Sample records for lajos grof-tisza doc

  1. Appendix 7 - Stripes Architecture Overview

    Broader source: Energy.gov (indexed) [DOE]

    Name: Department of Energy iManage Program Project ID: iManage Program STRIPES Project Project Manager: Mathew Sparks Program Mgr: Lajos Grof-Tisza Doc ID: STRIPES Technical...

  2. exploringpowerpurchaseagreementsthebasicspart1.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1...

  3. DOCS SCMP (ANNOTATED OUTLINE)

    Broader source: Energy.gov (indexed) [DOE]

    NMMSS PROJECT NMMSS UPGRADE SOFTWARE CONFIGURATION MANAGEMENT PLAN September 2001 Doc No: 135-PL-300A Revision: 1 REVIEWS AND APPROVALS Prepared by: ...

  4. Diversification (PROF DOC) at WVU

    E-Print Network [OSTI]

    Mohaghegh, Shahab

    announces the availability of two-year postdoctoral fellowship opportunities for highly qualified individuals from underrepresented groups with Ph.D.'s in the STEM disciplines. The PROF DOC postdoctoral university, orienting them to the academic profession. These two-year postdoctoral appointments come

  5. Microsoft Word - AL2006-02.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe District ofInstituteMicrosoft19.1, Summary of3.doc3.doc5.doc1.doc2

  6. FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code / ProDoc

    E-Print Network [OSTI]

    Twente, Universiteit

    INTAKE TGS FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code / ProDoc Message 1. Every new PhD candidate 1 is given the status '05 Invitation Intake TGS' (ProDoc Code) so that the new PhD's become visible for Twente Graduate School (TGS) in ProDoc. 2. The TGS

  7. Microsoft Word - U0163300.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434EA-1458

  8. Microsoft Word - U0179700.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434EA-1458700

  9. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434EA-1458700186600

  10. Microsoft Word - appxa.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: Woman Creek at West

  11. Microsoft Word - appxb.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: Woman Creek at30-Day

  12. Microsoft Word - appxd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: Woman Creek the

  13. Microsoft Word - cover.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: Woman

  14. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix A

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix AB

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABC

  17. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCD

  18. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCD

  19. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCDF

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCDFG

  1. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCDFG

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix ABCDFGI

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendix

  4. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendixK MMTS

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No.GS05: WomanAppendixK MMTS

  6. CH 6 REFERENCES.DOC 6-1 6 References

    E-Print Network [OSTI]

    REFERENCES.DOC Allan, S., A. R. Buckley, and J. E. Meacham. 2001. Atlas of Oregon. Second Edition. William J

  7. Microsoft Word - fal2004-04.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table7-11.doc More Documents

  8. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs...

  9. Microsoft Word - IMBA Gap Analysis Final 20060831.doc

    Broader source: Energy.gov (indexed) [DOE]

    Assurance ProcessProcedure (SQAPP) * User Interface Enhancement (UI) * DocumentationMedia (DOC) * Training (TRAIN) * Communications (COM) Table 4.2 Summary of Recommendations...

  10. Microsoft Word - GSP_Charter.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    U.S. Department of Energy Geospatial Sciences Program (GSP) Charter Microsoft Word - GSPCharter.doc More Documents & Publications Geospatial Science Program Mananagemnt Office...

  11. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a...

  12. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30T23:59:59.000Z

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  13. Microsoft Word - AL2006-07.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft3.doc7.doc

  14. Microsoft Word - AL2008-05.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc9.doc5.doc Microsoft

  15. Microsoft Word - AL2008-06.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc9.doc5.doc

  16. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  17. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Broader source: Energy.gov [DOE]

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  18. INFORMATION SECURITY POLICY.doc INFORMATION SECURITY POLICY

    E-Print Network [OSTI]

    Subramanian, Sriram

    - 1 ­ INFORMATION SECURITY POLICY.doc INFORMATION SECURITY POLICY Ratified by RCA Senate, February 2007 Contents Introduction 2 Policy Statement 3 Information Security at RCA 5 Annexes A. Applicable ­ INFORMATION SECURITY POLICY.doc Introduction Why Information Security? The access, availability

  19. car_app1.doc STAFF PARKING PERMIT APPLICATION

    E-Print Network [OSTI]

    Haase, Markus

    and drop off points Frequency of lifts (days per week) 6. Car Sharing You can share a group permit with upcar_app1.doc STAFF PARKING PERMIT APPLICATION The information supplied on this form will allow (whichever is quicker) from campus to home? (Departing campus at 1700 hours) #12;car_app1.doc 4. Staff

  20. FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code / ProDoc

    E-Print Network [OSTI]

    Twente, Universiteit

    QUALIFIER FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code / ProDoc Message 1. The first thing the PhD 1 can do after the draft T&SP is approved is plan a date (half year) after the start of your PhD project. A reminder email (09. Reminder plan qualifier date

  1. Microsoft Word - FeMoco.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPAURTeC:8CO 2Dances7,7,PropertyBSCFed.docFY140

  2. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's Possible for Renewable Energy:Nanowire3627 FederalTransformers |OJT!LSU/CAMD Procedure Doc.

  3. Microsoft Word - al2006-12.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc Microsoft

  4. Microsoft Word - al2007-11.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc Microsoft7-11

  5. Microsoft Word - AL2005-01.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc More Documents &

  6. Microsoft Word - AL2005-03.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc More DocumentsAL

  7. Microsoft Word - AL2005-07.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc MoreDOE Order 361.1A,

  8. Microsoft Word - AL2005-08.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc MoreDOE Order

  9. Microsoft Word - AL2005-10.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc MoreDOE Order0

  10. Microsoft Word - AL2005-11.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc MoreDOE1 Acquisition

  11. Microsoft Word - FAL2006-03.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc MicrosoftJanuary 27,Department4 Department

  12. Microsoft Word - ORSSAB Application, Sept. 2014.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulatorsMay2009.docENVIRONMENTAL

  13. Microsoft Word - final report.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment3311,Official File UnitedToOn4.doc MicrosoftSOFTWARE On

  14. Microsoft Word - GJPPGPracticesDraft.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependent ResearchFlash2008-08attachmentFAC22.doc More

  15. Microsoft Word - FAL2004-05.doc

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOfficeNOTICE:InspectionsMicrosoft Word - FAL2004-03.doc

  16. Ammendment 5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny: The Future of1Albuquerque, NM -AliciaBioenergy5.doc� Ammendment

  17. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, Disposal Site MayGroundwater09FormerlyGroundwater0 Doc.

  18. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S06815 Page 3-1

  19. Microsoft Word - TR05-09.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434 3.45-Year

  20. Microsoft Word - TR07-27.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434 3.45-YearBoiling

  1. Microsoft Word - appendix i.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434EA-145870018660009

  2. Microsoft Word - qa_plan1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreaking ofOil &315_ArnibanPriority DataPART 970 -7-11.doc MicrosoftRecordsSJ-RT

  3. Microsoft Word - AL2005-07.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc Microsoft7.doc

  4. Microsoft Word - AL2005-10.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc10.doc Microsoft

  5. Microsoft Word - AL2005-11.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc10.doc

  6. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc10.docMicrosoft

  7. Microsoft Word - AL2005-15.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft Word -5.doc

  8. Microsoft Word - AL2006-01.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft Word1.doc

  9. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft3.doc

  10. Microsoft Word - AL2006-09.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc9.doc Microsoft Word -

  11. Microsoft Word - AL2006-11.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc9.doc Microsoft

  12. Application for Presidential Permit OE Doc. No. PP-399 MATL LLP...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Presidential Permit OE Doc. No. PP-399 MATL LLP: Federal Register Notice, Volume 79, No. 93 - May 14, 2014 Application for Presidential Permit OE Doc. No. PP-399 MATL LLP: Federal...

  13. Doc'Up, association des doctorants de Sorbonne Universit Sige social : 15 rue de l'cole de mdecine, 75006 Paris

    E-Print Network [OSTI]

    Arleo, Angelo

    Doc'Up, association des doctorants de Sorbonne Université Siège social : 15 place Jussieu, 75252 Paris cedex 05 Association Doc'Up Site internet : www.doc-up.info Pour nous contacter : contact@doc-up.info Liste Doc'Up pour l'élection des

  14. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc Microsoft3.doc

  15. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc6-04.doc Microsoft

  16. Microsoft Word - FCL Testing Report Final.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc6-04.docAn

  17. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatusUNDERSTANDING2010 11.doc2.doc

  18. Microsoft Word - Public Comments EPAct 1817 061507.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER07.docFINAL.doc |ofNews i TABLE

  19. Microsoft Word - REMY_Comments Regarding ATVMLP.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER07.docFINAL.docWorkshopJeremiah

  20. Microsoft Word - canceled -7 Section A April 16 2010.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA p p r o v

  1. Microsoft Word - doe_mirant_order_sierraclub.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA p p20 th ,

  2. Microsoft Word - ex parte memo delaski cohen.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA p p20 On

  3. Microsoft Word - ieRoadmap Workshop_FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA

  4. Microsoft Word - johnson controls_EISA presentation_102208 _2_.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docADate:

  5. Microsoft Word - meritrev.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table7-11.doc More

  6. Microsoft Word - new council charter-2 _2_.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table7-11.doc MoreRecords

  7. Microsoft Word - AL2005-03.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc Microsoft Word

  8. Microsoft Word - AL2005-08.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc

  9. Microsoft Word - AL2005-14.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft Word -

  10. Microsoft Word - AL2005-16.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft Word

  11. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc Microsoft

  12. Microsoft Word - AL2006-08.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft4.doc

  13. DCLOSSP3.DOC ADAPTATION OF "SPICE3'' TO SIMULATION OF

    E-Print Network [OSTI]

    Palusinski, Olgierd A.

    DCLOSSP3.DOC ADAPTATION OF "SPICE3'' TO SIMULATION OF LOSSY MULTIPLE-COUPLED TRANSMISSION LINES simulation of transients in networks that include multiple, coupled lossy transmission lines. Widely used circuit simulator, SPICE, does not have facilities for simulation of multi-conductor transmission lines

  14. CV INA KONING Post-doc researcher at Utrecht University

    E-Print Network [OSTI]

    Oro, Daniel

    1 CV INA KONING Post-doc researcher at Utrecht University Universiteit Utrecht May 2011 ­ Present (1 year 11 months) PhD student on alcohol prevention among early adolescents Utrecht University March early adolescents and their parents. The project was carried out by the Utrecht University

  15. VISA -Mexico.doc March 2012 StudyAbroad@Exeter

    E-Print Network [OSTI]

    Mumby, Peter J.

    VISA - Mexico.doc March 2012 StudyAbroad@Exeter Visa info Mexico IMMIGRATION INFORMATION ­ MEXICO anticipated stay in Mexico with photocopy of photo page. Photographs Three passport-sized frontal photos entry into Mexico. · Within 30 days of arrival in Mexico the student must register at the National

  16. CDF/TOP/DOC/6265 Version 1.1

    E-Print Network [OSTI]

    CDF/TOP/DOC/6265 Version 1.1 January 14, 2003 Description of data samples for Top and Electroweak a complete description of the high p T electron and muon data samples which will be used for Top from the Top Group Data page http://www-cdf.fnal.gov/internal/physics/top/topdata/newtopdata.html 1

  17. VISA -Canada.doc March 2012 StudyAbroad@Exeter

    E-Print Network [OSTI]

    Mumby, Peter J.

