Circulation and Single Column Models/Parameterizations Working Group(s): Cloud-Aerosol-Precipitation Interactions Journal Reference: Roehrig R, D Bouniol, F Guichard, F Hourdin, and JL Redelsperger. 2013. "The present and future of the West African Monsoon: A process-oriented assessment of CMIP5 simulations along the AMMA transect." Journal of Climate, 26(17), doi:10.1175/jcli-d-12-00505.1. The wealth of data available from field campaigns between the Gulf of Guinea and the Sahara Desert allowed scientists to evaluate the ability of climate models to accurately predict rainfall in the area.

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Microsoft Word - table_09.doc  

Gasoline and Diesel Fuel Update (EIA)

0 0 Table 9. Summary of U.S. Natural Gas Imports and Exports, 2003-2007 Imports Volume (million cubic feet) Pipeline Canada a .................................................... 3,437,230 3,606,543 3,700,454 3,589,995 3,782,708 Mexico ...................................................... 0 0 9,320 12,749 54,062 Total Pipeline Imports............................. 3,437,230 3,606,543 3,709,774 3,602,744 3,836,770 LNG Algeria....................................................... 53,423 120,343 97,157 17,449 77,299 Australia.................................................... 0 14,990 0 0 0 Egypt......................................................... 0 0 72,540 119,528 114,580 Equatorial Guinea .....................................

422

Assessment of Biomass Resources from Marginal Lands in APEC Countries |  

Open Energy Info (EERE)

from Marginal Lands in APEC Countries from Marginal Lands in APEC Countries Jump to: navigation, search Logo: Assessment of Biomass Resources from Marginal Lands in APEC Countries Name Assessment of Biomass Resources from Marginal Lands in APEC Countries Agency/Company /Organization National Renewable Energy Laboratory Sector Energy Focus Area Biomass Topics Resource assessment Resource Type Dataset, Maps, Publications Website http://www.biofuels.apec.org/p Country Australia, Brunei, Canada, Chile, China, Indonesia, Japan, South Korea, Malaysia, Mexico, New Zealand, Papua New Guinea, Peru, Philippines, Russia, Chinese Taipei, Thailand, United States, Vietnam Australia and New Zealand, South-Eastern Asia, Northern America, South America, Eastern Asia, South-Eastern Asia, Eastern Asia, Eastern Asia, South-Eastern Asia, Central America, Australia and New Zealand, Melanesia, South America, South-Eastern Asia, Eastern Europe, , South-Eastern Asia, Northern America, South-Eastern Asia

423

TWP Nauru Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Nauru Site Nauru Site TWP Related Links Facilities and Instruments Manus Island Nauru Island Darwin, AUS ES&H Guidance Statement Operations Science Field Campaigns Year of Tropical Convection Visiting the Site TWP Fact Sheet Images Information for Guest Scientists Contacts TWP Nauru Site Location: 0° 31' 15.6" S, 166° 54' 57.60" E Altitude: 7.1 meters The Nauru facility was established in November 1998 as the second TWP climate research station. It is situated in the Denigomodu district on Nauru Island, the Republic of Nauru, which is located in the western South Pacific, approximately 1,200 miles northeast of Papua New Guinea. The ARM Program selected this location because it is on the eastern edge of the Pacific warm pool under La Niña conditions, which affect weather patterns

424

Energy Upgrade Program Revitalizing Oregon | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Upgrade Program Revitalizing Oregon Energy Upgrade Program Revitalizing Oregon Energy Upgrade Program Revitalizing Oregon May 28, 2010 - 2:38pm Addthis Joshua DeLung What does this project do? Local businesses in 13 communities are getting energy makeovers in an effort to help business owners save hundreds of dollars each year and revitalize downtown areas. 'Main streets' in Clackamas County, Oregon, are undergoing a makeover - an energy-efficiency makeover. As part of the Clackamas County Energy Efficiency on Main Street Program, local businesses in 13 communities are getting energy makeovers in an effort to help business owners save hundreds of dollars each year and revitalize downtown areas. First to save The program needed a guinea pig to be the first to receive a free energy audit and found a willing participant in Key Carpets, a Molalla-based store

425

Description of the Early Growth Dynamics of 2014 West Africa Ebola Epidemic  

E-Print Network (OSTI)

${\\bf Background:}$ The early growth dynamics of the West African Ebola virus epidemic has been qualitatively different for Guinea, Sierra Leone and Liberia. However, it is important to understand these disparate dynamics as trends of a single epidemic spread over regions with similar geographic and cultural aspects, with likely common parameters for transmission rates and the reproduction number $R_0$. ${\\bf Methods:}$ We combine a discrete, stochastic SEIR model with a two-scale community network model to demonstrate that the different regional trends may be explained by different community mixing rates. Heuristically, the effect of different community mixing rates may be understood as the observation that two individuals infected by the same chain of transmission are more likely to know one another in a less-mixed community. Saturation effects occur as the contacts of an infected individual are more likely to already be exposed by the same chain of transmission. ${\\bf Results:}$ The effects of community mi...

Kiskowski, Maria

2014-01-01T23:59:59.000Z

426

Current Concepts: Flavivirus Encephalitis  

Science Journals Connector (OSTI)

..., which has caused encephalitis outbreaks in Brazil, and Murray Valley encephalitis virus in Australia, New Guinea, and New Zealand. Kunjin virus, which also circulates in Australia, recently has been reclassified as a subtype of West Nile virus. In terms of numbers, the most important member of the... West Nile virus is one member of the genus flavivirus, which includes mosquito-borne viruses that cause similar disease patterns in much of the world. The other members of this serogroup include the St. Louis encephalitis virus, the Murray Valley virus, and the Japanese encephalitis virus (which causes thousands of deaths each year in Asia). This review summarizes what is currently known about flavivirus encephalitis, with emphasis on the pathogenesis of West Nile virus infections.

Solomon T.

2004-07-22T23:59:59.000Z

427

C-Band Scanning ARM Precipitation Radar (C-SAPR) Handbook  

SciTech Connect

The C-band scanning ARM precipitation radar (C-SAPR) is a scanning polarimetric Doppler radar transmitting simultaneously in both H and V polarizations. With a 350-kW magnetron transmitter, this puts 125 kW of transmitted power for each polarization. The receiver for the C-SAPR is a National Center for Atmospheric Research (NCAR) -developed Hi-Q system operating in a coherent-on-receive mode. The ARM Climate Research Facility operates two C-SAPRs; one of them is deployed near the Southern Great Plains (SGP) Central Facility near the triangular array of X-SAPRs, and the second C-SAPR is deployed at ARMs Tropical Western Pacific (TWP) site on Manus Island in Papua New Guinea.

Widener, K; Bharadwaj, N

2012-11-13T23:59:59.000Z

428

Complete genome sequence of Hippea maritima type strain (MH2T)  

SciTech Connect

Hippea maritima (Miroshnichenko et al. 1999) is the type species of the genus Hippea, which belongs to the family Desulfurellaceae within the class Deltaproteobacteria. The anaerobic, moderately thermophilic marine sulfur-reducer was first isolated from shallow-water hot vents in Matipur Harbor, Papua New Guinea. H. maritima was of interest for genome se- quencing because of its isolated phylogenetic location, as a distant next neighbor of the ge- nus Desulfurella. Strain MH2T is the first type strain from the order Desulfurellales with a com- pletely sequenced genome. The 1,694,430 bp long linear genome with its 1,723 protein- coding and 57 RNA genes consists of one circular chromosome and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Huntemann, Marcel [U.S. Department of Energy, Joint Genome Institute; Lu, Megan [Los Alamos National Laboratory (LANL); Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Hammon, Nancy [U.S. Department of Energy, Joint Genome Institute; Deshpande, Shweta [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Ovchinnikova, Galina [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Hauser, Loren John [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute

2011-01-01T23:59:59.000Z

429

Hazardous waste management in the Pacific basin  

SciTech Connect

Hazardous waste control activities in Asia and the Pacific have been reviewed. The review includes China (mainland, Hong Kong, and Taiwan), Indonesia, Korea, Malaysia, Papua New Guinea, the Philippines, Singapore, and Thailand. It covers the sources of hazardous waste, the government structure for dealing with hazardous waste, and current hazardous waste control activities in each country. In addition, the hazardous waste program activities of US government agencies, US private-sector organizations, and international organizations are reviewed. The objective of these reviews is to provide a comprehensive picture of the current hazardous waste problems and the waste management approaches being used to address them so that new program activities can be designed more efficiently.

Cirillo, R.R.; Chiu, S.; Chun, K.C.; Conzelmann, G. [Argonne National Lab., IL (United States); Carpenter, R.A.; Indriyanto, S.H. [East-West Center, Honolulu, HI (United States)

1994-11-01T23:59:59.000Z

430

Central Africa: Global climate change and development. Overview. Technical report  

SciTech Connect

The preliminary study focuses on the six countries of central Africa which contain the largest remaining contiguous block of closed forests in sub-Saharan Africa: Cameroon, Central African Republic, the Congo, Equatorial Guinea, Gabon, and Zaire. The carbon in the vegetation and soils in these moist tropical forests and surrounding seasonal woodlands constitute the greatest potential source of future carbon dioxide (CO2) emissions from sub-Saharan Africa. This study also considers the importance of savanna burning, although in less depth since the small savanna area in central Africa precludes this activity from being a large regional source of emissions. Analysis of biogeophysical and socioeconomic issues relevant to global climate change, and research containing both space-based and ground-based components, were undertaken.

Not Available

1993-01-01T23:59:59.000Z

431

Preliminary toxicology study of 3,6-diamino-1,2,4,5-tetrazine  

SciTech Connect

The calculated acute oral LD 30/50 (lethal dose for 50% of the animals occurring within 30 days after compound administration) value for 3,6-diamino-1,2,4,5-tetrazine (DATZ) was 863 mg/kg in rats. According to classical guidelines, DATZ would be considered slightly to moderately toxic for rats. The calculated acute oral LD [sub 30/50] value was 2,288 mg/kg in mice and would be considered slightly to moderately toxic for mice. Skin application studies using rabbits demonstrated DATZ to be a nonirritant. The eye study using rabbits disclosed DATZ to be a very mild irritant. The sensitization study using guinea pigs did not show DATZ to have potential sensitizing properties.

London, J.E.

1993-03-01T23:59:59.000Z

432

Preliminary toxicology study of 3,6-diamino-1,2,4,5-tetrazine  

SciTech Connect

The calculated acute oral LD 30/50 (lethal dose for 50% of the animals occurring within 30 days after compound administration) value for 3,6-diamino-1,2,4,5-tetrazine (DATZ) was 863 mg/kg in rats. According to classical guidelines, DATZ would be considered slightly to moderately toxic for rats. The calculated acute oral LD {sub 30/50} value was 2,288 mg/kg in mice and would be considered slightly to moderately toxic for mice. Skin application studies using rabbits demonstrated DATZ to be a nonirritant. The eye study using rabbits disclosed DATZ to be a very mild irritant. The sensitization study using guinea pigs did not show DATZ to have potential sensitizing properties.

London, J.E.

1993-03-01T23:59:59.000Z

433

Central African Regional Program for the Environment (CARPE) | Open Energy  

Open Energy Info (EERE)

the Environment (CARPE) the Environment (CARPE) Jump to: navigation, search Name Central African Regional Program for the Environment (CARPE) Agency/Company /Organization U.S. Agency for International Development, United States Forest Service, University of Maryland Sector Land Focus Area Forestry Topics Implementation, Policies/deployment programs, Background analysis Resource Type Dataset, Maps, Software/modeling tools Website http://carpe.umd.edu/ Country Gabon, Rwanda, Burundi, Sao Tome and Principe, Central African Republic, Democratic Republic of Congo, Republic of the Congo, Equatorial Guinea, Cameroon Middle Africa, Eastern Africa, Eastern Africa, Middle Africa, Middle Africa, Middle Africa, Middle Africa, Middle Africa, Middle Africa References Central African Regional Program for the Environment (CARPE)[1]

434

Nationally Appropriate Mitigation Actions | Open Energy Information  

Open Energy Info (EERE)

Page Page Edit with form History Facebook icon Twitter icon » Nationally Appropriate Mitigation Actions Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Nationally Appropriate Mitigation Actions Agency/Company /Organization: United Nations Framework Convention on Climate Change Sector: Energy, Land Focus Area: Energy Efficiency Topics: GHG inventory, Low emission development planning Resource Type: Publications, Lessons learned/best practices, Case studies/examples Website: unfccc.int/home/items/5265.php Country: Afghanistan, Antigua and Barbuda, Armenia, Benin, Bhutan, Botswana, Brazil, Cameroon, Central African Republic, China, Democratic Republic of Congo, Costa Rica, Ivory Coast, Ethiopia, Eritrea, Gabon, Georgia (country), Ghana, India, Indonesia, Israel, Jordan, Madagascar, Maldives, Marshall Islands, Mauritania, Mexico, Mongolia, Morocco, Papua New Guinea, Peru, South Korea, Moldova, San Marino, Sierra Leone, Singapore, South Africa, Republic of Macedonia, Togo, Tunisia

435

ARM - Feature Stories and Releases Article  

NLE Websites -- All DOE Office Websites (Extended Search)

, 2011 [Feature Stories and Releases] , 2011 [Feature Stories and Releases] AMIE, What You Wanna Do? Bookmark and Share Data spanning the Maldives to Papua New Guinea will help scientists analyze far-reaching tropical weather cycle This view shows a subset of the ARM Mobile Facility instruments operating at the Gan Island airport for the AMIE campaign. To see the complete collection, see the image set in Flickr. This view shows a subset of the ARM Mobile Facility instruments operating at the Gan Island airport for the AMIE campaign. To see the complete collection, see the image set in Flickr. Like the lyrics in the song from the 1970s, the ARM Mobile Facility is going to stay in the Maldives "for a while, maybe longer"-about six months, actually-in support of the ARM Madden Julian Oscillation (MJO)

436

Research Highlight  

NLE Websites -- All DOE Office Websites (Extended Search)

Island-Induced Cloud Plumes Influence Tropical Atmospheric Measurements, Island-Induced Cloud Plumes Influence Tropical Atmospheric Measurements, Surface Radiation Submitter: McFarlane, S. A., U.S. Department of Energy Area of Research: Radiation Processes Working Group(s): Radiative Processes Journal Reference: McFarlane, S.A., Long, C.N., and Flynn, D., Nauru Island Effect Study, Fourteenth ARM Science Team Meeting, March 22 to 26, 2004, Albuquerque, New Mexico. Nauru Island, about 1,200 miles northeast of Papua New Guinea in the western South Pacific, is one of three instrumented island sites that comprise ARM's Tropical Western Pacific locale. A key objective of the U.S. Department of Energy's Atmospheric Radiation Measurement (ARM) Program is to identify interactions between the processes that determine the radiative properties of an atmospheric column, including

437

Low Emissions Asian Development (LEAD) Program | Open Energy Information  

Open Energy Info (EERE)

Development (LEAD) Program Development (LEAD) Program (Redirected from Low Emission Asian Development (LEAD) Program) Jump to: navigation, search Name Low Emissions Asian Development (LEAD) Program Agency/Company /Organization ICF International, United States Agency for International Development (USAID) Partner USFS, EPA, United States Department of State Sector Climate, Energy, Land Topics Background analysis, Low emission development planning, -LEDS Website http://www.LowEmissionsAsia.or Country Bangladesh, Cambodia, India, Indonesia, Laos, Malaysia, Nepal, Papua New Guinea, Philippines, Thailand, Vietnam Southern Asia, South-Eastern Asia, Southern Asia, South-Eastern Asia, South-Eastern Asia, South-Eastern Asia, Southern Asia, Melanesia, South-Eastern Asia, South-Eastern Asia, South-Eastern Asia

438

Low Emissions Asian Development (LEAD) Program | Open Energy Information  

Open Energy Info (EERE)

Emissions Asian Development (LEAD) Program Emissions Asian Development (LEAD) Program Jump to: navigation, search Name Low Emissions Asian Development (LEAD) Program Agency/Company /Organization ICF International, United States Agency for International Development (USAID) Partner USFS, EPA, United States Department of State Sector Climate, Energy, Land Topics Background analysis, Low emission development planning, -LEDS Website http://www.LowEmissionsAsia.or Country Bangladesh, Cambodia, India, Indonesia, Laos, Malaysia, Nepal, Papua New Guinea, Philippines, Thailand, Vietnam Southern Asia, South-Eastern Asia, Southern Asia, South-Eastern Asia, South-Eastern Asia, South-Eastern Asia, Southern Asia, Melanesia, South-Eastern Asia, South-Eastern Asia, South-Eastern Asia References LEAD Program[1]

439

African oil: past, present, and future  

SciTech Connect

Nearly 50% of Africa's total area is comprised of sedimentary basins. These basins number more than 80 and contain an estimated proven hydrocarbon reserve of 89 billion bbl (oil equivalent), about 8% of the world's resources. Of these reserves, 68% occur in North Africa, 22% in Nigeria, and 7% in the Aptian Salt basin, which encompasses the coastal parts of Cameroon, Gabon, Congo, Zaire, and Angola. The first discovery of hydrocarbons in Africa was in Egypt in 1886, and the most recent discoveries are in the Gulf of Guinea and the interior rift basins of central Africa. Africa's basins can be classified into six types. However, each type has modifiers and most basins have evolved through a polycyclic history from one type to another. Giant hydrocarbons accumulations are related to marine source strata and large, non-giant pools to nonmarine source strata. All sizes of fields occur in areas with marine source rocks, but giant fields very rarely occur in areas where nonmarine source rocks are thought to predominate. Estimates of future potential reserves for each basin have been established by conventional basin assessment, play assessment, and volumetric yield methods, where data were sufficient. Giant accumulations will be found in the future in Tunisia and Egypt, in east Africa (if a deeper Karroo-play is pursued), and in the interior sag basins of central Africa, which are remote and unexplored. Some chance of finding one or two giant fields exists in Algeria and Libya, and Aptian Salt basin, the Gulf of Guinea, and the interior rift basins of central Africa, but generally only large accumulations will be found.