    VISA - Canada.doc March 2012 StudyAbroad@Exeter Visa info Canada IMMIGRATION INFORMATION ­ CANADA are going to study in Canada for more than six months. If you are going to study in Canada for less than six be purchased at most major banks. This draft should be made payable to: THE RECEIVER GENERAL FOR CANADA Please

  18. Notes2Providers.doc -1-Notes to Retail Providers

    E-Print Network [OSTI]

    providers that purchase electricity from a power pool that submits an Annual Report to the Energy CommissionNotes2Providers.doc -1- Notes to Retail Providers February 2003 Power Source Disclosure an energy mix or fuel mix different than the California Mix, (Net System Power)i . As a retail provider you

  19. ________________________________________________________________ F. Ceriotti cv_ceriotti.doc 1/13

    E-Print Network [OSTI]

    Rodriguez, Carlos

    , upgraded to ISO 9001:2000 in July 2002 and to ISO #12 of Quality Manager for ISO 9000 Certification of the Clinical Laboratory (certification obtained in July 1998_ceriotti.doc 2/13 9001:2008 in October 2008). From November 2002 he has the title of Director for the area

  20. Electronics Division Technical Note No. 189 File: \\\\EAGLE\\cv-cdl-sis\\Docs\\Rack\\SIS Mixer Bias Supply\\Simulation\\Report2.doc Page 1 of 5

    E-Print Network [OSTI]

    Groppi, Christopher

    1 to protect the mixer junction from static discharge1 . The mixers are powered by bias suppliesElectronics Division Technical Note No. 189 File: \\\\EAGLE\\cv-cdl-sis\\Docs\\Rack\\SIS Mixer Bias Supply\\Simulation\\Report2.doc Page 1 of 5 Stability Analysis of SIS Mixer Bias Supply with 1K Ohm

  1. ProDoc guidelines for PhD candidates at the University of Twente INTRODUCTION

    E-Print Network [OSTI]

    Twente, Universiteit

    ProDoc guidelines for PhD candidates at the University of Twente INTRODUCTION ProDoc1 is the registration and monitoring system for PhD candidates at the University of Twente. All PhD candidates . The introduction of ProDoc per 1-1-2014 is accompanied by a PhD Charter3 and a revision of the Doctoral Regulations

  2. Version 3.0 SOP 7 --October 12, 2007 (DOC) (TDN)

    E-Print Network [OSTI]

    ). (grease) . 6.1 60 ml (HDPE) 10% 4 . polycarbonate inline filter DOC . 250 m GF/F . . GF/F Niskin polycarbonate inline

  3. CDF/TOP/DOC/6548 Version 1.1

    E-Print Network [OSTI]

    CDF/TOP/DOC/6548 Version 1.1 July 1, 2003 Description of data samples for Top Group for Summer 2003 T electron and muon data sam- ples which will be used for Top group analysis results for Summer 2003 conferences. Up-to-date information on these samples is available from the Top Group Data page http://www-cdf.fnal.gov/internal/physics/top

  4. NSF TRAINING MATRIX Topic Undergraduates Graduate Students PostDoc Faculty Administrative

    E-Print Network [OSTI]

    Yu, Gexin

    NSF TRAINING MATRIX 8/31/10 Topic Undergraduates Graduate Students PostDoc Faculty Administrative *Falsification Required/online ApSCI 604*open to Classroom trainingClassroom training all/list of enrollees Video to Corbett Online training required for Graduate students Required for PostDocs. On Being A Scientist

  5. Using Facebook and Google Docs for Teaching and Sharing Information Kanda Runapongsa Saikaew1

    E-Print Network [OSTI]

    Runapongsa, Kanda

    1 Using Facebook and Google Docs for Teaching and Sharing Information Kanda Runapongsa, Burapha University, Thailand #12;2 Using Facebook and Google Docs for Teaching and Sharing by doing and exploring. This paper presents the approach and the experience in using Facebook and Google

  6. ScopingStudyReport-AppxC-Homework-013105.doc -1 -DEMAND RESPONSE RESEARCH CENTER SCOPING

    E-Print Network [OSTI]

    ScopingStudyReport-AppxC-Homework-013105.doc - 1 - DEMAND RESPONSE RESEARCH CENTER SCOPING STUDYStudyReport-AppxC-Homework-013105.doc - 2 - Preparing for the Roundtable Session (HOMEWORK ASSIGNMENT) The PIER Demand Response that advances the near-term adoption of Demand Response technologies, policies, programs, strategies

  7. Business Expense Guidelines Page 1 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc

    E-Print Network [OSTI]

    Goddard III, William A.

    Business Expense Guidelines Page 1 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc Office of Financial Services March 2003 Revision date: 9/12/05 #12;Business Expense Guidelines Page 2 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc CCoonntteennttss 1. Introduction

  8. m:\\disability\\policies\\marking-dyslexia.doc THE UNIVERSITY OF SUSSEX

    E-Print Network [OSTI]

    Sussex, University of

    m:\\disability\\policies\\marking-dyslexia.doc THE UNIVERSITY OF SUSSEX Policy and Procedures for a reason relating to his or her disability. 1.2 Dyslexia is a registered disability under the Disability editor could put right. #12;m:\\disability\\policies\\marking-dyslexia.doc 2.3.2 The written work

  9. N:\\\\IPG\\\\SHARE\\\\CMHARDEN\\\\New Hire\\\\Student employment application.doc Student Employment Application

    E-Print Network [OSTI]

    Saidak, Filip

    N:\\\\IPG\\\\SHARE\\\\CMHARDEN\\\\New Hire\\\\Student employment application.doc Student Employment No If this is summer employment will you be enrolled in the fall? Yes No Please list educational background: Schools\\\\Student employment application.doc Pg 2 Please list previous jobs (on and off-campus) with most recent job first

  10. -Le_rachat_2005-06-14.doc Le rachat des Corses esclaves Tunis en 1779

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    1 / 19 - Le_rachat_2005-06-14.doc Le rachat des Corses esclaves à Tunis en 1779 L'établissement de), voir la bibliographie halshs-00162606,version1-14Jul2007 #12;2 / 19 - Le_rachat_2005-06-14.doc Esclaves

  11. 4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University

    E-Print Network [OSTI]

    Ferrari, Silvia

    4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University RCR FORUMS GS311 2005-2006 Topic: GS311;4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University RCR FORUMS 2005-2006 (cont.) Topic: GS311-02: "From

  12. CVP_EDR_OMPS_Flynn_Oct 2009 Public Release.doc NATIONAL POLAR-ORBITTING OPERATIONAL

    E-Print Network [OSTI]

    CVP_EDR_OMPS_Flynn_Oct 2009 Public Release.doc NATIONAL POLAR-ORBITTING OPERATIONAL ENVIRONMENTAL NPOESS Community Collaborative Calibration/Validation Plan for the NPOESS Preparatory Project OMPS EDRs) Page 1 of 70 #12;CVP_EDR_OMPS_Flynn_Oct 2009 Public Release.doc TABLE OF CONTENTS TABLE OF CONTENTS

  13. CVP EDR VIIRS VCM Kopp Public Release Oct2009.doc NATIONAL POLAR-ORBITTING OPERATIONAL

    E-Print Network [OSTI]

    CVP EDR VIIRS VCM Kopp Public Release Oct2009.doc NATIONAL POLAR-ORBITTING OPERATIONAL) Page 1 of 1 #12;CVP EDR VIIRS VCM Kopp Public Release Oct2009.doc Table of Contents 1.0 Objectives ............................................................................. 16 8.0 Appendix B: Validation Against the System Specification .. 18 Page 2 of 2 #12;CVP EDR VIIRS

  14. CVP EDR CrIS Barnet Public Release September 2009.doc NATIONAL POLAR-ORBITTING OPERATIONAL

    E-Print Network [OSTI]

    CVP EDR CrIS Barnet Public Release September 2009.doc NATIONAL POLAR-ORBITTING OPERATIONAL Project CrIS/ATMS EDRs DATE: 15 September No. I30004 VER. 1 REV. B PREPARED BY) Page 1 of 75 #12;CVP EDR CrIS Barnet Public Release September 2009.doc Table of Contents TABLE

  15. LSsugiyama-buss_c09CEforrequests.doc Page 1 of 1

    E-Print Network [OSTI]

    Sugiyama, Lawrence S.

    LSsugiyama-buss_c09CEforrequests.doc Page 1 of 1 Chapter 10 PHYSICAL ATTRACTIVENESS or a facultative developmental program that builds that design. #12;LSsugiyama-buss_c09CEforrequests.doc Page 2 of alleles linked with that preference (Buss, 1992; Symons, 1979; Thornhill, 2003). Attractiveness

  16. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W. [Ecosystem Center, The] [Ecosystem Center, The; Hayes, Daniel J [ORNL] [ORNL; Mcclelland, James W [University of Texas] [University of Texas; Peterson, Bruce [Marine Biological Laboratory] [Marine Biological Laboratory; Mcguire, David [University of Alaska] [University of Alaska; Melillo, Jerry [Marine Biological Laboratory] [Marine Biological Laboratory

    2014-01-01T23:59:59.000Z

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western Russia.

  17. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,Office of Policy, OAPM | DepartmentI Office of ENERGY ScienceDNS asDOCS System

  18. Flash2006-42Attachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic Plan|.pdf Flash2006-12.pdf Flash2006-12.pdf41.pdfAttachment2.doc�

  19. Flash2006-45Attachment.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic Plan|.pdf Flash2006-12.pdf5Attachment.doc�

  20. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122Commercial602 1,39732onMake Your NextHow EM AcronymsIQA memo10-6-08SAR.doc Microsoft

  1. Microsoft Word - Second National Report -- Final Rev 30.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122Commercial602 1,39732onMake Your NextHow EM AcronymsIQA memo10-6-08SAR.doc

  2. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National NuclearRegulation;I07al2005-04.doc Microsoft

  3. Microsoft Word - al2005-06.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National NuclearRegulation;I07al2005-04.doc

  4. Microsoft Word - al2006-12.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National NuclearRegulation;I07al2005-04.docal2006-12.doc

  5. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National 93-4 Acquisition Regulation Date April 7,06.doc

  6. Microsoft Word - al96-09.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National 93-4 Acquisition Regulation Date April6-09.doc

  7. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to:Ezfeedflag Jump to: navigation,ProjectStartDateProperty Edit withTieredDoc Jump to:

  8. AL2007-05.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently20,000 RussianBy:Whether you're a16-17, 2015 |75.doc� More Documents &

  9. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of Science (SC)IntegratedSpeeding accessPeptoid Nanosheets Offer a MathPetascale Post-Doc Project a

  10. al99-06.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual Siteof Energy 2, 2015Visiting Strong,Women @JoinEnergy ZEROFIXED.doc�

  11. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENT OF ENERGY6 ADM 24-02.doc Microsoft

  12. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENT OF ENERGY6 ADM 24-02.docALDOE

  13. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENT OF ENERGY6DepartmentARRAModelWAS.doc

  14. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc Microsoft Word

  15. Microsoft Word - FAL2004-02.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc Microsoft

  16. Microsoft Word - FAL2004-06.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc

  17. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatusUNDERSTANDING2010 11.doc

  18. Microsoft Word - AL2002-03.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary 2014RecoveryLetters2-03.doc

  19. Microsoft Word - AL2004-02.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc More Documents &

  20. Microsoft Word - AL2005-02.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc More Documents

  1. Microsoft Word - AL2005-05Revised.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc More

  2. Microsoft Word - AL2005-10.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLCFebruary4-02.doc MoreDOE

  3. Microsoft Word - DOE MEBA Storage letter.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc Microsoft WordEnergy Cover1-13)

  4. Microsoft Word - EMSSABChairs conferencecall Jan22 FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc Microsoft

  5. Microsoft Word - EMSSABChairs conferencecall July9 FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc MicrosoftJanuary 27, 2011

  6. Microsoft Word - EMSSABChairs conferencecall Nov20 FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc MicrosoftJanuary 27, 2011November 20, 2008

  7. Microsoft Word - EMSSABChairs.conferencecall.May7.070809.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc MicrosoftJanuary 27, 2011NovemberMarchMay

  8. Microsoft Word - EMSSABChairs.conferencecall.Nov19.FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc MicrosoftJanuary 27,

  9. Microsoft Word - ITR SRS Rpt FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulators and43.docOctober 6, 2008 ETR-19

  10. Microsoft Word - Revised DOE M 460 -Mar 2006.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating35.doc Microsoft Word -

  11. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment3311,Official File UnitedToOn4.doc Microsoft Word

  12. Microsoft Word - al94-19.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment3311,Official File UnitedToOn4.doc Microsoft Word 93-4Microsoft Word

  13. Microsoft Word - August06.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed off Energy.gov. Are you sure InternationalServices » LearningFinalModule6.ppt2005 FOIAAugust06.doc

  14. Microsoft Word - Hispanic Report 2010 _Final_.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependent ResearchFlash2008-08attachmentFAC22.doc

  15. Microsoft Word - May2009.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment of Energy MicrosoftMay2009.doc

  16. Microsoft Word - STATEMENT OF HERBERT RICHARDSON.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving BEFORE THE

  17. Microsoft Word - SpecialTermsandConditions0506.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving

  18. Microsoft Word - AL2005-01.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word

  19. Microsoft Word - AL2005-13.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft

  20. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S06815 Page 3-1 3.04-16-1

  1. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S06815 Page 3-1 3.04-16-1

  2. Microsoft Word - S08266_App_A-2.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S068154 Amphibian Index

  3. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S068154 Amphibian Index3

  4. Microsoft Word - SPPTS Report.10.08.09.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. Rocky434 3.4

  5. Microsoft Word - al93-4.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed off Energy.gov.Energy02.pdf7Processes toSummarizingHUMAN RELIABILITY BEFORE THEAprilal93-4.doc

  6. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc...