Clifford, A.

1984-09-01T23:59:59.000Z

440

Hombres jvenes que tienen sexo con hombres: un colectivo en alto riesgo para la infeccin por el VIH?  

Science Journals Connector (OSTI)

ResumenObjetivos Comparar las variables asociadas al riesgo de infeccin por el VIH entre los hombres ?25 aos (jvenes) y >25 aos de edad que tienen sexo con hombres, y determinar las variables asociadas a la penetracin anal sin condn de los hombres jvenes con parejas sexuales ocasionales. Mtodo Durante 1 mes, 485 participantes ?25 aos y 1.470 >25 aos completaron una encuesta impresa aplicada en lugares de ambiente o a travs de Internet en Madrid, Barcelona, Bilbao y San Sebastin. La encuesta investig conductas sexuales de los ltimos 3 meses segn las parejas sexuales conocidas en lugares de ambiente y por Internet. Resultados No se encontraron diferencias significativas entre los hombres ?25 aos y >25 aos con respecto a la penetracin anal sin condn con parejas sexuales conocidas en lugares de ambiente (23% frente a 30%, p>0,05) o en Internet (29% frente a 30%, p>0,05), al uso del condn en la ltima penetracin anal y a haber tenido una infeccin de transmisin sexual en el ltimo ao (19% frente a 23%, p>0,05). Sin embargo, los encuestados >25 aos tuvieron un nmero promedio mayor de parejas sexuales conocidas en lugares de ambiente (9,2 frente a 7, psexo con hombres, los jvenes no estn expuestos a un mayor riesgo de infeccin por el VIH y de otras infecciones de transmisin sexual que los >25 aos. Sin embargo, algunas variables podran hablar de su vulnerabilidad. Objectives To compare variables associated with the risk of HIV among men ?25 years old who have sex with men (YMSM) and those >25 years old, and to determine the variables associated with unprotected anal intercourse (UAI) in YMSM with casual sexual partners. Method For 1 month, 485 participants ?25 years old and 1,470 aged >25 years old completed a pen-and-paper survey carried out in gay venues (GV) or via the Internet in Madrid, Barcelona, Bilbao and San Sebastin (Spain). The survey investigated sexual behaviors in the past 3 months according to whether the men met sexual partners in GV (SPGV) or on the Internet (SPI). Results No significant differences were found between YMSM and those >25 years old with respect to UAI with SPGV (23% vs. 30%, p>0.05) and SPI (29% vs. 30%, p>0.05), condom use in the last anal intercourse and having had a sexually-transmitted infection (STI) in the last year (19% vs. 23%, p>0.05). However, respondents>25 years old had a higher average number of SPGV (9.2 vs. 7, p<0.05) and SPI (8.9 vs. 6.4, p<0.05), were more likely to have used drugs while having UAI (68% vs. 55%, p<0.05, with SPI, and 73% vs. 55%, p<0.05, with SPGV) and had a higher prevalence of HIV (11% vs. 4%, p<0.05). When exploring other variables, we found that YMSM more frequently had receptive UAI with SPI (73% vs. 57%, p<0.05), had less time to be in a stable relationship, and their sexual partner more frequently convinced them to ha

Percy Fernndez-Dvila; Kati Zaragoza Lorca

2011-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Particle identification with the AMS-02 RICH detector: search for dark matter with antideuterons  

E-Print Network (OSTI)

The Alpha Magnetic Spectrometer (AMS), whose final version AMS-02 is to be installed on the International Space Station (ISS) for at least 3 years, is a detector designed to measure charged cosmic ray spectra with energies up to the TeV region and with high energy photon detection capability up to a few hundred GeV, using state-of-the art particle identification techniques. It is equipped with several subsystems, one of which is a proximity focusing Ring Imaging Cherenkov (RICH) detector equipped with a dual radiator (aerogel+NaF), a lateral conical mirror and a detection plane made of 680 photomultipliers and light guides, enabling precise measurements of particle electric charge and velocity (Delta beta / beta ~ 10^-3 and 10^-4 for Z=1 and Z=10-20, respectively) at kinetic energies of a few GeV/nucleon. Combining velocity measurements with data on particle rigidity from the AMS-02 Tracker (Delta R / R ~ 2% for R=1-10 GV) it is possible to obtain a reliable measurement for particle mass. One of the main topics of the AMS-02 physics program is the search for indirect signatures of dark matter. Experimental data indicate that dark, non-baryonic matter of unknown composition is much more abundant than baryonic matter, accounting for a large fraction of the energy content of the Universe. Apart from antideuterons produced in cosmic-ray propagation, the annihilation of dark matter will produce additional antideuteron fluxes. Detailed Monte Carlo simulations of AMS-02 have been used to evaluate the detector's performance for mass separation, a key issue for anti-D/anti-p separation. Results of these studies are presented.

Lusa Arruda; Fernando Baro; Rui Pereira

2007-10-04T23:59:59.000Z

442

Constraints on particle dark matter from cosmic-ray antiprotons  

E-Print Network (OSTI)

Cosmic-ray antiprotons represent an important channel for dark matter indirect-detection studies. Current measurements of the antiproton flux at the top of the atmosphere and theoretical determinations of the secondary antiproton production in the Galaxy are in good agreement, with no manifest deviation which could point to an exotic contribution in this channel. Therefore, antiprotons can be used as a powerful tool for constraining particle dark matter properties. By using the spectrum of PAMELA data from 50 MV to 180 GV in rigidity, we derive bounds on the dark matter annihilation cross section (or decay rate, for decaying dark matter) for the whole spectrum of dark matter annihilation (decay) channels and under different hypotheses of cosmic-rays transport in the Galaxy and in the heliosphere. For typical models of galactic propagation, the constraints are significantly strong, setting a lower bound on the dark matter mass of a "thermal" relic at about 50 -- 90 GeV for hadronic annihilation channels. These bounds are enhanced to about 150 GeV on the dark matter mass, when large cosmic-rays confinement volumes in the Galaxy are considered, and are reduced to 4-5 GeV for annihilation to light quarks (no bound for heavy-quark production) when the confinement volume is small. Bounds for dark matter lighter than few tens of GeV are due to the low energy part of the PAMELA spectrum, an energy region where solar modulation is relevant: to this aim, we have implemented a detailed solution of the transport equation in the heliosphere, which allowed us not only to extend bounds to light dark matter, but also to determine the uncertainty on the constraints arising from solar modulation modeling. Finally, we estimate the impact of soon-to-come AMS-02 data on the antiproton constraints.

N. Fornengo; L. Maccione; A. Vittino

2013-12-12T23:59:59.000Z

443

Constraints on particle dark matter from cosmic-ray antiprotons  

E-Print Network (OSTI)

Cosmic-ray antiprotons represent an important channel for dark matter indirect-detection studies. Current measurements of the antiproton flux at the top of the atmosphere and theoretical determinations of the secondary antiproton production in the Galaxy are in good agreement, with no manifest deviation which could point to an exotic contribution in this channel. Therefore, antiprotons can be used as a powerful tool for constraining particle dark matter properties. By using the spectrum of PAMELA data from 50 MV to 180 GV in rigidity, we derive bounds on the dark matter annihilation cross section (or decay rate, for decaying dark matter) for the whole spectrum of dark matter annihilation (decay) channels and under different hypotheses of cosmic-rays transport in the Galaxy and in the heliosphere. For typical models of galactic propagation, the constraints are significantly strong, setting a lower bound on the dark matter mass of a "thermal" relic at about 50-90 GeV for hadronic annihilation channels. These bounds are enhanced to about 150 GeV on the dark matter mass, when large cosmic-rays confinement volumes in the Galaxy are considered, and are reduced to 4-5 GeV for annihilation to light quarks (no bound for heavy-quark production) when the confinement volume is small. Bounds for dark matter lighter than few tens of GeV are due to the low energy part of the PAMELA spectrum, an energy region where solar modulation is relevant: to this aim, we have implemented a detailed solution of the transport equation in the heliosphere, which allowed us not only to extend bounds to light dark matter, but also to determine the uncertainty on the constraints arising from solar modulation modeling. Finally, we estimate the impact of soon-to-come AMS-02 data on the antiproton constraints.

N. Fornengo; L. Maccione; A. Vittino

2015-01-30T23:59:59.000Z

444

Lorentz Transformations  

E-Print Network (OSTI)

This paper describes a particularly didactic and transparent derivation of basic properties of the Lorentz group. The generators for rotations and boosts along an arbitrary direction, as well as their commutation relations, are written as functions of the unit vectors that define the axis of rotation or the direction of the boost (an approach that can be compared with the one that in electrodynamics, works with the electric and magnetic fields instead of the Maxwell stress tensor). For finite values of the angle of rotation or the boost's velocity, collectively denoted by V, the existence of an exponential expansion for the coordinate transformation's matrix, M (in terms of GV where G is the generator) requires that the matrix's derivative with respect to V, be equal to GM. This condition can only be satisfied if the transformation is additive as it is indeed the case for rotations, but not for velocities. If it is assumed, however, that for boosts such an expansion exists, with V = V(v), v being the velocity, and if the above condition is imposed on the boost's matrix then its expression in terms of hyperbolic cosh(V) and sinh(V} is recovered, and the expression for V(= arc tanh(v)) is determined. A general Lorentz transformation can be written as an exponential containing the sum of a rotation and a boost, which to first order is equal to the product of a boost with a rotation. The calculations of the second and third order terms show that the equations for the generators used in this paper, allow to reliably infer the expressions for the higher order generators, without having recourse to the commutation relations. The transformationmatrices for Weyl spinors are derived for finite values of the rotation and velocity, and field representations, leading to the expression for the angular momentum operator, are studied.

Bernard R. Durney

2011-12-09T23:59:59.000Z

445

Effective passivation of In{sub 0.2}Ga{sub 0.8}As by HfO{sub 2} surpassing Al{sub 2}O{sub 3} via in-situ atomic layer deposition  

SciTech Connect

High {kappa} gate dielectrics of HfO{sub 2} and Al{sub 2}O{sub 3} were deposited on molecular beam epitaxy-grown In{sub 0.2}Ga{sub 0.8}As pristine surface using in-situ atomic-layer-deposition (ALD) without any surface treatment or passivation layer. The ALD-HfO{sub 2}/p-In{sub 0.2}Ga{sub 0.8}As interface showed notable reduction in the interfacial density of states (D{sub it}), deduced from quasi-static capacitance-voltage and conductance-voltage (G-V) at room temperature and 100 Degree-Sign C. More significantly, the midgap peak commonly observed in the D{sub it}(E) of ALD-oxides/In{sub 0.2}Ga{sub 0.8}As is now greatly diminished. The midgap D{sub it} value decreases from {>=}15 Multiplication-Sign 10{sup 12} eV{sup -1} cm{sup -2} for ALD-Al{sub 2}O{sub 3} to {approx}2-4 Multiplication-Sign 10{sup 12} eV{sup -1} cm{sup -2} for ALD-HfO{sub 2}. Further, thermal stability at 850 Degree-Sign C was achieved in the HfO{sub 2}/In{sub 0.2}Ga{sub 0.8}As, whereas C-V characteristics of Al{sub 2}O{sub 3}/p-In{sub 0.2}Ga{sub 0.8}As degraded after the high temperature annealing. From in-situ x-ray photoelectron spectra, the AsO{sub x}, which is not the oxidized state from the native oxide, but is an induced state from adsorption of trimethylaluminum and H{sub 2}O, was found at the ALD-Al{sub 2}O{sub 3}/In{sub 0.2}Ga{sub 0.8}As interface, while that was not detected at the ALD-HfO{sub 2}/In{sub 0.2}Ga{sub 0.8}As interface.

Chang, Y. H.; Chiang, T. H. [Department of Materials Science and Engineering, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Lin, C. A.; Liu, Y. T.; Lin, H. Y.; Huang, M. L.; Kwo, J. [Department of Physics, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Lin, T. D.; Hong, M. [Graduate Institute of Applied Physics and Department of Physics, National Taiwan University, Taipei 10617, Taiwan (China); Pi, T. W. [National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan (China)

2012-10-22T23:59:59.000Z

446

Midlatitude Continental Convective Clouds Experiment (MC3E)  

SciTech Connect

Convective processes play a critical role in the Earths energy balance through the redistribution of heat and moisture in the atmosphere and subsequent impacts on the hydrologic cycle. Global observation and accurate representation of these processes in numerical models is vital to improving our current understanding and future simulations of Earths climate system. Despite improvements in computing power, current operational weather and global climate models are unable to resolve the natural temporal and spatial scales that are associated with convective and stratiform precipitation processes; therefore, they must turn to parameterization schemes to represent these processes. In turn, the physical basis for these parameterization schemes needs to be evaluated for general application under a variety of atmospheric conditions. Analogously, space-based remote sensing algorithms designed to retrieve related cloud and precipitation information for use in hydrological, climate, and numerical weather prediction applications often rely on physical parameterizations that reliably translate indirectly related instrument measurements to the physical quantity of interest (e.g., precipitation rate). Importantly, both spaceborne retrieval algorithms and model convective parameterization schemes traditionally rely on field campaign data sets as a basis for evaluating and improving the physics of their respective approaches. The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the AprilMay 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administrations (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available. Several different components of convective cloud and precipitation processes tangible to both the convective parameterization and precipitation retrieval algorithm problem are targeted, such as preconvective environment and convective initiation, updraft/downdraft dynamics, condensate transport and detrainment, precipitation and cloud microphysics, spatial and temporal variability of precipitation, influence on the environment and radiation, and a detailed description of the large-scale forcing.

Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

2010-04-01T23:59:59.000Z

447

Bangladesh-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Bangladesh-Pilot Program for Climate Resilience (PPCR) Bangladesh-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Bangladesh-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Bangladesh UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

448

Zambia-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Zambia-Pilot Program for Climate Resilience (PPCR) Zambia-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Zambia-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Zambia UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

449

Jamaica-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Jamaica-Pilot Program for Climate Resilience (PPCR) Jamaica-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Jamaica-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Jamaica UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

450

U.S. LNG Imports from Other Countries  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

451

U.S. LNG Imports from Egypt  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

452

U.S. LNG Imports from Malaysia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

453

U.S. LNG Imports from Peru  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

454

U.S. LNG Imports from Trinidad/Tobago  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

455

U.S. LNG Imports from Algeria  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

456

Haiti-Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Haiti-Pilot Program for Climate Resilience (PPCR) Haiti-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Haiti-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Haiti UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

457

Saint Lucia-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Saint Lucia-Pilot Program for Climate Resilience (PPCR) Saint Lucia-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Saint Lucia-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Saint Lucia UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

458

Grenada-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Grenada-Pilot Program for Climate Resilience (PPCR) Grenada-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Grenada-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Grenada UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

459

Mozambique-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Mozambique-Pilot Program for Climate Resilience (PPCR) Mozambique-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Mozambique-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Mozambique UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

460

U.S. Natural Gas Imports by Country  

Gasoline and Diesel Fuel Update (EIA)

May-13 Jun-13 Jul-13 Aug-13 Sep-13 Oct-13 View May-13 Jun-13 Jul-13 Aug-13 Sep-13 Oct-13 View History Import Volumes Total 234,183 236,690 236,199 236,248 244,966 208,895 1973-2013 Pipeline 228,558 228,644 228,087 227,439 228,016 203,337 1997-2013 Canada 228,544 228,616 227,905 227,274 227,868 203,173 1973-2013 Mexico 14 28 182 164 148 164 1973-2013 LNG 5,626 8,046 8,111 8,809 16,950 5,559 1997-2013 Algeria 0 0 0 0 0 0 1973-2013 Australia 0 0 0 0 0 0 1973-2013 Brunei 0 0 0 0 0 0 2001-2013 Canada 0 0 88 139 139 79 2013-2013 Egypt 0 0 0 0 0 0 2005-2013 Equatorial Guinea 0 0 0 0 0 0 2007-2013 Indonesia 0 0 0 0 0 0 1997-2013 Malaysia 0 0 0 0 0 0 1999-2013 Nigeria 0 0 0 0 2,590 0 1997-2013 Norway 0 0 0 2,709 2,918 0 2007-2013 Oman

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Microsoft Word - table_08.doc  

Gasoline and Diesel Fuel Update (EIA)

4 4 Table 8. Summary of U.S. natural gas imports, 2007-2011 Imports Volume (million cubic feet) Pipeline Canada a 3,782,708 3,589,089 3,271,107 3,279,752 3,117,081 Mexico 54,062 43,314 28,296 29,995 2,672 Total Pipeline Imports 3,836,770 3,632,403 3,299,402 3,309,747 3,119,753 LNG Algeria 77,299 0 0 0 0 Egypt 114,580 54,839 160,435 72,990 35,120 Equatorial Guinea 17,795 0 0 0 0 Nigeria 95,028 12,049 13,306 41,733 2,362 Norway 0 14,882 29,327 26,014 15,175 Peru 0 0 0 16,045 16,620 Qatar 18,352 3,108 12,687 45,583 90,972 Trinidad/Tobago 447,758 266,821 236,202 189,748 128,620 Yemen 0 0 0 38,897 60,071 Total LNG Imports 770,812 351,698

462

U.S. LNG Imports from Nigeria  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

463

U.S. LNG Imports from Qatar  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

464

U.S. LNG Imports from Yemen  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

465

U.S. Total Exports  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

466

U.S. LNG Imports from Indonesia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

467

U.S. Natural Gas Imports by Country  

Gasoline and Diesel Fuel Update (EIA)