    Broader source: Energy.gov (indexed) [DOE]

    Glossary 2006-02-03nolinks.doc More Documents & Publications GNEP Glossary Lesson 5 - Fission and Chain Reactions Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group...

  7. NSF Mentoring Plan for Post Docs: Postdoctoral Researcher Mentoring Plan. Each proposal that requests funding to

    E-Print Network [OSTI]

    Rhode Island, University of

    . See GPG Chapter II.D.4 for additional information on collaborative proposals. Examples of mentoring will be returned without review (see GPG Chapter IV.B.) If you need additional information on preparing a post doc

  8. WSU EXTENSION TEMPORARY EMPLOYMENT REQUEST PROCEDURES Temporary Employment Request.doc 3/28/2013

    E-Print Network [OSTI]

    Collins, Gary S.

    WSU EXTENSION TEMPORARY EMPLOYMENT REQUEST PROCEDURES Temporary Employment Request.doc 3/28/2013 Please contact the appropriate Administrative Office with questions regarding temporary employment Ag Employment Request · E-mail to appropriate Administrative Office · Call appropriate Administrative Office

  9. VIRTIS for Doc: ROS-LES-RP-XXX Title: VIRTIS-H Calibration

    E-Print Network [OSTI]

    Demoulin, Pascal

    VIRTIS for Doc: ROS-LES-RP-XXX Title: VIRTIS-H Calibration Author: JM REESS / F. HENRY Date: 13: ROS-LES-RP-XXX Title: VIRTIS-H Calibration Author: JM REESS / F. HENRY Date: 13/06/2013 Issue: 1 Reason of the modification 1.0 13/06/13 JMR First Issue #12;VIRTIS for Doc: ROS-LES-RP-XXX Title: VIRTIS

  10. 2005-06 Annual Budget Instructions FY6/AppendixC.doc -1 -02-01-05

    E-Print Network [OSTI]

    Sheridan, Jennifer

    2005-06 Annual Budget Instructions FY6/AppendixC.doc - 1 - 02-01-05 A P P E N D I X C NUMERIC FUND;Office of Budget, Planning & Analysis FY6/AppendixC.doc - 2 - 02-01-05 NUMERIC CODE SOURCE DESCRIPTION; Principal Repayment, Interest, and Rebates #12;2005-06 Annual Budget Instructions FY6/AppendixC.doc - 3 - 02

  11. Z:\\Gerontology\\Program\\Application Packages\\PBD Application Package\\PBD package 2008\\Reference form.doc de partme nt of ge rontology

    E-Print Network [OSTI]

    .doc de partme nt of ge rontology gerontology research centre Letter of ReferenceLetter of Reference

  12. Z:\\Gerontology\\Program\\Application Packages\\MA Application Package\\Application Package 2008\\Reference Form.doc de partme nt of ge rontology

    E-Print Network [OSTI]

    \\Reference Form.doc de partme nt of ge rontology gerontology research centre LETTER OF REFERENCE MASTER

  13. Doc'Up, association des doctorants de Sorbonne Universits Sige social: 15 rue de l'cole de mdecine, 75006 Paris

    E-Print Network [OSTI]

    Arleo, Angelo

    Doc'Up, association des doctorants de Sorbonne Universités Siège social: 15 rue de l'école de.docup.info Pour nous contacter : contact@docup.info Liste soutenue par Doc'Up pour l'élection des représentants des doctorants à la Commission de la Recherche de l'UPMC. Qu'est ce que Doc' Up ? Doc'Up, créée à l

  14. g:\\fpdc\\contracts unit\\consultant selection and agreement forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 1 of 24

    E-Print Network [OSTI]

    Dyer, Bill

    \\owner consultant agreement final pdc.doc Page 1 of 24 MONTANA STATE UNIVERSITY PLANNING, DESIGN & CONSTRUCTION 6TH forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 2 of 24 TABLE OF CONTENTS PART\\consultant selection and agreement forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 3 of 24 1

  15. !Y-Y-2000062! J:\\Registration,Readmits,Spec. programs\\Data (Forms, Reports, Etc.)\\Registrar Forms and Petitions\\Word Docs\\Partial Fee Reduction_Barcoded.doc

    E-Print Network [OSTI]

    California at Santa Barbara, University of

    and Petitions\\Word Docs\\Partial Fee Reduction_Barcoded.doc Revised 5/26/2011 SS REQUEST FOR PARTIAL FEE Educational Fee and must be submitted to the Office of the Registrar. A petition for a deficit load should to a complete withdraw from the University. 2. Approval for partial fee reduction is not automatic. To qualify

  16. Analysis 6127Performance071230.doc 1 of 5 1/21/2008 Steve Kliewer Analysis of 6127Performance071230.txt

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Analysis 6127Performance071230.doc 1 of 5 1/21/2008 Steve Kliewer Analysis of 6127Performance071230.txt Analysis of Data using QDAQ.exe This page represents the statistical analysis of this file done 7 #12;Analysis 6127Performance071230.doc 2 of 5 1/21/2008 Steve Kliewer Invalid GPS Status: Data

  17. Department Human Resources Bulletin, #027, FY06, dated August 1,2006 DOC Demonstration Project Operating Procedures

    E-Print Network [OSTI]

    setting pay for Presidential Management Fellows (PMF) who are covered by the DOC Demonstration Project Resources Bulletin #027, FY06, Presidential Management Fellows Program. This bulletin provides agencieswho Committee meeting, comprised of members in organizationscovered by the DOC Demonstration Project, to permit

  18. Microsoft Word - Policy_Flash_ 09_01_L1_Safety_course.doc | Department of

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER07.docFINAL.doc |

  19. Microsoft Word - Policy_Flash_09_02_Interim_Certification.doc | Department

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER07.docFINAL.doc |of Energy

  20. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER07.docFINAL.doc |ofNews Media

  1. Microsoft Word - eMeter 10-11-01 Response to DOE RFI.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA p p20 th

  2. Microsoft Word - ex parte memo deLaski Harris.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovemberi CONTENTSSTATEMENT OF DAVID14,4.doc14.docA p p20 On

  3. Microsoft Word - Policy Flash 2006-35.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc More Documents &35.doc More

  4. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc Microsoft Word2.doc Microsoft

  5. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.docALonEO13423Last.doc Microsoft Word -

  6. TELECOM incubator summer internship description.doc TELECOM & Management SudParis Pamplin Summer Internships

    E-Print Network [OSTI]

    Virginia Tech

    at Management Sud Paris. They will work for a start-up company in the business incubator at Management Sud ParisTELECOM incubator summer internship description.doc TELECOM & Management SudParis ­ Pamplin Summer Internships Introduction Virginia Tech has had an exchange agreement for many years with TELECOM &Management

  7. CH 5 MANAGEMENT PLAN.DOC 5-1 5 Management Plan

    E-Print Network [OSTI]

    CH 5 MANAGEMENT PLAN.DOC 5-1 5 Management Plan 5.1 Vision The Willamette Subbasin Plan Oversight drafted the following vision: Willamette Basin citizens from all walks of life prize and enjoy a quilt-work of natural areas, working landscapes, and distinctive communities, from the crest of the Coast Range

  8. ORA_Record_of_Export_Control.doc ORA RECORD of EXPORT CONTROL REVIEW

    E-Print Network [OSTI]

    Massachusetts at Lowell, University of

    ORA_Record_of_Export_Control.doc ORA RECORD of EXPORT CONTROL REVIEW Note: If any questions that: 1.References U.S. export regulations? Yes No 2.Restricts participation based on citizenship with export control laws and regulations that are issued by the Department of Commerce and/or State. A final

  9. 11/2001: Project Report Submission Form.doc Agilent Technologies Black Undergraduate Physics Student Award

    E-Print Network [OSTI]

    Wechsler, Risa H.

    11/2001: Project Report Submission Form.doc Agilent Technologies Black Undergraduate Physics Student Award National Conference Black Physics Students Stanford University March 29 ­ April 1, 2001 Name) FY2001 Check the box that applies: c I am submitting my Project Report for a technical presentation c

  10. File: PoS_Markov_22_MM.doc 100524 Poisson Simulation outperforms Markov Simulation

    E-Print Network [OSTI]

    [10], is a more recent method for model building and simulation that facilitates construction, modelFile: PoS_Markov_22_MM.doc 100524 Poisson Simulation outperforms Markov Simulation Leif Gustafsson.Gustafsson@bt.slu.se Abstract Markov Simulation and the more recent Poisson Simulation are two fully consistent ways

  11. CH 4 INVENTORY.DOC 4-1 4 Inventory and Assessment of Conservation Efforts

    E-Print Network [OSTI]

    CH 4 INVENTORY.DOC 4-1 4 Inventory and Assessment of Conservation Efforts 4.1 Background According and imminent protections, and 3) current strategies implemented through specific projects. The inventory residents makes an inventory and assessment of this nature very difficult. It may therefore be helpful

  12. FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code /

    E-Print Network [OSTI]

    Twente, Universiteit

    GRADUATION FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code: Graduation. The PhD1 will receive an e-mail with an invitation to submit the manuscript (33. Invitation not approved it could lead to a discontinuation of the PhD project. Termination of the employment contract

  13. jdb_1700.doc 4/15/091 Energy and the Environment, Spring 2009, Class Schedule

    E-Print Network [OSTI]

    Bowen, James D.

    jdb_1700.doc 4/15/091 Energy and the Environment, Spring 2009, Class Schedule Date Home- work Class-class Test #1, Chapters 1-11 Feb. 26 13 Fossil Fuel Resources Chapter 12 Mar. 3 Mar. 5 Environmental Impacts Mar. 26 16 Nuclear Reactions, Nuclear Energy Production Basics Chapters 18-19 Mar. 31 17 Nuclear

  14. App D_Terrestrial Tech App.doc 1 Protection, Restoration, and Management of

    E-Print Network [OSTI]

    , Restoration, Management 83 2.4.6 Compatibility of Wetland Management and Stream Management 84 2 2.5.5 Protection, Restoration, Management 103 2.5.6 Compatibility of Pond Management and StreamApp D_Terrestrial Tech App.doc 1 Protection, Restoration, and Management of Terrestrial Habitats

  15. G:\\Policies\\Genealogy Research Policy.doc 1 IIT Archives Genealogy Research Policy

    E-Print Network [OSTI]

    Heller, Barbara

    G:\\Policies\\Genealogy Research Policy.doc 1 IIT Archives Genealogy Research Policy Effective April 14, 2010 I. The IIT Archives provides limited genealogical research services. Access to the IIT Archives' collections for the purpose of personal/family genealogy, either in person by the researcher him

  16. P:\\Policy & Procedures\\OSUA\\OSUA #2-purchasing.doc Office of Space Utilization & Analysis

    E-Print Network [OSTI]

    Fernandez, Eduardo

    AND PURPOSE: To establish a standard procedure for purchasing computers and computer related equipment. It is the responsibility of the Maintenance Contractor to purchase the current version of the operating system softwareP:\\Policy & Procedures\\OSUA\\OSUA #2-purchasing.doc Office of Space Utilization & Analysis Policy

  17. Potential DOC production from size-fractionated Arctic tundra soils Chunhao Xu a,b

    E-Print Network [OSTI]

    Guo, Laodong

    by freeze­thaw and subsequent frost heave processes (cryoturbated) into the underlying mineral soil horizons evaluated under different extraction time, temperature, soil/water ratio, and preservation conditions-acidic)soils. In general,soil extraction athigher temperature (22°Cvs. 2 °C)resultedin a 10­ 20% higher DOC. Degradation

  18. P:\\Policy & Procedures\\PP\\PP#10-Ext Lighting Maint..doc Physical Plant

    E-Print Network [OSTI]

    Fernandez, Eduardo

    P:\\Policy & Procedures\\PP\\PP#10-Ext Lighting Maint..doc Physical Plant Policy & Procedure #10 TITLE: EXTERIOR LIGHTING MAINTENANCE OBJECTIVE AND PURPOSE: To assure existing exterior lighting is maintained: ACTION MAINTENANCE DEPARTMENT (MERIDIAN) Conduct Monthly Lighting Tour (visual inspection) of all