2007 2008 2009 2010 2011 2012 View 2007 2008 2009 2010 2011 2012 View History Import Volumes Total 4,607,582 3,984,101 3,751,360 3,740,757 3,468,693 3,137,789 1973-2012 Pipeline 3,836,770 3,632,403 3,299,402 3,309,747 3,119,753 2,963,140 1985-2012 Canada 3,782,708 3,589,089 3,271,107 3,279,752 3,117,081 2,962,827 1973-2012 Mexico 54,062 43,314 28,296 29,995 2,672 314 1973-2012 LNG 770,812 351,698 451,957 431,010 348,939 174,649 1985-2012 Algeria 77,299 0 0 0 0 0 1973-2012 Australia 0 0 0 0 0 0 1973-2012 Brunei 0 0 0 0 0 0 1997-2012 Egypt 114,580 54,839 160,435 72,990 35,120 2,811 2005-2012 Equatorial Guinea 17,795 0 0 0 0 0 2007-2012 Indonesia 0 0 0 0 0 0 1986-2012 Malaysia 0 0 0 0 0 0 1997-2012 Nigeria 95,028 12,049 13,306 41,733 2,362 0 1997-2012

468

Dominica-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Dominica-Pilot Program for Climate Resilience (PPCR) Dominica-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Dominica-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Dominica UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

469

U.S. Price of Liquefied Natural Gas Imports by Point of Entry  

U.S. Energy Information Administration (EIA) Indexed Site

Apr-13 May-13 Jun-13 Jul-13 Aug-13 Sep-13 View Apr-13 May-13 Jun-13 Jul-13 Aug-13 Sep-13 View History U.S. Total 4.90 4.51 8.65 4.59 7.42 9.96 1997-2013 From Canada -- -- -- 13.37 13.54 10.52 2013-2013 Highgate Springs, VT 13.37 13.54 10.52 2013-2013 From Algeria -- -- -- -- -- -- 1989-2013 From Australia -- -- -- -- -- -- 1997-2013 From Brunei -- -- -- -- -- -- 2001-2013 From Egypt -- -- -- -- -- -- 2003-2013 Cameron, LA 2011-2011 Elba Island, GA 2011-2012 Freeport, TX 2011-2011 Gulf LNG, MS 2011-2011 From Equatorial Guinea -- -- -- -- -- -- 2007-2013 From Indonesia -- -- -- -- -- -- 1997-2013 From Malaysia -- -- -- -- -- -- 1999-2013 From Nigeria -- -- -- -- -- 15.74 1994-2013 Cove Point, MD 15.74 2011-2013 From Norway -- -- -- -- 14.85 14.85 2007-2013

470

Yemen-Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Yemen-Pilot Program for Climate Resilience (PPCR) Yemen-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Yemen-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Yemen UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

471

U.S. LNG Imports from Canada  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

472

Samoa-Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Samoa-Pilot Program for Climate Resilience (PPCR) Samoa-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Samoa-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Samoa UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

473

Nepal-Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Nepal-Pilot Program for Climate Resilience (PPCR) Nepal-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Nepal-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Nepal UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

474

U.S. LNG Imports from Norway  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

475

U.S. LNG Imports from Australia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

476

U.S. LNG Imports from United Arab Emirates  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

477

Experimental study of boninite genesis  

SciTech Connect

Seven boninitic compositions from 4 localities, i.e., Troodos (arakapas and Margi), Cyprus (2), Setouchi volcano belt, Japan (2), Bonin Island (1) and Cape Vogel, Papua New Guinea (2), ranging from high-CaO, low-SiO/sub 2/ to low-CaO, high SiO/sub 2/ and showing characteristics of primitive magmas, have been studied in gas-mixing furnaces at 1 atm. and in IHPV experiments between 1 and 10 kbar. Experimental starting materials were 9-element gels with major element compositions equivalent to the natural rocks. At 1 atm. Troodos (Arakapas) and the two Japan samples show opx/clino-en. with olivine in a near liquidus temperature interval (1210-1275 C), whereas the Troodos (Margi), the Bonin and the two Cape Vogel samples only give opx/clino-en. with liquidus temperatures between 1250 and 1380. Two kinds of IHPV experiments were done; firstly a study of near liquidus phase relations and secondly, reequilibration of starting compositions with natural harzburgite capsule linings, both at variable P, T and X/sub water/ conditions. Magma compositions can be explained in terms of P, T, X/sub water/ conditions and extend of melting of a variably refractory mantle source.

Van Der Laan, S.R.; Flower, M.F.J.; Koster Van Groos, A.F.

1985-01-01T23:59:59.000Z

478

The bovine tuberculosis burden in cattle herds in zones with low dose radiation pollution in the Ukraine  

SciTech Connect

The authors describe a study of the tuberculosis (TB) incidence in cattle exposed to low doses of radiation resulting from the Chernobyl (pronounced Chornobyl in Ukrainian) nuclear plant catastrophe in 1986. The purpose of the study was to determine if ionising radiation influences the number of outbreaks of bovine TB and their severity on farms in the Kyiv, Cherkasy and Chernigiv regions of the Ukraine. These farms are all located within a 200 km radius of Chernobyl and have had low?dose radiation pollution. Pathological and blood samples were taken from cattle in those regions that had positive TB skin tests. Mycobacterium spp. were isolated, differentiated by PCR, analysed and tested in guinea?pigs and rabbits. Species differentiation showed a significant percentage of atypical mycobacteria, which resulted in the allergic reactions to tuberculin antigen in the skin test. Mixed infection of M. bovis and M. avium subsp. hominissuis was found in three cases. The results concluded that low?dose radiation plays a major role in the occurrence of bovine TB in regions affected by the Chernobyl nuclear disaster.

Weller, Richard E.; Skrypnyk, Artem; Zavgorodniy, Andriy; Stegniy, Borys; Gerilovych, Anton; Kutsan, Oleksandr; Pozmogova, Svitlana; Sapko, Svitlana

2009-02-01T23:59:59.000Z

479

LFSC - Linac Feedback Simulation Code  

SciTech Connect

The computer program LFSC () is a numerical tool for simulation beam based feedback in high performance linacs. The code LFSC is based on the earlier version developed by a collective of authors at SLAC (L.Hendrickson, R. McEwen, T. Himel, H. Shoaee, S. Shah, P. Emma, P. Schultz) during 1990-2005. That code was successively used in simulation of SLC, TESLA, CLIC and NLC projects. It can simulate as pulse-to-pulse feedback on timescale corresponding to 5-100 Hz, as slower feedbacks, operating in the 0.1-1 Hz range in the Main Linac and Beam Delivery System. The code LFSC is running under Matlab for MS Windows operating system. It contains about 30,000 lines of source code in more than 260 subroutines. The code uses the LIAR ('Linear Accelerator Research code') for particle tracking under ground motion and technical noise perturbations. It uses the Guinea Pig code to simulate the luminosity performance. A set of input files includes the lattice description (XSIF format), and plane text files with numerical parameters, wake fields, ground motion data etc. The Matlab environment provides a flexible system for graphical output.

Ivanov, Valentin; /Fermilab

2008-05-01T23:59:59.000Z

480

Carbobenzoxy amino acids: Structural requirements for cholecystokinin receptor antagonist activity  

SciTech Connect

The authors used dispersed acini prepared from guinea pig pancreas to examine 28 carbobenzoxy (CBZ) amino acids for their abilities to function as cholecystokinin receptor antagonists. All amino acid derivatives tested, except for CBZ-alanine, CBZ-glycine, and N alpha-CBZ- lysine, were able to inhibit the stimulation of amylase secretion caused by the C-terminal octapeptide of cholecystokinin. In general, there was a good correlation between the ability of a carbobenzoxy amino acid to inhibit stimulated amylase secretion and the ability of the amino acid derivative to inhibit binding of /sup 125/I-cholecystokinin. The inhibition of cholecystokinin-stimulated amylase secretion was competitive, fully reversible, and specific for those secretagogues that interact with the cholecystokinin receptor. The potencies with which the various carbobenzoxy amino acids inhibited the action of cholecystokinin varied 100-fold and CBZ-cystine was the most potent cholecystokinin receptor antagonist. This variation in potency was primarily but not exclusively a function of the hydrophobicity of the amino acid side chain.

Maton, P.N.; Sutliff, V.E.; Jensen, R.T.; Gardner, J.D.

1985-04-01T23:59:59.000Z

Note: This page contains sample records for the topic "latvia gv guinea" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Quantitative structure-activity relationships (QSAR) of some 2,2-diphenyl propionate (DPP) derivatives of muscarinic antagonists  

SciTech Connect

QSAR between biological activities and molecular-chemical properties were investigated to aid in designing more effective and potent antimuscarinic pharmacophores. A molecular modeling program was used to calculate geometrical and topological values of a series of DPP pharmacophores. The newly synthesized pharmacophores were tested for their antagonist activities by: (1) inhibition of (N-methyl-/sup 3/H)scopolamine binding assay to the muscarinic receptors of N4TG1 neuroblastoma cells; (2) blocking of acetylcholine-induced contraction of guinea pig ileum; and (3) inhibition of carbachol-induced ..cap alpha..-amylase release from rat pancreas. The differences in the log of these biological activities were directly and significantly related to the distances between the carbonyl oxygen of the DPP and the quaternary nitrogen of the modified pharmacophores. The biological activities, while depending on each particular assay, varied between three and four logs of activity. The charge remained the same in all the pharmacophores. There were no QSAR correlations between molecular volume, molecular connectivity, or principle moments and their antagonistic activities, although multivariate QSAR was not employed. Thus, based on distance geometry, potent muscarinic pharmacophores can be predicted.

Gordon, R.K.; Breuer, E.; Padilla, F.N.; Chiang, P.K.

1987-05-01T23:59:59.000Z

482

A P2 and P3 substrate specificity comparison between the Murray Valley encephalitis and West Nile virus NS2B/NS3 protease using C-terminal agmatine dipeptides  

Science Journals Connector (OSTI)

Abstract The Murray Valley encephalitis virus (MVEV) and the West Nile virus (WNV) are mosquito-borne single-stranded RNA Flaviviruses responsible for many cases of viral encephalitis and deaths worldwide. The former is endemic in north Australia and Papua New Guinea while the latter has spread to different parts of the world and was responsible for a recent North American outbreak in 2012, resulting in 243 fatalities. There is currently no approved vaccines or drugs against MVEV and WNV viral infections. A plausible drug target is the viral non-structural NS2B/NS3 protease due to its role in viral replication. This trypsin-like serine protease recognizes and cleaves viral polyproteins at the C-terminal end of an arginine residue, opening an avenue for the development of peptide-based antivirals. This communication compares the P2 and P3 residue preferences of the MVEV and WNV NS2B/NS3 proteases using a series of C-terminal agmatine dipeptides. Our results revealed that both viral enzymes were highly specific toward lysines at the P2 and P3 positions, suggesting that a peptidomimetic viral protease inhibitor developed against one virus should also be active against the other.

Melgious Jin Yan Ang; Zhitao Li; Huichang Annie Lim; Fui Mee Ng; Siew Wen Then; John Liang Kuan Wee; Joma Joy; Jeffrey Hill; C.S. Brian Chia

2014-01-01T23:59:59.000Z

483

Establishing a Point of Departure for Risk Assessment Using Acute Inhalation Toxicology Data  

SciTech Connect

A simple method is presented for estimating a non-lethal level for inhalation toxicity studies. By reviewing 209 LC50 studies representing 96 chemicals that also reported a non-lethal level, it has been shown that taking 1/3 of the LC50 is a conservative estimate for a non-lethal exposure level. This approach was also compared to studies with LC01 and BMCL05 calculations. In the 38 studies that reported either of these values, again taking 1/3 of the LC50 provided a more conservation estimate for the non-lethal threshold. The studies included time intervals from 5 minutes out to 8 hours and utilized multiple species such as the rat, mouse, hamster, guinea pig and dog. In all but 13 cases, taking 1/3 of the LC50 provided a more conservative estimate for a non-lethal exposure level compared to the experimentally observed value. In all but one of the 13 cases, the higher values were consequences of the selection of the exposure levels.

Bast, Cheryl B [ORNL; Rusch, George M. [Honeywell International; Cavender, Finis [Consultant

2009-01-01T23:59:59.000Z

484

BM-520, an original TXA2 modulator, inhibits the action of thromboxane A2 and 8-iso-prostaglandin F2? in vitro and in vivo on human and rodent platelets, and aortic vascular smooth muscles from rodents  

Science Journals Connector (OSTI)

Thromboxane A2 (TXA2) and 8-iso-PGF2? are two prostanoid agonists of the thromboxane A2 receptor (TP), whose activation has been involved in platelet aggregation and atherosclerosis. Agents able to counteract the actions of these agonists are of great interest in the treatment and prevention of cardiovascular events. Here, we investigated in vitro and in vivo the pharmacological profile of BM-520, a new TP antagonist. In our experiments, this compound showed a great binding affinity for human washed platelets TP receptors, and prevented human platelet activation and aggregation induced by U-46619, arachidonic acid and 8-iso-PGF2?. The TP receptor antagonist property of BM-520 was confirmed by its relaxing effect on rat aorta smooth muscle preparations precontracted with U-46619 and 8-iso-PGF2?. Further, its TP antagonism was also demonstrated in vivo in guinea pig after a single intravenous injection (10mgkg?1). We conclude that this novel TP antagonist could be a promising therapeutic tool in pathologies such as atherosclerosis where an increased production of TXA2 and 8-iso-PGF2?, as well as TP activation are well-established pathogenic events.

S. Rolin; J. Hanson; C. Vastersaegher; C. Cherdon; D. Pratico; B. Masereel; J.M. Dogne

2007-01-01T23:59:59.000Z

485

An environmental mapping methodology adapted to the needs of petroleum operators  

SciTech Connect

Environmental mapping programs were carried out in three countries of intensive petroleum activity, located in the Gulf of Guinea: Gabon, Nigeria and Congo. The aim was to produce maps of environmental sensitive variables (thematic maps), which are used by the petroleum operating companies for improving the management of the environment. The maps are particularly useful for oil spill response organization or environmental assistance in the development of infrastructures. Whilst carrying out these applications, a mapping methodology adapted to the petroleum industry was developed and tested. In the first section, this methodology is described and illustrated by the above mentioned applications. The specific locations are selected according to their ecological, socioeconomic or petroleum special interest. Remote sensing data are used as an initial source of information. Two types of thematic maps are produced the first one dedicated to the ecological components, and the second one to the infrastructures and the environmental sensitivity, assessed from the ecological and socio-economical components. These maps can be integrated into atlases with accompanying text, and in order to make them more operational, all the mapping data collected are integrated into a Geographical Information System (GIS). In the second section, we present the innovative aspects of these R&D works, which concern mainly the adaptation of remote sensing for the environmental expertise and the use of GIS for full data integration and easy updating.

Veyradier, L.; Coquelet, D.; Dutrieux, E.

1996-12-31T23:59:59.000Z

486

Arsenic in shrimp from Kuwait  

SciTech Connect

Arsenic is ubiquitous in the environment and can accumulate in food via contaminated soil, water or air. It enters the food chain through dry and wet atmospheric deposition. Combustion of oil and coal, use of arsenical fertilizers and pesticides and smelting of ores contributes significantly to the natural background of arsenic in soils and sediments. The metal can be transferred from soil to man through plants. In spite of variation in acute, subacute, and chronic toxic effects to plants and animals, evidence of nutritional essentiality of arsenic for rats, goats, and guinea pigs has been suggested, but has not been confirmed for humans. Adverse toxic effects of arsenic as well as its widespread distribution in the environment raises concern about levels of arsenic in man`s diet. Higher levels of arsenic in the diet can result in a higher accumulation rate. Arsenic levels in marine organisms are influenced by species differences, size of organism, and human activities. Bottom dwellers such as shrimp, crab, and lobster accumulate more arsenic than fish due to their frequent contact with bottom sediments. Shrimp constitute approximately 30% of mean total seafood consumption in Kuwait. This study was designed to determine the accumulation of arsenic in the commercially important jinga shrimp (Metapenaeus affinis) and grooved tiger prawn (Penaeus semisulcatus). 13 refs., 3 figs., 1 tab.

Bou-Olayan, A.H. [Kuwait Univ. (Kuwait); Al-Yakoob, S.; Al-Hossaini, M. [Kuwait Institute for Scientific Research (Kuwait)

1995-04-01T23:59:59.000Z

487

U.S. Liquefied Natural Gas Imports by Point of Entry  

U.S. Energy Information Administration (EIA) Indexed Site

5,171 5,626 8,046 8,111 8,809 16,950 1997-2013 5,171 5,626 8,046 8,111 8,809 16,950 1997-2013 From Canada 0 0 0 88 139 139 2013-2013 Highgate Springs, VT 88 139 139 2013-2013 From Algeria 0 0 0 0 0 0 1973-2013 From Australia 0 0 0 0 0 0 1973-2013 From Brunei 0 0 0 0 0 0 2001-2013 From Egypt 0 0 0 0 0 0 2005-2013 Cameron, LA 2011-2011 Elba Island, GA 2011-2012 Freeport, TX 2011-2011 Gulf LNG, MS 2011-2011 From Equatorial Guinea 0 0 0 0 0 0 2007-2013 From Indonesia 0 0 0 0 0 0 1997-2013 From Malaysia 0 0 0 0 0 0 1999-2013 From Nigeria 0 0 0 0 0 2,590 1997-2013 Cove Point, MD 2,590 2011-2013 From Norway 0 0 0 0 2,709 2,918 2007-2013 Cove Point, MD 2011-2011 Freeport, TX 2,709 2,918 2013-2013 Sabine Pass, LA 2011-2012 From Oman 0 0 0 0 0 0 2000-2013 From Peru