  19. Post-doc GIPSA-Lab / LGIT : Ocean Acoustic Tomography in shallow water and Signal Processing

    E-Print Network [OSTI]

    van Tiggelen, Bart

    Post-doc GIPSA-Lab / LGIT : Ocean Acoustic Tomography in shallow water and Signal Processing influence and pollution in coastal areas. Consequently, they need the precise knowledge of the spatial and to estimate the sur- face height is also very interesting as these problems have many applications (acoustic

  20. 2004 Notes2Providers.doc -1-Notes to Retail Providers

    E-Print Network [OSTI]

    with the meter data reported to the system operator (Retail providers that purchase electricity from a power pool2004 Notes2Providers.doc -1- Notes to Retail Providers February 2005 Power Source Disclosure than the California Mix, (Net System Power)i . As a retail provider you are probably aware that all

  1. Revised on 2/6/2014 Application.doc College of the Environment

    E-Print Network [OSTI]

    Royer, Dana

    Revised on 2/6/2014 Application.doc College of the Environment 2014 Internship Application Form The College of the Environment is pleased to announce the 2014 Internship Program at Wesleyan University by Monday, February 24, 2014 in the College of the Environment Office, located at 284 High Street

  2. G:\\library-management\\Policies\\Coll_Man_PolicySept08.doc 1 University of Sussex Library

    E-Print Network [OSTI]

    Sussex, University of

    G:\\library-management\\Policies\\Coll_Man_PolicySept08.doc 1 University of Sussex Library Collection Management Policy 1. Introduction The University of Sussex Library contains 800,000 books, to which about 15,000 new items are added each year. The Library also provides access to over 20,000 print and online

  3. FBE-IIPrequirements.doc 1 To: PIER Students and Steering Committee

    E-Print Network [OSTI]

    FBE-IIPrequirements.doc 1 To: PIER Students and Steering Committee From: David Klahr and Sharon-Based Experience (FBE) and Integrative Interdisciplinary Project (IIP), yet clear flexibility to tailor the experiences to the unique profiles of our diverse student population. The FBE and IIP are two

  4. Minor in Chemistry Handout1.doc (04/30/08) Department of Chemistry

    E-Print Network [OSTI]

    Reed, Christopher A.

    Minor in Chemistry Handout1.doc (04/30/08) Department of Chemistry Undergraduate Student Academic.fleming@ucr.edu Minor in Chemistry Procedure: It is assumed that you have completed the requirements listed in section to Declare a Minor to Chemistry. Include the following: full name, student identification number, and email

  5. Post-doc position : Nanostructured materials for the realization of enhanced micro-supercapacitors

    E-Print Network [OSTI]

    Ingrand, François

    Post-doc position : Nanostructured materials for the realization of enhanced micro-supercapacitors and temperature range. The integration of low-profile, miniaturized supercapacitors could, CDC, CNT, RuO2...) for the development of micro-supercapacitors. An attractive

  6. Sample -PDF FEL.doc 2012-04-18 THE UNIVERSITY OF BRITISH COLUMBIA

    E-Print Network [OSTI]

    Strynadka, Natalie

    Sample - PDF FEL.doc 2012-04-18 THE UNIVERSITY OF BRITISH COLUMBIA - FACULTY APPOINTMENT FORM GRANT % AMOUNT (mandatory) ANNUAL AMOUNT (Optional)Monthly Per Period 2012-12-01 2013-11-30 FEL FAKE covered by FEL, will need BEN line - Only one PG can cover benefits - BEN line needed even if PDF

  7. NO NAME:Accident reporting and Auto Insurance.doc July 15, 2014

    E-Print Network [OSTI]

    Kelly, Scott David

    NO NAME:Accident reporting and Auto Insurance.doc July 15, 2014 STATEMENT OF RESOURCES TO ADDRESS CLAIMS ARISING FROM ACCIDENTS INVOLVING VEHICLES OPERATED ON UNIVERSITY BUSINESS This statement contains a general description of resources available in connection with claims arising from accidents involving

  8. RR\\362845EN.doc PE 362.845v02-00 EUROPEAN PARLIAMENT

    E-Print Network [OSTI]

    Franz, Sven Oliver

    on 27 June 2002 by the Group of Eight in Kananaskis, #12;PE 362.845v02-00 4/24 RR\\362845EN.doc EN of the Africa Action Plan, released on 1 July 2005 by the Group of Eight in London, - having regard to the Gleneagles Communiqué, released on 8 July 2005 by the Group of Eight in Gleneagles, - having regard

  9. CH 3 ASSESSMENT.DOC 3-1 3 Subbasin Assessment

    E-Print Network [OSTI]

    .1% Washington 469,001 413,944 88.3% 5.6% Yamhill 459,391 422,481 92.0% 5.8% Source: Adapted from Pacific.DOC 3-3 Figure 3-2: The Willamette Basin Source: Uhrich and Wentz, 1999: 3.1.1.3 Geology The Willamette; Thieman, 2000) A variety of rock types are present in the Willamette Basin. The Coast Range consists

  10. J:\\Communal\\qual ass\\Periodic Subject Review\\standard docs\\pre review documents\\student info sheet_13_14.docx

    E-Print Network [OSTI]

    Glasgow, University of

    J:\\Communal\\qual ass\\Periodic Subject Review\\standard docs\\pre review documents\\student info sheet:\\Communal\\qual ass\\Periodic Subject Review\\standard docs\\pre review documents\\student info sheet_13_14.docx checking

  11. O:\\CSUE\\Horticulture\\Native Plant Masters\\2013\\2013 NPM Application.doc4/3/2013 Colorado State University Extension 2009

    E-Print Network [OSTI]

    Stephens, Graeme L.

    O:\\CSUE\\Horticulture\\Native Plant Masters\\2013\\2013 NPM Application.doc4/3/2013 © Colorado State: ___________________________ The following items are very important for communication with your trainer and NPM staff: Your Mailing Address\\2013\\2013 NPM Application.doc4/3/2013 © Colorado State University Extension 2009 2 SECTION B: (All

  12. HP Laboratories 5/22/97 Hiro:Documents:Giordano Beretta:Research:AIC97:aic97ohp.doc

    E-Print Network [OSTI]

    Beretta, Giordano

    k l,[ ] var Y k l,[ ]( ) 1 B ---- Yi k l,[ ] My k l[ , ]­( )2 i 1= B = = #12;w w w HP Laboratories 5w w w HP Laboratories 5/22/97 Hiro:Documents:Giordano Beretta:Research:AIC97:aic97ohp.doc 0Encoding://www.hpl.hp.com/personal/Giordano_Beretta #12;w w w HP Laboratories 5/22/97 Hiro:Documents:Giordano Beretta:Research:AIC97:aic97ohp.doc 1The

  13. Microsoft Word - FY2014_HAB_WorkPlan_v6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPAURTeC:8CO 2Dances7,7,PropertyBSCFed.docFY14

  14. Microsoft Word - FY09PropertyBSCFed.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122Commercial602 1,39732onMake Your NextHow EM DoesDoubleTree byPropertyBSCFed.doc

  15. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122Commercial602 1,39732onMake Your NextHow EM DoesDoubleTreePropertyBSCFed.doc

  16. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National NuclearRegulation;I I D DMicrosoft Word -4.doc

  17. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction toManagement of the National NuclearRegulation;I I D DMicrosoft Word10.doc

  18. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENT OFMonday, December 1,pt31A.doc

  19. Microsoft Word - AcqGuide70pt31B.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENT OFMonday, December 1,pt31A.docB

  20. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S. DEPARTMENTtheStatus of3-03R.doc Microsoft Word -

  1. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&W (08-93)Flash2009dashxxFAC34.doc

  2. Microsoft Word - Policy Flash 2008-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions forCheneyNovember S.Fluor-B&WOPOWER submitstheTable1.doc Microsoft

  3. Microsoft Word - EM SSAB Chairs Asset Retention Recommendation2011-01.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc Microsoft WordEnergyWestEERE PSRP1

  4. Microsoft Word - EM SSAB Chairs Authorizing Funds for Movement of Artifacts Recommendation2011-02.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc Microsoft WordEnergyWestEERE PSRP12

  5. Microsoft Word - EM SSAB Chairs Letter Reclamation of Asset Metals 070909.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.doc Microsoft WordEnergyWestEERE PSRP12July

  6. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulators and43.doc

  7. Microsoft Word - Groundwater_Booklet-2008-v5 final.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulators and43.doc INTRODUCTION: The

  8. Microsoft Word - INCOMING.EM SSAB Chairs Recommendation 2010-1.RFP Option Periods.012110.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulators and43.doc INTRODUCTION:Chairs'0-1

  9. Microsoft Word - INCOMING.EM SSAB Chairs to NewEM-1.052109.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating Panel1.docregulators and43.doc

  10. Microsoft Word - Summary and Guide for Stakeholders 01-03-11 AFD.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating35.doc Microsoft Word -Secretary ofUpdated May Table

  11. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_Cost Estimating35.docMusings on Water (and

  12. Microsoft Word - eCPIC User Request Form_v 6_20090727.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment3311,Official File UnitedToOn4.doc MicrosoftSOFTWARE QUALITYREV:

  13. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependent ResearchFlash2008-08attachmentFAC22.doc More

  14. Microsoft Word - IG Testimony - UCLANL Cost Incurred- Long9 delivered.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependent ResearchFlash2008-08attachmentFAC22.docGREGORY

  15. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc MoreCert-Microsoft Word

  16. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department of

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc

  17. Microsoft Word - SEPA Final congressional justification 1-22-10.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving ProjectResearch

  18. Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc | Department of

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving

  19. Microsoft Word - STATEMENT OF GREGORY H. FRIEDMAN _April 5 2005_--Yucca.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving BEFORE THE U.S. HOUSE

  20. Microsoft Word - STATEMENT OF GREGORY H. FRIEDMAN _June 17th 2004_2.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving BEFORE THE U.S.

  1. Microsoft Word - Second_ ITER Council Press Release.doc | Department of

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving BEFOREEnergy

  2. Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc | Department

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Improving BEFOREEnergyof

  3. Microsoft Word - Subcontracting Guidelines Final-11-27-06 _2_.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table of Contents ABBREVIATIONS

  4. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table of ContentsTSLCC

  5. Microsoft Word - Transmittal Memo - FY 2007 Isotopes Final Report 4-7-2011_1.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015of 2005 atthe DistrictIndependentDepartment4.doc Table of ContentsTSLCCApril 7,

  6. Microsoft Word - AL2009DWMBPRewrite2GenaCleared.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice of Small.doc

  7. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2:Introduction to EnergyDepartmentOffice ofARRAModelWAS.doc MicrosoftMicrosoft Word -

  8. Microsoft Word - S07693_5-yr review rpt.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S06815 Page 3-1ReviewThird

  9. Microsoft Word - S09330_2ndQtr2012.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona,Site Operations Guide Doc. No. S068154 Slick Rock,2Second

  10. W:\\Clinical Affairs\\Marshall\\HOTLINES\\HOTLINES-Revised-1-31-2013.doc Internal Medicine Residency Hotlines!

    E-Print Network [OSTI]

    Gilbert, Matthew

    W:\\Clinical Affairs\\Marshall\\HOTLINES\\HOTLINES-Revised-1-31-2013.doc Internal Medicine Residency after hours and leave Ron a voice mail message. 2. To talk personally to William Marshall, Chair. To talk personally to Debbie McCall, Executive Assistant Dean for Administration about pay, benefits

  11. doc. RNDr. Vladislav Rosa, PhD., Department of fundamentals of mathematics and didactic of mathematics FMFI UK

    E-Print Network [OSTI]

    Spagnolo, Filippo

    doc. RNDr. Vladislav Rosa, PhD., Department of fundamentals of mathematics and didactic. The 2nd chapter ­ the shortest ­ contains description of key words of actual didactic of mathematics (didactical contract, visions, models, conflicts, incorrect opinions, obstacles). This chapter describes

  12. doc. RNDr. Vladislav Rosa, PhD., Department of Algebra, Geometry and Didactics of Mathematics, FMFI UK Bratislava

    E-Print Network [OSTI]

    Spagnolo, Filippo

    1 doc. RNDr. Vladislav Rosa, PhD., Department of Algebra, Geometry and Didactics of Mathematics a didactical background; · extension of the tools to creation of a-didactic situation and deeper understanding proper didactic experiment carried out on sample of 11-12 and 14-15 years old pupils. This experiment

  13. Web Security Standards and Practices Page 1 of 13 Web Security Standard Operating Environment (SOE) V1.doc

    E-Print Network [OSTI]

    Qian, Ning

    Web Security Standards and Practices Page 1 of 13 Web Security Standard Operating Environment (SOE) V1.doc Columbia University Web Security Standards and Practices Objective and Scope Effective Date: January 2011 This Web Security Standards and Practices document establishes a baseline of security related

  14. 9/1/2011 file: W1109D_Cruise_Plan_v5.doc CRUISE PLAN R/V WECOMA

    E-Print Network [OSTI]

    : water samples with rosette will be taken at some of the stations. Mon Sep 26 -- Load ship Tues Sep 27_Cruise_Plan_v5.doc Fri Sep 30 -- 0800 At dock in Newport WILL RADIOACTIVE METHODS BE USED? NO SAMPLING PLAN: See itinerary above EQUIPMENT REQUIRED: (Should be included on Shared-Use Equipment request form) Tip plate

  15. 10/2/2012 file: OC1210B_Cruise_Plan_v3.doc CRUISE PLAN R/V OCEANUS

    E-Print Network [OSTI]

    : water samples with rosette will be taken at some of the stations. Mon Sep 26 -- Load ship Tues Sep 27_Cruise_Plan_v5.doc Fri Sep 30 -- 0800 At dock in Newport WILL RADIOACTIVE METHODS BE USED? NO SAMPLING PLAN: See itinerary above EQUIPMENT REQUIRED: (Should be included on Shared-Use Equipment request form) Tip plate

  16. PDX\\APP L_STATE FED INVENTORY.DOC 1 Inventory of State and Federal Fish and Wildlife

    E-Print Network [OSTI]

    PDX\\APP L_STATE FED INVENTORY.DOC 1 APPENDIX L Inventory of State and Federal Fish and Wildlife Plans and Programs This inventory was conducted in the spring of 2003 by the Oregon Department of Fish and Wildlife under contract to WRI. The following pages are printed from the spreadsheet used in the inventory

  17. GAL.BLAYDES-FIRESTONE.DOC 11/19/2008 2:01 PM WIND POWER, WILDLIFE, AND THE MIGRATORY BIRD

    E-Print Network [OSTI]

    Firestone, Jeremy

    GAL.BLAYDES-FIRESTONE.DOC 11/19/2008 2:01 PM [1167] WIND POWER, WILDLIFE, AND THE MIGRATORY BIRD by discussing the rapid domestic growth of wind power and the implications for turbine-related avian and bat impacts, and then examine other anthropogenic sources of avian mortality. Next, we provide a broad

  18. ulvacsim.paper.doc 08/20/99 p. 1 of 23 Dynamic Simulation of a Multichamber CVD Cluster Tool

    E-Print Network [OSTI]

    Rubloff, Gary W.

    ulvacsim.paper.doc 08/20/99 p. 1 of 23 Dynamic Simulation of a Multichamber CVD Cluster Tool N-level dynamic simulator for an 8" CVD cluster tool (ULVAC-ERA1000). The simulator incorporates models, and volumes to reflect actual behavior, validated against experiments on the Ulvac tool. The process simulator

  19. P:\\Policy & Procedures\\EHS\\EH&S#16-Receiving dangerous goods-rev.doc Environmental Health & Safety

    E-Print Network [OSTI]

    Fernandez, Eduardo

    P:\\Policy & Procedures\\EHS\\EH&S#16-Receiving dangerous goods-rev.doc Environmental Health & Safety Policy & Procedure #16 TITLE: DANGEROUS GOODS RECEIVING POLICY OBJECTIVE AND PURPOSE: To ensure packages containing dangerous goods are properly received, stored and distributed to the FAU campus community

  20. Exhibit 7 Filing of Patent Applications Classified Subject Matter UT-B Contracts Div ex7-july10.doc

    E-Print Network [OSTI]

    Pennycook, Steve

    Exhibit 7 ­ Filing of Patent Applications ­ Classified Subject Matter UT-B Contracts Div July 2010 Page 1 of ex7-july10.doc Exhibit 7 Ref: FAR 52.227-10 (Dec 2007) FILING OF PATENT APPLICATIONS - CLASSIFIED SUBJECT MATTER (July 2010) (a) Before filing or causing to be filed a patent application

  1. C:\\Documents and Settings\\rpriesmeyer\\My Documents\\Word\\FAMIS Purchasing Guidelines.doc FAMIS Purchasing Guidelines

    E-Print Network [OSTI]

    Behmer, Spencer T.

    C:\\Documents and Settings\\rpriesmeyer\\My Documents\\Word\\FAMIS Purchasing Guidelines.doc FAMIS Purchasing Guidelines We are now utilizing the FAMIS (Financial Accounting Information Systems) State of measure & unit price of each item) · Indicate if there is a separate charge for shipping and handling

  2. APP M_EXISTING CONSERVATION.DOC 1 Appendix M: Summary of Existing Conservation Efforts in the Willamette Basin

    E-Print Network [OSTI]

    APP M_EXISTING CONSERVATION.DOC 1 Appendix M: Summary of Existing Conservation Efforts actions. (National Marine Fisheries Service. 2000. Conservation of Columbia Basin Fish--Final Basinwide of Land Management; Bureau of Reclamation; Environmental Protection Agency; Fish and Wildlife Service

  3. Z:\\Payroll Related\\Misc Payroll Information\\Strand Union Employment Application.doc STRAND UNION EMPLOYMENT APPLICATION

    E-Print Network [OSTI]

    Maxwell, Bruce D.

    Z:\\Payroll Related\\Misc Payroll Information\\Strand Union Employment Application.doc STRAND UNION EMPLOYMENT APPLICATION Complete both sides of this application form and return it to The Ask Us Desk OR Room ____Manager Ask Us Desk ____Instructor ____Desk Attendant ____Manager Have you been previously employed

  4. Social Networks, Cognition and Culture Douglas R. White Social_Nets_Cog-June2010a.doc

    E-Print Network [OSTI]

    White, Douglas R.

    1 Social Networks, Cognition and Culture Douglas R. White Social_Nets_Cog-June2010a.doc Blackwell of social network interactions and contexts. Elements of network structure may thus be perceived of the relation between social networks, cognition and culture. Approaches and findings are explored in a series

  5. Organization Web Link American Association for Retired Person's http://www.grandfactsheets.org/doc/oklahoma07-final.pdf

    E-Print Network [OSTI]

    Veiga, Pedro Manuel Barbosa

    Organization Web Link American Association for Retired Person's http://www.grandfactsheets.org/doc/oklahoma-572-6831 Address: 1414 S. Division, Guthrie, OK 73044 Phone: 405-264-2700 , 800-572-6831 Oklahoma, North Address: 2409 N. Kelly, P.O. Box 26768, Oklahoma City, OK 73126 Phone: 405-522-5818, 800-884-1534 Address: 2409

  6. risk_policies_accident_std_vist.doc/ac 1 Revised 07.26.13 STUDENT AND VISITOR ACCIDENT

    E-Print Network [OSTI]

    Su, Xiao

    risk_policies_accident_std_vist.doc/ac 1 Revised 07.26.13 STUDENT AND VISITOR ACCIDENT REPORTING: 408-924-1892 Student and Visitor Accident Reporting Guidelines These guidelines provide instructions for reporting and handling accidents or incidents that happen to students and visitors while on the San José

  7. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies: Preprint

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-04-01T23:59:59.000Z

    An accelerated durability test method determined the potential impact of biodiesel ash impurities, including engine testing with multiple diesel particulate filter substrate types, as well as diesel oxidation catalyst and selective catalyst reduction catalysts. The results showed no significant degradation in the thermo-mechanical properties of a DPF after exposure to 150,000-mile equivalent biodiesel ash and thermal aging. However, exposure to 435,000-mile equivalent aging resulted in a 69% decrease in thermal shock resistance. A decrease in DOC activity was seen after exposure to 150,000-mile equivalent aging, resulting in higher hydrocarbon slip and a reduction in NO2 formation. The SCR catalyst experienced a slight loss in activity after exposure to 435,000-mile equivalent aging. The SCR catalyst, placed downstream of the DPF and exposed to B20 exhaust suffered a 5% reduction in overall NOx conversion activity over the HDDT test cycle. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. The results of this study suggest that long-term operation with B20 at the current specification limits for alkali and alkaline earth metal impurities will adversely impact the performance of DOC, DPF and SCR systems.

  8. J:\\Communal\\qual ass\\Periodic Subject Review\\standard docs\\pre review documents\\staff info sheet_13_14.docx

    E-Print Network [OSTI]

    Glasgow, University of

    J:\\Communal\\qual ass\\Periodic Subject Review\\standard docs\\pre review documents\\staff info sheet_13 Court, the governing body of the University. #12;J:\\Communal\\qual ass\\Periodic Subject Review

  9. Above- and below-ground Litter Manipulation: Effect on Retention and Release of DOC, DON and DIN in the Sikfokut Forest, Hungary

    E-Print Network [OSTI]

    Evetts, Elizabeth A.; Peterson, Jacqueline A.

    2009-09-30T23:59:59.000Z

    ABOVE- AND BELOW-GROUND LITTER MANIPULATION: EFFECT ON RETENTION AND RELEASE OF DOC, DON AND DIN IN THE SIKFOKUT FOREST, HUNGARY A Senior Scholars Thesis by ELIZABETH A. EVETTS Submitted to the Office...: EFFECT ON RETENTION AND RELEASE OF DOC, DON AND DIN IN THE SIKFOKUT FOREST, HUNGARY A Senior Scholars Thesis by ELIZABETH A. EVETTS Submitted to the Office of Undergraduate Research Texas A&M University in partial...

  10. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-06-01T23:59:59.000Z

    It is estimated that operating continuously on a B20 fuel containing the current allowable ASTM specification limits for metal impurities in biodiesel could result in a doubling of ash exposure relative to lube-oil derived ash. The purpose of this study was to determine if a fuel containing metals at the ASTM limits could cause adverse impacts on the performance and durability of diesel emission control systems. An accelerated durability test method was developed to determine the potential impact of these biodiesel impurities. The test program included engine testing with multiple DPF substrate types as well as DOC and SCR catalysts. The results showed no significant degradation in the thermo-mechanical properties of cordierite, aluminum titanate, or silicon carbide DPFs after exposure to 150,000 mile equivalent biodiesel ash and thermal aging. However, exposure of a cordierite DPF to 435,000 mile equivalent aging resulted in a 69% decrease in the thermal shock resistance parameter. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. A decrease in DOC activity was seen after exposure to 150,000 mile equivalent aging, resulting in higher HC slip and a reduction in NO{sub 2} formation. The metal-zeolite SCR catalyst experienced a slight loss in activity after exposure to 435,000 mile equivalent aging. This catalyst, placed downstream of the DPF, showed a 5% reduction in overall NOx conversion activity over the HDDT test cycle.

  11. PQLA_perm_new.doc Site Name : Quella permanent station Author : C. Vigny, A. Socquet, A. Pavez

    E-Print Network [OSTI]

    Vigny, Christophe

    the peak, a gate opens the access to a dirt road that brings to the the house of the landlords (or his : Topcon PGAI : PN O1-840201-06 SN 308-5828 Battery Lucas Supreme SMFNX110-SL 70Ah sealed Antenna cable 3m Contact David Lizana Coordinates of his house: S36.08367° W72.13291° #12;PQLA_perm_new.doc QLAP 2 ACCESS

  12. HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98:ontologyOHP.doc

    E-Print Network [OSTI]

    Beretta, Giordano

    HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98:ontologyOHP.doc 0Structure-Packard Company. All rights reserved. #12;HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98 radioactive · use a real big magnet · store needles separately from hay #12;HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI

  13. UCSF Housing Services Missing Persons Policy & Protocol for Students, PostDocs, Residents, Fellows and Faculty who reside in oncampus housing

    E-Print Network [OSTI]

    Yamamoto, Keith

    1 UCSF Housing Services Missing Persons Policy & Protocol for Students, PostDocs, Residents, Fellows and Faculty who reside in oncampus housing (revised Nov. 4, 2010) I. Missing Person Emergency Contact: UCSF campus housing is home to a broad range of tenants. The community population

  14. 3 Stellen -Wiss. Mitarbeiter/in PostDoc od. Wiss. Mitarbeiter/in zur Promotion Entgeltgruppe 13 TV-L Berliner Hochschulen fr max. 5 Jahre

    E-Print Network [OSTI]

    Feichtinger, Hans Georg

    3 Stellen - Wiss. Mitarbeiter/in ­ PostDoc ­ od. Wiss. Mitarbeiter/in ­ zur Promotion Entgeltgruppe der Analysis (Funktionanalysis, Fourieranalysis, od. analytische Methoden in der Signal- u. Bildverarbeitung) Anforderungen: erfolgr. abgeschl. wiss. Hochschulstudium der Mathematik (Diplom, Master od

  15. C:\\Public\\CECarter\\Horse\\AdvCouncil\\2009\\11Minutes.doc 4-H Horse Advisory Council 4 November 2009

    E-Print Network [OSTI]

    New Hampshire, University of

    C:\\Public\\CECarter\\Horse\\AdvCouncil\\2009\\11Minutes.doc 4-H Horse Advisory Council 4 November 2009, and of course is not something we can solve if N.H. is not hosting the Regional meet. Judging: Kids were be an issue; some horses are possibly just not ready for show like State (multi-day, of this size, full

  16. H:\\Internship Program\\Employer Packets and Marketing\\Internship Handbook for Employers 8-07.doc Tips for creating and maintaining successful internships

    E-Print Network [OSTI]

    Duchowski, Andrew T.

    H:\\Internship Program\\Employer Packets and Marketing\\Internship Handbook for Employers 8-07.doc Tips for creating and maintaining successful internships Internship Handbook for Employers: Michelin://career.clemson.edu recruit_L@clemson.edu #12;2 CONTENTS Internship overview

  17. Business Expense Guidelines Page 1 Revision date: 12-06-12 Caltech Business Expense Guidelines Rev 01-04-13.doc

    E-Print Network [OSTI]

    Bruck, Jehoshua (Shuki)

    Business Expense Guidelines Page 1 Revision date: 12-06-12 Caltech Business Expense Guidelines Rev 01-04-13.doc California Institute of Technology BUSINESS EXPENSE GUIDELINES Office of Financial Services March 2003 Revised January, 2013 #12;Business Expense Guidelines Page 2 Caltech Business Expense

  18. Version: AuthorAgreementFormAC2.doc, 2013-11-04 Academic Commons is Columbia University's online research repository, which is managed by the

    E-Print Network [OSTI]

    Salzman, Daniel

    Version: AuthorAgreementFormAC2.doc, 2013-11-04 Academic Commons is Columbia University's online of Columbia University Libraries/Information Services. http://academiccommons.columbia.edu Author Rights understand that by acceptance of this agreement I have granted Columbia University the non-exclusive right

  19. d:\\activepdf\\uploadfolder\\$asq1rr04-4144-212200461042pm.doc Page 1 Erosional narrowing after dam removal: Theory and numerical model

    E-Print Network [OSTI]

    Parker, Gary

    of a dam that is filled with sediment. A channel incises into the deposit after failure of the leadingd:\\activepdf\\uploadfolder\\$asq1rr04-4144-212200461042pm.doc Page 1 Erosional narrowing after dam phenomenon herein called "erosional narrowing". This occurs immediately after the sudden removal of a dam

  20. singapore_composites5.doc submitted to World Scientific 22/10/2003 -14:46 1/1 DIAMOND-FIBRE REINFORCED PLASTIC COMPOSITES

    E-Print Network [OSTI]

    Bristol, University of

    thin films of polycrystalline diamond on different substrates has enabled scientists and engineerssingapore_composites5.doc submitted to World Scientific 22/10/2003 - 14:46 1/1 DIAMOND of Bristol, Bristol BS8 1TR, UK Email: David.Smith@bris.ac.uk Diamond fibre reinforced poly

  1. H:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin Milwaukee

    E-Print Network [OSTI]

    Saldin, Dilano

    June 2013 June 2014 June 2015 June 2016 H:\\INST\\AUXBGT\\FY13UWM\\Internal Aux Financing\\Fund 128 ProjH:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin ­ Milwaukee 201213 Auxiliary Budget Kickoff Meeting October 12, 2011 10:00 ­ 11:30 Regents

  2. SPRING 2009 Undergraduate Research in Solar Astrophysics C:\\Documents and Settings\\ezita\\My Documents\\zitaweb\\research\\09LMSAL\\Spring09UGR.doc

    E-Print Network [OSTI]

    Zita, E.J.

    Martin Solar and Astrophysics Laboratory (LMSAL) in Palo Alto, CA, is just down the road from StanfordSPRING 2009 Undergraduate Research in Solar Astrophysics C:\\Documents and Settings\\ezita\\My Documents\\zitaweb\\research\\09LMSAL\\Spring09UGR.doc http://www.lmsal.com/ http://solar

  3. Instructions for Humanities AI/TF Doc Inventory & GSI Appointment Request Using the CEP supplemental form, please determine if the file will require CEP approval,

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Instructions for Humanities AI/TF Doc Inventory & GSI Appointment Request Form Using the CEP document inventory for Associate In or Teaching Fellow appointments and the CEP GSI Appointment Request, please complete the Humanities GSI Appointment Request Form and the Humanities Document Inventory

  4. SMETE.ORG User Profile Information 9/1/14 SMETE.ORG_User_Profile-v3b-4.doc 1

    E-Print Network [OSTI]

    Agogino, Alice M.

    SMETE.ORG User Profile Information 9/1/14 SMETE.ORG_User_Profile-v3b-4.doc 1 User Profile: · Performing a requirements analysis to develop user profiles based upon the needs of the SMETE.ORG Alliance and National SMETE Digital Library program. · Developing a distributed user profile system to build upon

  5. Mxico Social, nm. 24, julio 2012, Mxico, CEIDAS, pp. 17 19. URL: http://issuu.com/mexico_social/docs/ms_julio2012/3?mode=window

    E-Print Network [OSTI]

    Islas, León

    elegido el camino del extractivismo por encima o en contra del bienestar social y ambiental en generalMéxico Social, núm. 24, julio 2012, México, CEIDAS, pp. 17 ­ 19. URL: http://issuu.com/mexico_social/docs/ms_julio2012/3?mode=window visitado el día 6 FEB 2013. 1 Una Nueva Política Social para los Pueblos Indígenas

  6. Commitment to Civil Rights and Affirmative Action 2009 I:\\Extension\\Civil Rights\\Commitment to Civil Rights and Affirmative Action.doc

    E-Print Network [OSTI]

    Collins, Gary S.

    Commitment to Civil Rights and Affirmative Action 2009 I:\\Extension\\Civil Rights\\Commitment to Civil Rights and Affirmative Action.doc COMMITMENT TO CIVIL RIGHTS AND AFFIRMATIVE ACTION government, another person, and private groups. The United States Constitution, state constitutions and many

  7. National Center for Standards and Certification Information (NCSCI) Policy The U.S. Department of Commerce (DOC), National Institute of Standards and Technology

    E-Print Network [OSTI]

    and Certification Information (NCSCI) does not provide analyses or comparisons of documentary standards, nor does1 National Center for Standards and Certification Information (NCSCI) Policy The U.S. Department of Commerce (DOC), National Institute of Standards and Technology (NIST), National Center for Standards

  8. C:\\Documents and Settings\\vivian\\My Documents\\Recruiting\\Packet\\Checklist for applicants.doc PhD in Nursing

    E-Print Network [OSTI]

    Huang, Haiying

    C:\\Documents and Settings\\vivian\\My Documents\\Recruiting\\Packet\\Checklist for applicants.doc PhD transcripts to Graduate School Goal Statement Written per guidelines; sent to PhD Program GRE (for BSN of record send transcript to Graduate School 2 years clinical experience (BSN-PhD) To be verified by PhD

  9. 1 Intevep/2002/papers/FoamyOil-Pt2/nucleation_5-03.doc Modeling Foamy Oil Flow in Porous Media II

    E-Print Network [OSTI]

    Joseph, Daniel D.

    the assumption that the bubbles move with the oil. The main novel features of theory are an equilibrium equation1 · Intevep/2002/papers/FoamyOil-Pt2/nucleation_5-03.doc Modeling Foamy Oil Flow in Porous Media II presented a model of the flow of foamy oil in porous media in situations in which the bubbles do

  10. 679.26 Prohibited Species Donation Program 50 CFR 679b26.doc 679.26 Prohibited Species Donation Program Page 1 of 3

    E-Print Network [OSTI]

    manager of the processor. (xii) A signed statement from the applicant and from all persons who are listed for personal injury, death, sickness, damage to property directly or indirectly due to activities conducted§ 679.26 Prohibited Species Donation Program 50 CFR 679b26.doc § 679.26 Prohibited Species Donation

  11. C:\\Documents and Settings\\Serena Borsini\\Desktop\\AMS -Electronics\\Test 2008\\UG crate QM\\UG CRATE ESS\\ENVRPT26_S3013R-UG crate QM_ESS-29FEB2K8.doc Laboratorio per lo Studio degli

    E-Print Network [OSTI]

    Roma "La Sapienza", Università di

    ESS\\ENVRPT26_S3013R-UG crate QM_ESS-29FEB2K8.doc SERMS Laboratorio per lo Studio degli Effetti delle.0744.49.29.13 ENVIRONMENTAL TEST REPORT doc: UG crate QM - ESS date: 29/02/08 rev: A01 pag: 1 /11 file: ENVRPT26_S3013R- UG crate QM_ESS- 29FEB2K8.doc INFN - Roma ENVIRONMENTAL TEST REPORT ­ UG crate QM - ESS ENVRPT26_S3013R

  12. "V Doc with logo.doc"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    notice may share health information with each other to carry out treatment, payment, or health care operations. These Plans are collectively referred to as the Plan in this...

  13. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    ...21 Attachment 1-Assessment of Anomalous Data Potential Outliers Report Attachment 2-Data Presentation Groundwater Quality Data Static...

  14. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:F E A research project inI

  15. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:F E A research project inISHP/S04483

  16. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:F E A research project

  17. Microsoft Word - 08101898_DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:F E A research project8and Surface

  18. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling CorpNewCF INDUSTRIES,L?How DOE and theSAL/S04639

  19. T:\\013.ffentlichkeitsarbeit\\05.Vortrge\\32.NAWTEC 11 Florida 2003\\A_Ways to Improve the Efficiency of Waste to Energy Plants.doc Ways to Improve the Efficiency of Waste to Energy Plants

    E-Print Network [OSTI]

    Columbia University

    of Waste to Energy Plants.doc Ways to Improve the Efficiency of Waste to Energy Plants for the Production@mvr-hh.de Abstract Up to now the emissions of waste-to-energy plants have been of major concern for the operators of waste incineration plants and the public. In Germany the emission standards for waste incineration

  20. C:\\Documents and Settings\\cfan\\Local Settings\\Temporary Internet Files\\Content.Outlook\\WAA5WMY7\\AODflyerSpring 2013.doc1/16/2013 CONCERNED ABOUT YOUR ALCOHOL OR DRUG USE?

    E-Print Network [OSTI]

    Kammen, Daniel M.

    \\AODflyerSpring 2013.doc1/16/2013 CONCERNED ABOUT YOUR ALCOHOL OR DRUG USE? Choose a Healthier Lifestyle effects from their alcohol or other drug use. Harm Reduction: Tuesdays, 4:10 ­ 6:00 pm. This group is for students who would like to make healthier decisions around their alcohol/drug use to minimize the negative

  1. Inter/Intra-Vehicle Wireless Communication file:///X:/www-docs/cse574-06/ftp/vehicular_wireless/index.html 1 of 16 5/9/2006 7:32 PM

    E-Print Network [OSTI]

    Jain, Raj

    Inter/Intra-Vehicle Wireless Communication file:///X:/www-docs/cse574-06/ftp/vehicular_wireless/index.html 1 of 16 5/9/2006 7:32 PM Inter/Intra-Vehicle Wireless Communication Gregory S. Bickel greg vehicles, as well as between vehicles. Different concepts associated with radio frequency bands and wave

  2. OCI.doc

    E-Print Network [OSTI]

    construction of a modeling and analysis library to demonstrate the use of relatively new ... Such a center would undertake community-building activities such as ... Biology/Bioinformatics, Medicine, Physics, Astronomy, Materials Science and ...

  3. Lesson30.doc

    E-Print Network [OSTI]

    The time in minutes required to charge a battery depends on how close it is to being fully charged. If M is the theoretical maximum charge, k is a positive constant ...

  4. Lesson21.doc

    E-Print Network [OSTI]

    The time in minutes required to charge a battery depends on how close it is to being fully charged. If M is the theoretical maximum charge, k is a positive constant ...

  5. Lesson17.doc

    E-Print Network [OSTI]

    Power Property for equations: When both sides of an equation are raised to the same ... Ex 14: For each planet in our solar system, its year is the time it takes the

  6. Microsoft Word - ~7664231.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    USA Fred Gunnerson Nuclear Engineering Program University of Idaho, IdahoFalls, Idaho, USA ABSTRACT One key long-standing issue that must be overcome to fully realize the...

  7. Microsoft Word - ??????.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the 12 th Meeting of the Joint Working Group of the U.S.-Japan Coordinating Committee of Fusion Energy on Safety in Inter-Institutional Collaborations (U.S.-Japan Safety...

  8. mundial98.doc

    E-Print Network [OSTI]

    Hydrology phenomena have been studied for a long time1,7 and many of its conceps are very well established, as well as their qualitative behaviour.

  9. Lesson4.doc

    E-Print Network [OSTI]

    If the original number is 10 or greater, the exponent of the base 10 will be positive ... 7,516,000,000 (Source: U.S. Bureau of the Census, International Data Base).

  10. Lesson2.doc

    E-Print Network [OSTI]

    x is called the base, n is called the exponent, is called a power ... be approximately 7,516,000,000 (Source: U.S. Bureau of the Census, International Data Base).

  11. Lesson18.doc

    E-Print Network [OSTI]

    Ma 15200 Lesson 18 Section 1.7. I Representing an Inequality. There are 3 ways to represent an inequality. (1) Using the inequality symbol (sometime within ...

  12. matlab.doc

    E-Print Network [OSTI]

    Department of Computer Science. University of New Mexico ...... If all goes according to plan, this will read the matrix A from the file A,. invert it, store the inverse ...

  13. 1146627_7.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PacifiCorp; NextEra Energy Resources, LLC; Invenergy Wind North America LLC; and Horizon Wind Energy LLC Complainants, v. Bonneville Power Administration Respondent. ) ) ) ) ) ) )...

  14. zg_lwlvl.doc

    E-Print Network [OSTI]

    modular; in spite of IBM's recent move toward building video. hardware into the computer's motherboard, most vendors have. maintained the ability to install ...

  15. DOC182.PDF

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,Office of Policy, OAPM | DepartmentI Office of ENERGY ScienceDNS as aCOMMITTEE

  16. TsaiFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron Spin Transition in2,EHSS A-Z SiteManhattanPacific: A Year inTruman

  17. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:F ENaturalWater Vapor in Gas at24

  18. guide.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, , ., Decembergangh AmesAFind ReportRadiativethe

  19. Environmental Records.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,OfficeEnd of Year 2010 SNFEnergySession0-02NationwideServices

  20. 022996A.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del(ANL-IN-03-032) - Energy Innovation Portal Advanced Materialsj o n2/13/055,

  1. LLNLKEYSFINAL.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment ofLetter Report:40PM toLED Lighting FactsWashersInspections

  2. Habadv-115.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal848 Unlimited Release1/2 HR 1.00 $ ForHVAC5115

  3. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal848 Unlimited Release1/2 HR 1.00 $ ForHVAC51159

  4. Habadv-120.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal848 Unlimited Release1/2 HR 1.00 $ ForHVAC5115920

  5. titlepg.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, ,Development1U C L E A R Etest andW HA.7 (Released

  6. weatherwksht.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, ,Development1U CO FVehicle3

  7. win0203.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, ,Development1U CO1) 1 Winter Fuels Outlook: 2001/2002

  8. SEC A.doc

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNL 2001a,Summary; i-C* S H I E L D *

  9. SWPPPMH1.doc

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 2010 NationalStorm Water Pollution

  10. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has Driving ComeJanuary 2010

  11. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has Driving ComeJanuary

  12. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has Driving ComeJanuary

  13. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has Driving ComeJanuaryJuly

  14. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has Driving

  15. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has DrivingJune 2003 1

  16. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has DrivingJune 2003 1March

  17. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has DrivingJune 2003

  18. Highlights.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 111 1,613 122 40 Buildingto17 3400, U.S.MajorMarketsNov-14 Dec-14Has DrivingJune

  19. Report2003.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011 Strategic2 OPAM615_CostNSAR -Department of Energyasto|Department of Energy2003

  20. 2B-01.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015ofDepartment ofCBFO-13-3322(EE)DepartmentVery5Dryers;under Federal Employee1,

  1. 2B-05.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China 2015ofDepartment ofCBFO-13-3322(EE)DepartmentVery5Dryers;under Federal Employee1,5,

  2. Nov08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's Possible for Renewable Energy:Nanowire3627 Federal Register / Vol. 77, No. 23807 1 November

  3. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHigh SchoolIn12 Investigation PeerNOON... NoJames Morbyto:Jefferson9

  4. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHigh SchoolIn12electron beamJoin2015 BonnevilleJulyJune1June49, 2012FOR8

  5. Activation.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisiting the TWP TWP Related LinksATHENA AccountManagement |ARQ A

  6. LibraDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHigh SchoolIn12electron 9 5Let us count the ways. We've13,LewisLianeLibra

  7. Aug08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office511041cloth DocumentationProductsAlternativeOperational ManagementDemand66 Audit Report:4Audits Sign88

  8. DOEF46001705.doc

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,Office of Policy, OAPMMilestone | DepartmentEA - 0942 E N v8 AUDIT141 8NOV 1μmF

  9. Chakrapani-V.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office511041clothAdvanced Materials Advanced. C o w l i t z C oCNMSStaffCerium OxideChair Summaries

  10. SubcontractingGuidelines.doc

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO Overview OCHCO OverviewRepositoryManagementFacilityExcellence | Department Table of

  11. FIBDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist. Category UC-lFederal ColumbiaASCR RequirementsFIA-11-0018 -6 -FIB

  12. Microsoft Word - 20.doc

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItem Not Found Item Not Found TheHot electron dynamics in807 DE899 06enginomixEFFECT OF

  13. sr0801.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengtheningWildfires mayYuan T.ExternalscriptEnv -through December 2002

  14. sr0905.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengtheningWildfires mayYuan T.ExternalscriptEnv -through December 2002Media

  15. sr0930.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengtheningWildfires mayYuan T.ExternalscriptEnv -through

  16. sr0934.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengtheningWildfires mayYuan T.ExternalscriptEnv -throughThursday, OctoberNEWS

  17. 1B-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny: The Future of BadTHE U.S. DEPARTMENT OFDecember 18, 2012 Agency/Departmentof1B-03,

  18. Index2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreaking of BlytheDepartment of EnergyTreatment and Department of Energy

  19. doeadm-17.doc

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual Siteof Energy 2, 2015Visiting Strong,Women @JoinEnergyappearancecrd title6 DEPARTMENT

  20. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power Administration wouldDECOMPOSITION OFSupplementalC. L.Deadly CarcinogenDeborah S. Jin28

  1. Microsoft Word - 033302.doc

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronicCurves | SciTechLagrange Multiplier Technique |and geometries

  2. Microsoft Word - 58285.doc

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronicCurves | SciTechLagrange Multiplier Technique |and

  3. Microsoft Word - ~2432658.doc

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronicCurves | SciTechLagrange Multiplier TechniqueAbsorption

  4. Feb09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist. Category UC-lFederalFYRANDOMFailure ModesflowFe09

  5. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del(ANL-IN-03-032) -Less isNFebruaryOctober 2, 2014Energy,FNeed more4 3.2S. Hudson

  6. Microsoft Word - 13045.doc

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaeferApril 1,(EAC) Richard2015MountainLLC TribalHouZeDepartmentPUBLIC LAW33045,

  7. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's PossibleRadiation Protection245C Unlimited ReleaseWelcome ton n u a l r e p o r

  8. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's PossibleRadiation Protection245C Unlimited ReleaseWelcome ton n u a l r e p o rMarch 21, 2014

  9. N0057000.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7 August 2008 Office7-TACi+J-UN 2DCT i*', ,,

  10. 2010SR05.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS, (803)Big Top

  11. 2010sr07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS, (803)Big

  12. 2010sr13.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS, (803)BigApril

  13. 2010sr14.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,

  14. 2010sr15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,With ARRA Funds,

  15. 2010sr16.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,With ARRA

  16. 2010sr17.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,With

  17. 2010sr18.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,WithTuesday, May

  18. 2010sr19.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo, SRNS,WithTuesday,

  19. 2010sr20.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,

  20. 2010sr21.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday July 7, 2010

  1. 2010sr22.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday July 7,

  2. 2010sr23.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday July 7,11,

  3. 2010sr24.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday July

  4. 2010sr25.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday JulyTuesday,

  5. 2010sr26.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09Paivi Nettamo,Wednesday

  6. 2010sr32.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment of Energy09PaiviWednesday, October

  7. 2011_sr_03.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment ofAugust 2011 Thu,Wednesday, February 23, 2011

  8. 2011sr01.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearch >InternshipDepartment ofAugust 2011 Thu,Wednesday, February 23,

  9. May08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighand Retrievals from a NewCuneo Matthew1, 2012 1:00 - 2:00May 2008

  10. Annual Report 2008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisiting the TWP TWPAlumni Alumni PARC/I-CARESAnalysis for NationalTotalAnnualSRS Cold

  11. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of Science (SC)Integrated Codes |IsLove Your HomeOverviewCleanupShipping Form3 - March, 201497 (9/12)

  12. Doc...~En.

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling CorpNew 1325.8. (8-89)p,Departtient,of-JAN26

  13. Doc.~:Ru.

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling CorpNew 1325.8. (8-89)p,Departtient,of-JAN26.' ,

  14. TecnaiDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over Our InstagramStructureProposedPAGESafety

  15. Index2.doc

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed offOCHCO2: FinalOffers3.pdf0-45.pdf05 Identified PatentDepartment-EnergyProjectReserve Bryan

  16. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPA

  17. Microsoft Word - 64490001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPAURTeC: 215362227/15/13x4-ASaving7

  18. Microsoft Word - 782.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPAURTeC: 215362227/15/13x4-ASaving78

  19. craig_IAEA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, , ., ..., ,+ .- web) Establish a formalGlobal

  20. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, , ., ...,exerciseTheoreticalEA - 0993 ENVIRONMENTAL

  1. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron4 Self-Scrubbing:,, , ., ...,exerciseTheoreticalEA - 0993 ENVIRONMENTAL

  2. U0004500.DOC

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthN V O'1repositoryShiprock,at

  3. U0083900.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthN V

  4. U0174100.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthN V4100 DOE/EA-1452 Environmental

  5. shprkEA.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthN V4100U.S. Department of Energy3

  6. Microsoft Word - 10063154.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthNrr-osams ADMIN551

  7. Sep08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over Our Instagram Secretary Moniz is TakingDepartmentSensitivities ofSensors and8

  8. Fonsi.Leo.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.New MexicoFinancingProofWorkingEnergyGo modelP e r f o r mAGENCY:

  9. HABAdv#167.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal Heaton Armed-MTBE (Oxygenate)Gustavusand7 Subject:

  10. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal Heaton Armed-MTBE (Oxygenate)Gustavusand7

  11. HABadv-117.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal Heaton Armed-MTBE (Oxygenate)Gustavusand77

  12. HABadv-118.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal Heaton Armed-MTBE (Oxygenate)Gustavusand778

  13. HABadv-121.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.NewofGeothermal Heaton Armed-MTBE (Oxygenate)Gustavusand7781

  14. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directed off Energy.gov. Are you sure you want to follow thishomeownerguide15b1.pdf

  15. 1146627_7.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del(ANL-IN-03-032) -Less is more:culturingProtonAPRIL/MAY9HydrateSignature127-I

  16. Oct08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's Possible for RenewableSpeeding accessSpeeding access(SC)GasOcean Aerosols: The5104478

  17. Tentative Agreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengthening a solidSynthesis of 2D AlloysTrails

  18. TentativeAgreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengthening a solidSynthesis of 2D AlloysTrailsAND RESOLUTION OF NEGOTIATIONS

  19. IEEE TRANSACTIONS ON SOFTWARE ENGINEERING, VOL. 25, NO. 3, MAY/JUNE 1999 1 J:\\PRODUCTION\\TSE\\2-INPROD\\105579\\105579-1.DOC regularpaper98.dot SL 19,968 04/14/99 2:14 PM 1 / 15

    E-Print Network [OSTI]

    Fenton, Norman

    IEEE TRANSACTIONS ON SOFTWARE ENGINEERING, VOL. 25, NO. 3, MAY/JUNE 1999 1 J:\\PRODUCTION\\TSE\\2-INPROD\\105579\\105579-1.DOC regularpaper98.dot SL 19,968 04/14/99 2:14 PM 1 / 15 A Critique of Software Defect Prediction Models Norman E. Fenton, Member, IEEE Computer Society, and Martin Neil, Member, IEEE

  20. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:FEngineers®652 U.S.SITE-WIDE206448

  1. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:FEngineers®652 U.S.SITE-WIDE20644885

  2. Microsoft Word - RIN 08051595 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:FEngineers®652 U.S.SITE-WIDE2064488508

  3. Microsoft Word - RIN 08061655 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTableSelling7111AWell:FEngineers®652

  4. Microsoft Word - RIN07050889_ DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, Disposal Site May 2013 LMS/TUB/S00213

  5. "V Doc with logo.doc"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del SolStrengtheningWildfiresImpurityRotation;ReportLANL HIPAA Privacy Notice: This

  6. Microsoft Word - 08041519_08051593_DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthNrr-osams ADMIN551 - g9.13

  7. Microsoft Word - RIN 07040836 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthNrr-osamsRFLMAGunnison, ColoradoReport

  8. Microsoft Word - RIN 08071743 DocProd.doc

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA groupTuba City, Arizona, DisposalFourthNrr-osamsRFLMAGunnison,

  9. Microsoft Word - YAK0055.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EMITTANCE CONTROL OF A BEAM BY SHAPING THE TRANSVERSE CHARGE DISTRIBUTION, USING A TOMOGRAPHY DIAGNOSTIC V. Yakimenko, M. Babzien, I. Ben-Zvi, R. Malone, X.-J. Wang, National...

  10. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    Explosives Facilities Several small projects for security, fencing, lighting, and flood control upgrades; road repair; boiler, cooling tower, and water tank repairs;...

  11. Microsoft Word - TFC-0009.doc

    Broader source: Energy.gov (indexed) [DOE]

    that time was the "Upgraded Final Safety Analysis Report for the Advanced Test Reactor, Revision 19, Effective Date 080310," from which information was redacted and withheld...

  12. T1000BAT.DOC

    E-Print Network [OSTI]

    battery with reservation. The author talks about opening up the machine and. making an adjustment on the T1000. While opening the machine does not void the.

  13. Microsoft Word - alderman.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    not readily available at the APS. Through a collaboration with the National Institute of Standards and Technology (NIST), one such technique using radiachromic films was...

  14. Microsoft Word - LS310.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    designated to be the beam axis. Using modern survey technology one can establish a control reference system with point accuracies of 150 to 300 m depending on the size of...

  15. Microsoft Word - fugro.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Helicopter to make low-level flights over Teapot Dome Oilfield Casper, Wyo. - August 1, 2007 - A helicopter will be seen making low-level flights at Naval Petroleum Reserve No. 3...

  16. Microsoft Word - DOETTQuestions.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on Governmental Relations (COGR) is an association of more than 175 research universities and their affiliated academic medical centers and research institutes. COGR...

  17. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    and may be contributing to the increases in gas prices. The price of West Texas crude oil moved down about 0.45 per barrel last week as it traded for 16.00 on Friday....

  18. Microsoft Word - TITLE.doc

    Broader source: Energy.gov (indexed) [DOE]

    Membranes Thomas A. Zawodzinski (primary contact), Francisco Uribe, Wayne Smith, Michael Eikerling, Lawrence Pratt, Antonio Redondo, Tom Springer, Judith Valerio,...

  19. Microsoft Word - Chapter 01.doc

    Broader source: Energy.gov (indexed) [DOE]

    which may contain hazardous chemicals that can be ingested; and other environmental media, through which people may come in contact with hazardous chemicals. Hazardous...

  20. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    TNT 2,4,6-trinitrotoluene TTR Tonopah Test Range U.S. United States USFWS U.S. Fish and Wildlife Service WM Waste Management Draft Site-Wide Environmental Impact Statement...

  1. Microsoft Word - ls303.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    magnitude higher than facilities with similar photon energies. 1. Introduction The use of Compton scattering of laser beams from high-energy electron beams to generate high-energy...

  2. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    season had almost 11 percent fewer heating degree days than normal. Supplies of natural gas and storage resources were ample with an end-of-January storage level of 2,045...

  3. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    crude oil production quotas. Consumer Prices: The BLS consumer price index for utility natural gas for all urban consumers (the U.S. city average) declined by about 2 percent in...

  4. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    of last year at this time (1,374 Bcf vs. 1,199). EIA estimates that 1,492 Bcf of working gas was on hand at the end of March, well above last year&20;s total of 1,185 Bcf and almost...

  5. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    markets might affect electric utilities&20; incremental demand for natural gas. Spot prices for natural gas at the Henry Hub bounced up and down throughout the week, then settled...

  6. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    of Labor Statistics (BLS) data for February, the seasonally adjusted price index for natural gas delivered to residential customers decreased slightly&26;less than 1 percent&26;between...

  7. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    increase since the end of May in the number of drilling rigs searching for natural gas (380 vs. 450) in the United States. The July contract will close on Monday, June 28....

  8. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    All this excess supply has resulted in sharp drops in the price of gas. On Friday, prices at most major markets that serve the West were all well below 1.95 per MMBtu. Futures...

  9. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    with the previous October. Increases in USIraqi tensions had no apparent impact on oil prices last week as price of West Texas Intermediate crude oil declined 30 cents per...

  10. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    fundamentals, this upward trend appears to be the result of the 35-percent drop in the natural gas rig count over the last 12 months and continued related concerns about domestic...

  11. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    of December, the spot price at the Henry Hub has moved down most days. On January 9, natural gas was trading for less than 2.10 per MMBtu, which is similar to prices seen in...

  12. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    than 19 percent higher than at the same time last year - 142 Bcf vs. 119 Bcf. Spot Prices: Natural gas continued to be traded at the Henry Hub at generally the same price level...

  13. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    percent at the same time last year. Spot Prices: At most major market locations, spot prices for gas were in the 1.75-1.90 range per MMBtu most days last week, about 0.20...

  14. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    weekly withdrawal level of about 150 Bcf. Consumer Prices: The BLS price index of natural gas to consumers declined for the first time since August as the national average for...

  15. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    fundamentals except for the recent increase in petroleum prices. As in early March, natural gas prices on the spot market at the Henry Hub and at many other major market...

  16. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    similar effects, but neither storm appeared to have any obvious direct impact on the natural gas industry. Nonetheless, both spot and futures prices moved up fairly robustly...

  17. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    indicates that in July the electric utilities in Texas consumed more than 144 Bcf of natural gas. Spot Prices: At the Henry Hub spot prices moved down each day to end the week at...

  18. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    at 2.202 per MMBtu at the close of business on Friday. This softening of natural gas prices began about 3 weeks ago and at present appears to be tied to: moderating summer...

  19. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    that several OPEC members had agreed to production quotas. West Texas crude oil prices did display some price volatility early in the week before closing at 16.80 per...

  20. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Storage: The American Gas Association (AGA) reported that an estimated 86 Bcf of natural gas was added to the industry&20;s working gas storage level during the week ended...

  1. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    for 3.548 per MMBtu at the beginning of bidweek as concerns about storage levels, natural gas replacing coal supplies at Texas utilities, and the vagaries of an &24;El Nino&23;...

  2. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    areas of coastal Louisiana. It temporarily curtailed more than 5 Bcf a day of natural gas production. This threat gave prices on both the spot and futures markets a temporary...

  3. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    with last year at this time appear to be applying downward price pressure on the NYMEX natural gas future contracts leading up to and into the early winter months. Last year, the...

  4. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    to coastal areas in North Carolina and Virginia but had virtually no effect on natural gas supply or industry infrastructure. Most of the rest of the country continues to have...

  5. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    1,413 Bcf. On November 1, 1998, the East was 99 percent full, with 1,763 Bcf in working gas storage. Spot Prices: On Monday, spot prices in virtually all markets edged upward...

  6. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    calling for it to continue, are the main factors in the current level of natural gas prices. February&20;s futures contract closed on Wednesday (January 28) at 2.001 per MMBtu,...

  7. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    operation last Friday. The plant was idled by a fire that occurred on August 13. Spot prices traded for about 5 to 10 cents higher at the Henry Hub most days last week but still...

  8. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    than 3 years. Storage: According to the latest estimate from AGA, net withdrawals of natural gas from storage during the last week of February were 47 Bcf - 30 Bcf less than the...

  9. Microsoft Word - TB-45.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    beam (as expressed in tolerances for the first and second field integrals and higher multipole moments), the undulators need to be shimmed for high spectral brilliance 10. To...

  10. Microsoft Word - TB-50.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    as FEv1.2u except the 1 st Fixed Mask is M1-20 instead of M1-30 11 Elliptical multipole wiggler (16 cm) K y,max 14.3, N18 3 2.2. Source Parameters For undulator power...

  11. Microsoft Word - Part 8.doc

    Office of Environmental Management (EM)

    section. The following sections shall be included. a. Surface Conditions A section on surface conditions shall describe current site topography, features, and structures...

  12. Microsoft Word - TUA134.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the location of the magnetic axis, as defined by the wire, is referenced to tooling balls on each magnet segment by means of a straightness interferometer. After...

  13. Microsoft Word - DUWKSUM0.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The main components are a high-brightness rf photocathode electron gun; pulse compressors; about 15 of the SLAC linac; and a long undulator with a FODO quadrupole focussing...

  14. Microsoft Word - FUSRAPtransition.doc

    Office of Environmental Management (EM)

    Compensation, and Liability Act 4 and the National Oil and Hazardous Substances Pollution Contingency Plan.5 Since 1997, four more sites were deemed eligible or were added...

  15. Microsoft Word - ls279.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the chromaticity correction capability of the sextupoles can be greatly increased by a modest increase in the horizontal tune. Increasing the horizontal tune by one unit and...

  16. Microsoft Word - ls278.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CALCULATING BPM COEFFICIENTS WITH GREEN'S RECIPROCATION THEOREM S. H. Kim March 4, 1999 1. Introduction and Conclusion For a highly relativistic charged beam, the Lorentz...

  17. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    3, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  18. Microsoft Word - Test4.doc

    Gasoline and Diesel Fuel Update (EIA)

    2, 1997 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  19. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    9, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r ic e s 1 .2 5 1 .5 0 1 .7 5 2 .0 0 2 .2 5 2 .5 0 2 .7 5 Dollars Per Million BTU N Y...

  20. Microsoft Word - winter.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    1, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  1. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    , 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r ic e s v s H e n r y H u b S p o t P r i c e s 1 .2 5 1 .5 0 1 .7 5 2 .0 0 2 .2 5 2 .5 0 2 .7 5 Dollars Per Million BTU N Y...

  2. Microsoft Word - winter.doc

    Gasoline and Diesel Fuel Update (EIA)

    , 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  3. Microsoft Word - summer.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    7, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  4. Microsoft Word - summer.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    6, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 ....

  5. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    0, 1998 http:www.eia.doe.gov A v e r a g e T e m p e r a tu r e fo r F o u r M a jo r G a s C o n s u m in g M e tr o A r e a s 0 1 0 2 0 3 0 4 0 5 0 6 0 7 0 8 0 1 0 1 9 8 1 0...

  6. Microsoft Word - summer.doc

    Gasoline and Diesel Fuel Update (EIA)

    4, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  7. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    5, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  8. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    7, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  9. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    5, 1997 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  10. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  11. Microsoft Word - winter.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    8, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  12. Microsoft Word - Test4.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    0, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  13. Microsoft Word - winter.doc

    Gasoline and Diesel Fuel Update (EIA)

    9, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  14. Microsoft Word - winter.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    3, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 .2 5 1 .5 0 1 .7 5 2 .0 0 2 .2 5 2 .5 0 2 .7 5 Dollars Per Million BTU N...

  15. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    4, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  16. Microsoft Word - summer.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    , 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 ....

  17. Microsoft Word - winter.doc

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    6, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  18. Microsoft Word - summer.doc

    Gasoline and Diesel Fuel Update (EIA)

    1, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...

  19. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    2, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  20. Microsoft Word - summer.doc

    Gasoline and Diesel Fuel Update (EIA)

    4, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...