488

PowerPoint Presentation  

U.S. Energy Information Administration (EIA) Indexed Site

LNG LNG World LNG Imports 1964 - 2007 World LNG Imports 1964 - 2007 0 20 40 60 80 100 120 140 160 180 200 1964 1968 1972 1976 1980 1984 1988 1992 1996 2000 2004 Americas Total Europe Total Asia in mtpa 7.7%pa 2 LNG 0 4 8 12 16 1 9 6 8 1 9 7 3 1 9 7 8 1 9 8 3 1 9 8 8 1 9 9 3 1 9 9 8 2 0 0 3 Algeria Trinidad Egypt Nigeria Eq. Guinea M. East Pacific Basin in mtpa US LNG Imports by Source 1968-2007 US LNG Imports by Source 1968-2007 3 LNG Regional LNG Production 1990 - 2007 Regional LNG Production 1990 - 2007 0 20 40 60 80 100 120 140 160 1990 1992 1994 1996 1998 2000 2002 2004 2006 in mtpa Pacific Basin Middle East Atlantic Basin 4 LNG The Importance of the Middle East - Incremental Liquefaction Capacity 2008- 2012 The Importance of the Middle East - Incremental Liquefaction Capacity 2008- 2012 0 25 50 75 100 2008 2009 2010 2011 2012 Rest of the World Qatar Yemen in mtpa 5 LNG Regas

489

Tajikistan-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Tajikistan-Pilot Program for Climate Resilience (PPCR) Tajikistan-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Tajikistan-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Tajikistan UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

490

Bolivia-Pilot Program for Climate Resilience (PPCR) | Open Energy  

Open Energy Info (EERE)

Bolivia-Pilot Program for Climate Resilience (PPCR) Bolivia-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Bolivia-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Bolivia UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

491

Niger-Pilot Program for Climate Resilience (PPCR) | Open Energy Information  

Open Energy Info (EERE)

Niger-Pilot Program for Climate Resilience (PPCR) Niger-Pilot Program for Climate Resilience (PPCR) Jump to: navigation, search Name Niger-Pilot Program for Climate Resilience (PPCR) Agency/Company /Organization World Bank Sector Energy, Land Topics Background analysis, Finance, Implementation, Low emission development planning, Market analysis Website http://www.climateinvestmentfu Country Niger UN Region Southern Asia References Pilot Program for Climate Resilience (PPCR)[1] Contents 1 Overview 2 Programs by Country 2.1 Bangladesh 2.2 Bolivia 2.3 Cambodia 2.4 Dominica 2.5 Grenada 2.6 Haiti 2.7 Jamaica 2.8 Mozambique 2.9 Nepal 2.10 Niger 2.11 Papua New Guinea 2.12 Saint Lucia 2.13 Saint Vincent and the Grenadines 2.14 Samoa 2.15 Tajikistan 2.16 Tonga 2.17 Yemen 2.18 Zambia 3 References Overview "The Pilot Program for Climate Resilience (PPCR), approved in November

492

Animal testing of beauty products  

NLE Websites -- All DOE Office Websites (Extended Search)

Animal testing of beauty products Animal testing of beauty products Name: Wayers Location: N/A Country: N/A Date: N/A Question: I consider animal testing to be cruel and unnecessary in most cases. I do not disapprove entirely with the testing of drugs and beneficial technology on animals; but I completely have a problem with testing unimportant items, such as make up, hair spray, and other beauty products on innocent lives. Are there any other methods of testing companies can use that wouldn't involve the harming of animals? Wayers Replies: Experience, theoretical models and testing on cell cultures can offer guidelines for a good guess as to what will happen when you throw some new chemical into a human body, but there are examples of where even very careful guesses have proved in practice to be terribly wrong (Thalidomide and DES come to mind). Given the very high level of safety that people demand from substances that go in or on their bodies, the only testing method that is considered reliable enough at present for new chemicals is to try the stuff out on some living creature that can tell you if it hurts or is sick. And even then you must be sure the creature is as similar as possible, at least in the part of the body you are worried about, to human beings. (This is itself a real challenge, and progress in treating disease is often hampered by the lack of a suitable animal model.) Thus ultimately comes the difficult ethical choice you are concerned with: namely, who or what gets to be the guinea pig? In terms of beauty products, there are enough people who feel as you do that there are a number of product lines which are guaranteed to be made without animal testing (they use ingredients that have been tested earlier on animals and are now recognized as safe). You can find them in natural foods and ecologically-conscious stores.

493

Mechanisms of aldehyde-induced bronchial reactivity: role of airway epithelium  

SciTech Connect

To investigate the relative irritant potencies of inhaled aldehydes, guinea pigs were exposed to formaldehyde or acrolein and specific total pulmonary resistance and bronchial reactivity to intravenous acetylcholine were assessed. The mechanisms associated with these responses were investigated by analyzing morphologic and biochemical changes in airway epithelial cells after in vivo and in vitro exposures. Immediately after exposure to formaldehyde or acrolein, specific resistance increased transiently and returned to control values within 30 to 60 minutes. Bronchial hyperreactivity, assessed by the acetylcholine dose necessary to double resistance, increased and became maximal two to six hours after exposure to at least 9 parts per million2 (ppm) formaldehyde or at least 1 ppm acrolein for two hours. The effect of exposure to 3 ppm formaldehyde for two hours was less than the effect of exposure to 1 ppm formaldehyde for eight hours; thus, extended exposures produced a disproportionate heightening of bronchial reactivity. Bronchial hyperreactivity often persisted for longer than 24 hours. Increases in three bronchoconstrictive eicosanoids, prostaglandin F2 alpha, thromboxane B2, and leukotriene C4, occurred immediately after exposure, whereas an influx of neutrophils into lavage fluid occurred 24 hours later. Histological examination of the tracheal epithelium and lamina propria also demonstrated a lack of inflammatory cell infiltration. Treatment with leukotriene synthesis inhibitors and receptor antagonists inhibited acrolein-induced hyperreactivity, supporting a causal role for these compounds in this response. Acrolein also stimulated eicosanoid release from bovine epithelial cells in culture. However, the profile of metabolites formed differed from that found in lavage fluid after in vivo exposure.

Leikauf, G.D. (Department of Environmental Health, University of Cincinnati Medical Center, OH (United States))

1992-02-01T23:59:59.000Z

494

The formation and maintenance of single-thread tie channels entering floodplain lakes: observations from three diverse river systems  

SciTech Connect

Tie channels connect rivers to floodplain lakes on many lowland rivers and thereby play a central role in floodplain sedimentology and ecology, yet they are generally unrecognized and little studied. here we report the results of field studies focused on tie channel origin and morphodynamics in three contrasting systems: the Middle Fly River, Papua New Guinea, the Lower Mississippi River, and Birch Creek in Alaska. Across these river systems, tie channels vary by an order of magnitude in size but exhibit the same characteristic morphology and appear to develop and evolve by a similar set of processes. In all three systems, the channels are characterized by a narrow, leveed single-thread morphology with maximum width approximately one tenth the width of the mainstem river. The channels typically have a V shaped cross-section, unlike most fluvial channels. These channels develop as lakes become isolated from the river by sedimentation. Narrowing of the connection between river and lake causes a sediment-laden jet to develop. Levees develop along the margins of the jet leading to channel emergence and eventual levee aggradation to the height of the mainstem levees. Bi-directional flow in these channels is common. Outflows from the lake scour sediment and prevent channel blockage. We propose that channel geometry and size are then controlled by a dynamic balance between channel narrowing by suspended sediment deposition and incision and widening by mass failure of banks during outflows. Tie channels are laterally stable and may convey flow for hundreds to a few thousand of years.

Rowland, Joel C [Los Alamos National Laboratory; Dietrich, William E [UC BERKELEY; Day, Geoff [NEWCREST MINING; Parker, Gary [UNIV OF ILLINOIS

2009-01-01T23:59:59.000Z

495

Inter-annual Tropospheric Aerosol Variability in Late Twentieth Century and its Impact on Tropical Atlantic and West African Climate by Direct and Semi-direct Effects  

SciTech Connect

A new high-resolution (0.9$^{\\circ}$x1.25$^{\\circ}$ in the horizontal) global tropospheric aerosol dataset with monthly resolution is generated using the finite-volume configuration of Community Atmosphere Model (CAM4) coupled to a bulk aerosol model and forced with recent estimates of surface emissions for the latter part of twentieth century. The surface emissions dataset is constructed from Coupled Model Inter-comparison Project (CMIP5) decadal-resolution surface emissions dataset to include REanalysis of TROpospheric chemical composition (RETRO) wildfire monthly emissions dataset. Experiments forced with the new tropospheric aerosol dataset and conducted using the spectral configuration of CAM4 with a T85 truncation (1.4$^{\\circ}$x1.4$^{\\circ}$) with prescribed twentieth century observed sea surface temperature, sea-ice and greenhouse gases reveal that variations in tropospheric aerosol levels can induce significant regional climate variability on the inter-annual timescales. Regression analyses over tropical Atlantic and Africa reveal that increasing dust aerosols can cool the North African landmass and shift convection southwards from West Africa into the Gulf of Guinea in the spring season in the simulations. Further, we find that increasing carbonaceous aerosols emanating from the southwestern African savannas can cool the region significantly and increase the marine stratocumulus cloud cover over the southeast tropical Atlantic ocean by aerosol-induced diabatic heating of the free troposphere above the low clouds. Experiments conducted with CAM4 coupled to a slab ocean model suggest that present day aerosols can shift the ITCZ southwards over the tropical Atlantic and can reduce the ocean mixed layer temperature beneath the increased marine stratocumulus clouds in the southeastern tropical Atlantic.

Evans, Katherine J [ORNL; Hack, James J [ORNL; Truesdale, John [National Center for Atmospheric Research (NCAR); Mahajan, Salil [ORNL; Lamarque, J-F [University Center for Atmospheric Research

2012-01-01T23:59:59.000Z

496

Calcium homeostasis of isolated heart muscle cells exposed to pulsed high-frequency electromagnetic fields  

SciTech Connect

The intracellular calcium concentration ([Ca{sup 2+}]{sub i}) of isolated ventricular cardiac myocytes of the guinea pig was measured during the application of pulsed high-frequency electromagnetic fields. The high-frequency fields were applied in a transverse electromagnetic cell designed to allow microscopic observation of the myocytes during the presence of the high-frequency fields. The [Ca{sup 2+}]{sub i} was measured as fura-2 fluorescence by means of digital image analysis. Both the carrier frequency and the square-wave pulse-modulation pattern were varied during the experiments (carrier frequencies: 900, 1,300, and 1,800 MHz pulse modulated at 217 Hz with 14% duty cycle; pulsation pattern at 900 MHz; continuous wave, 16 Hz,and 50 Hz modulation with 50% duty cycle and 30 kHz modulation with 80% duty cycle). The mean specific absorption rate (SAR) values in the solution were within one order of magnitude of 1 mW/kg. They varied depending on the applied carrier frequency and pulse pattern. The experiments were designed in three phases: 500 s of sham exposure, followed by 500 s of field exposure, then chemical stimulation without field. The chemical stimulation (K{sup +}-depolarization) indicated the viability of the cells. The K{sup +} depolarization yielded a significant increase in [Ca{sup 2+}]{sub i}. Significant differences between sham exposure and high-frequency field exposure were not found except when a very small but statistically significant difference was detected in the case of 900 MHz/50 Hz. However, this small difference was not regarded as a relevant effect of the exposure.

Wolke, S.; Gollnick, F.; Meyer, R. [Univ. Bonn (Germany)] [Univ. Bonn (Germany); Neibig, U.; Elsner, R. [Inst. fuer Nachrichtentechnik Braunschweig (Germany)] [Inst. fuer Nachrichtentechnik Braunschweig (Germany)

1996-05-01T23:59:59.000Z

497

Geology of oil fields and future exploration potential in west African Aptian Salt basin  

SciTech Connect

The Aptian Salt basin of west Africa, extends from Equatorial Guinea southward to Angola, contains recoverable reserves estimated at nearly 4 billion BOE, and is current producing 600,000 BOPD. The basin developed as a result of tensional forces between west Africa and South America initiated at the end of the Jurassic. The prospective sedimentary sequences ranged in age from Early Cretaceous (uppermost Jurassic in places) to Holocene and is divided by the Aptian transgressive sand and salt into a pre-salt, nonmarine, syn-rift sequence and a post-salt, marine, post-rift sequence. Both the pre- and post-salt sequences contain several successful exploration plays, the most prolific of which are the Early Cretaceous nonmarine sandstone fields in tilted fault blocks of Gabon and Cabinda; Early Cretaceous carbonate buildups on the margins of basement highs in Cabinda; Early Cretaceous transgressive marine sandstone fields in anticlines draped over basement highs in Gabon; Late Cretaceous shallow marine sandstone and carbonate fields in salt-related structures in the Congo, Zaire, Cabinda, and Angola; Late Cretaceous dolomites in structural/stratigraphic traps in Angola; Late Cretaceous/early Tertiary deltaic/estuarine sandstone traps formed by salt movement in Gabon, Cabinda, and angola; and Tertiary marine turbidite fields in Cabinda and Angola. Despite the exploration success in these trends, much of the basin is under or poorly explored. The major problems for exploration are the poor quality of seismic definition beneath the salt, which makes it difficult to predict pre-salt structure and stratigraphy, and the importance of a stratigraphic element in many of the post-salt traps, also difficult to detect on seismic.

Bignell, R.D.; Edwards, A.D.

1987-05-01T23:59:59.000Z

498

Chemical, biomedical and ecological studies of SRC-I materials from the Fort Lewis Pilot Plant: a status report  

SciTech Connect

This document discusses studies performed with solvent refined coal (SRC) materials obtained from the Fort Lewis Pilot Plant during operation in the SRC-I mode. The development of analytical methodology is presented as well as results obtained from the application of these methods to light oil (LO), wash solvent (WS) and process solvent (PS). Results of cellular and animal studies with LO, WS and PS are included, along with a description of methods for the generation and characterization of LO and PS aerosols, and for exposing rats, mice and guinea pigs to these aerosols. The effects of SRC-I product on seed germination and plant growth which have also been studied are discussed. The SRC-I product, feed coal and the mineral residue have been analyzed for organic and inorganic constituents. The higher-boiling-point material, PS, exhibited significant mutagenic activity in the Ames assay; LO and WS were inactive. Process solvent also caused transformation of cultured Syrian hamster embryo cells. Additional chemical fractionation studies suggest that primary aromatic amines are major determinants of the observed mutagenic activity. Skin-painting studies with SRC-II naphtha, heavy distillate, shale oil and petroleum crude indicate a good correlation between the results of the cellular assays and skin carcinogenesis in mice. Wash solvent was more toxic after oral administration to rats than was light oil or process solvent. The effects of LO, WS and PS on development were studied after administration to pregnant rats. The tissue distribution of a number of components of PS was studied after oral administration of PS to rats. The effect of SRC-I product on the germination and growth of barley was investigated by mixing or layering the product with soil and placing the mixture in a field lysimeter.

Mahlum, D.D. (ed.)

1981-01-01T23:59:59.000Z

499

Dielectric-Lined High-Gradient Accelerator Structure  

SciTech Connect

Rectangular particle accelerator structures with internal planar dielectric elements have been studied, with a view towards devising structures with lower surface fields for a given accelerating field, as compared with structures without dielectrics. Success with this concept is expected to allow operation at higher accelerating gradients than otherwise on account of reduced breakdown probabilities. The project involves studies of RF breakdown on amorphous dielectrics in test cavities that could enable high-gradient structures to be built for a future multi-TeV collider. The aim is to determine what the limits are for RF fields at the surfaces of selected dielectrics, and the resulting acceleration gradient that could be achieved in a working structure. The dielectric of principal interest in this study is artificial CVD diamond, on account of its advertised high breakdown field ({approx}2 GV/m for dc), low loss tangent, and high thermal conductivity. Experimental studies at mm-wavelengths on materials and structures for achieving high acceleration gradient were based on the availability of the 34.3 GHz third-harmonic magnicon amplifier developed by Omega-P, and installed at the Yale University Beam Physics Laboratory. Peak power from the magnicon was measured to be about 20 MW in 0.5 {micro}s pulses, with a gain of 54 dB. Experiments for studying RF high-field effects on CVD diamond samples failed to show any evidence after more than 10{sup 5} RF pulses of RF breakdown up to a tangential surface field strength of 153 MV/m; studies at higher fields were not possible due to a degradation in magnicon performance. A rebuild of the tube is underway at this writing. Computed performance for a dielectric-loaded rectangular accelerator structure (DLA) shows highly competitive properties, as compared with an existing all-metal structure. For example, comparisons were made of a DLA structure having two planar CVD diamond elements with a all-metal CERN structure HDS operating at 30 GHz. It was shown that the ratio of maximum surface electric field to accelerating field at the metal wall is only 0.35-0.4 for DLA, much smaller than the value 2.2 for HDS; and the ratio of surface magnetic field to accelerating field is 3.0 mA/V for DLA, compared with 3.45 mA/V for HDS. These values bode well for DLA in helping to avoid breakdown and to reducing pulsed surface heating and fatigue. The shunt impedance is found to be 160-175 M{Omega}/m for DLA, as compared to 99 M{Omega}/m for HDS. Conclusions are reached from this project that CVD diamond appears promising as a dielectric with a high threshold for RF breakdown, and that rectangular accelerator structures can be devised using planar CVD diamond elements that could be operated at higher acceleration gradients with low probability of RF breakdown, as compared with corresponding all-metallic structures.

Jay L. Hirshfield

2012-04-24T23:59:59.000Z

500

U.S. Total Exports  

U.S. Energy Information Administration (EIA) Indexed Site

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual