National Library of Energy BETA

Sample records for lajos grof-tisza doc

  1. Lajos Grof-Tisza

    Broader source: Energy.gov [DOE]

    Mr. Lajos Grof-Tisza joined the Department of Energy in 2003 and currently serves as the Director of Corporate Information Systems. As the Director of Corporate Information Systems, Mr. Grof-Tisza...

  2. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  3. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  4. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  5. iManage Presentation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    iManage Presentation iManage Presentation PDF icon Tuesday_Dallas_Ballroom_D_1425_Grof-Tisza.pdf More Documents & Publications Before the House Oversight and Government Reform Subcommittee on Technology, Information Policy, Intergovernmental Relations, and Procurement Reform FY 2009 E-Government Act Report Request an iPortal Account!

  6. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  7. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  8. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  9. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  10. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  11. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  12. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  13. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  14. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  15. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  16. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  17. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  18. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  19. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  20. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  1. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  2. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  3. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  4. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  5. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  6. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  7. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  8. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  9. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  10. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  11. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  12. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  13. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  14. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  15. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  16. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  17. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  18. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  19. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  20. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  1. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  2. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  3. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  4. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  5. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  6. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  7. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  8. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  9. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  10. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  11. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  12. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  13. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  14. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  15. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  16. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  17. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  18. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  19. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  20. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  1. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  3. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  4. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  5. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  6. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  7. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  8. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  9. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  10. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  11. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  12. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  13. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  14. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  15. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  16. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  17. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  18. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  19. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  20. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  1. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  2. al99-06.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  3. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  4. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  5. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  6. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  7. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  8. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  9. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  10. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  11. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  12. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  13. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  14. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  17. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  18. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  19. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  20. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  1. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  2. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  3. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  4. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  5. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  6. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  7. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  8. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  9. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  10. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  11. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  12. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  13. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  14. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  15. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  16. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  17. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  18. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  19. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  20. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  1. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  2. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  3. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  4. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  6. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  7. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  8. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  9. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  10. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  11. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  12. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  13. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Environmental Management (EM)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  14. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  15. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  16. fleetappforms04f1298.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    fleetappforms04f1298.doc&#0; More Documents & Publications pocforms06a0399.doc&#0; Inspection Report: INS-O-09-04 Inspection Report: INS-O-06-01

  17. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcript_jedi_model.doc Microsoft Office document icon transcript_jedi_model.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  18. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc Microsoft Office document icon expanding_chp_in_your_state.doc More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  19. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. PDF icon DOCS System Configuration Management Plan More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL Baseline

  20. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc Microsoft Office document icon 20130226_sunshot_transcript_lbnl.doc More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  1. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Photos of T Building Rooms with Special ICs This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page D-1 Figure D-1. T Building Rooms with Special ICs Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page D-2 Figure D-2. T Bldg. Room 16 View A Figure D-3. T Bldg. Room 16 View B Figure D-4. T Bldg. Room 16 View

  2. Residential Retrofit Program Design Guide Overview Transcript.doc |

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Residential Retrofit Program Design Guide Overview Transcript.doc Microsoft Office document icon Residential Retrofit Program Design Guide Overview Transcript.doc More Documents & Publications Residential Retrofit Program Design Guide Overview Transcript.doc Residential Retrofit Design Guide Overview Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript

  3. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section 311 AL FAL Feb 17 2010 Financial Assistance Letter No. FAL 2006-03

  4. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides Presentations, Women-Owned Small Business Forum (May 2013)

  5. Microsoft Word - meritrev.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For Financial Assistance Application Content and Evaluation Criteria/Process Application Content and Evaluation Criteria/Process

  6. AcqGuide37pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide37pt1.doc&#0; PDF icon AcqGuide37pt1.doc&#0; More Documents & Publications Chapter 37 - Service Contracting Microsoft Word - AcqGuide37pt1 binney Nov 2010 Special Review: OAS-M-15-05

  7. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide4pt1.doc&#0; PDF icon AcqGuide4pt1.doc&#0; More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  8. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt5.doc&#0; AcqGuide70pt5.doc&#0; PDF icon AcqGuide70pt5.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts CHAPTER 3 Policy Flash 2013-62 Acquisition Letter 09 - Revision of Department of Energy (DOE) Order 350.1 and Special H Clause

  9. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Policy Flash 2013-30 Acquisition Letter on Acquisition Planning Considerations for Management and Operating Contracts

  10. Microsoft Word - AL2005-15.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5.doc Microsoft Word - AL2005-15.doc PDF icon Microsoft Word - AL2005-15.doc More Documents & Publications Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Public comment re Price-Anderson Act Public Comment on Price Anderson Act from the University of Chicago

  11. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo AcqGuide70.52Matrixpart2Redo-OPAM

  12. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Recovery Act: Wind Energy Consortia between Institutions of Higher Learning and Industry Microsoft Word - kDE-FOA-0000090.rtf DISCLAIMER:

  13. AcqGuide3pt1.doc | Department of Energy

    Energy Savers [EERE]

    pt1.doc&#0; AcqGuide3pt1.doc&#0; PDF icon AcqGuide3pt1.doc&#0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&#0;

  14. Microsoft Word - Cross Reference Matrix Introduction.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & Publications Quality Assurance Requirements USA RS Basic Contract - Contract No.: DE-RW0000005 Office of Civilian Radioactive Waste Management-Quality Assurance Requirements and Description

  15. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - AcqGuide70pt52Matrixpart2Redo Part 2, Clauses Prescribed in DEAR Parts 952 and 970

  16. CompleteProject List.doc | Department of Energy

    Office of Environmental Management (EM)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  17. al99-06attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    attachment.doc&#0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes

  18. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Environmental Management (EM)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc PDF icon Microsoft Word - Political Activity and the Federal Employee.doc More Documents & Publications Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE EIS-0307: Withdrawal of Notice of Intent to Prepare an Environmental Impact Statement

  19. Microsoft Word - al95-14.doc | Department of Energy

    Office of Environmental Management (EM)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union CDLB-1003.PDF&#0; 10 CFR 600.325 - Intellectual Property Provisions (GDLB-1003) Grant

  20. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Environmental Management (EM)

    fal2004-04.doc Microsoft Word - fal2004-04.doc PDF icon Microsoft Word - fal2004-04.doc More Documents & Publications Financial Assistance Guide (2013) For Profit Audits - Information Related to 12/21/11 Federal Register Notice Policy Flash Search Listing (2001-2014)

  1. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Environmental Management (EM)

    CSATCourseCatalog_02.doc Microsoft Word - CSATCourseCatalog_02.doc classroom-1008856_960_720.jpg PDF icon Microsoft Word - CSATCourseCatalog_02.doc More Documents & Publications CSAT Course Catalog Headquarters Facilities Master Security Plan - Chapter 17, Headquarters Security Officer Program Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program

  2. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing (2001-2014) POLICY FLASH 2015-32 - FAC 2005-83

  3. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers Clean Cities Regional Support & Petroleum Displacement Awards Clean Cities 2009 Petroleum Displacement Awards

  4. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Environmental Management (EM)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc PDF icon Microsoft Word - LibraryofPriorRulemakings.doc More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  5. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    Gunnison, Colorado, Processing Site September 2010 LMS/GUP/S06692 This page intentionally left blank LMS/GUP/S06692 2010 Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report-Gunnison, Colorado, Processing Site September 2010 Doc. No. S06692 Page i Contents

  6. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Present Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page A-iii Contents A1.1 Location and Property Ownership ................................................................................1 A1.2 Physiography and Topography.....................................................................................4 A1.3 Hydrogeology

  7. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Final Sample Participant Profile November 2008.doc

  8. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR-Provisions-FederalAcquisitionReg.doc Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc PDF icon Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc

  9. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&#0; EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc

  10. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&#0; 2011-31 Attachment Aquisition Letter AcqGuide38pt1.doc&#0;

  11. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  12. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    Report for the Gunnison, Colorado, Processing Site August 2009 LMS/GUP/S05527 This page intentionally left blank LMS/GUP/S05527 2009 Verification Monitoring Report for the Gunnison, Colorado, Processing Site August 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. No. S05527 Page i Contents

  13. Microsoft Word - S06371_VMR_060210.doc

    Office of Legacy Management (LM)

    Naturita, Colorado, Processing Site May 2010 LMS/NAP/S06371 This page intentionally left blank LMS/NAP/S06371 Office of Legacy Management Verification Monitoring Report for the Naturita, Colorado, Processing Site May 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report⎯Naturita, Colorado May 2010 Doc. No. S06371 Page i Contents 1.0 Introduction

  14. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 LMS/NAP/S07050 This page intentionally left blank LMS/NAP/S07050 Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy Naturita-Monitoring Report for Wetland Area September 2010 Doc. No. S07050 Page i Contents 1.0 Introduction

  15. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  16. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  17. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  18. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  19. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  20. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  1. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  2. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  3. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  4. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  5. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 LMS/RFN/S06654 ESL-RPT-2010-01 This page intentionally left blank LMS/RFN/S06654 ESL-RPT-2010-01 Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 This page intentionally left blank U.S. Department of Energy Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater, Rifle, Colorado July 2010 Doc.

  6. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Final Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page A-iii Contents A1.0 Weldon Spring Site Description and History................................................................... A-1 A1.1 Location and Property Ownership .......................................................................... A-1 A1.2 Physiography and

  7. Microsoft Word - Appendix B.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU)

  8. Microsoft Word - S01382_September2004.doc

    Office of Legacy Management (LM)

    S0138200 Verification Monitoring Report for the Gunnison, Colorado, UMTRCA Title I Processing Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Verification Monitoring Report-Gunnison, Colorado September 2004 Doc. No. S0138200 Page iii Contents Acronyms and Abbreviations

  9. Microsoft Word - S06350_EA.doc

    Office of Legacy Management (LM)

    Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 LMS/DUD/S06350 DOE/EA 1770 This page intentionally left blank LMS/DUD/S06350 DOE/EA 1770 Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Disposal Site August 2010 This page intentionally left blank U.S. Department of Energy Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 Doc. No. S06350 Page i Contents Summary

  10. Microsoft Word - BreakoutSummary.doc

    Office of Environmental Management (EM)

    H:/TECWG/January 2002/Breakout Worksheets.doc *The number appearing in brackets refer to the number of participants with the same comment. 1. On a scale of 1 (lowest) to 10 (highest), how would you rate TEC's effectiveness relative to other comparable organizations? Average score = 7.51 2. The TEC mission is to "serve as a mechanism to provide continuing and improved coordination between appropriate DOE elements, other levels of government, and outside organizations having a responsibility

  11. Microsoft Word - DOE RFI.doc

    Office of Environmental Management (EM)

    Ms. Patricia Hoffman Assistant Secretary United States Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, DC 20585 RE: Smart Grid RFI Dear Assistant Secretary Hoffman, Thank you for the opportunity to provide information to the Department of Energy Federal Register Doc. 2010-23251 filed September 16, 2010. With our recent acquisition of Ventyx, ABB is one of the few companies in the smart grid space that can approach the entire smart grid value chain, from distributed

  12. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc&#0; AL2007-02.doc&#0; PDF icon AL2007-02.doc&#0; More Documents & Publications Attached is Policy Flash 2013-34 Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2014-07 Policy Flash 2014-29 Acquisition Letter 2014-07 - Benchmark Compensation Amount for Individual Executive Salary Actions

  13. AcqGuide70pt4.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt4.doc&#0; AcqGuide70pt4.doc&#0; PDF icon AcqGuide70pt4.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts Acquisition Letter No. AL 2014-01

  14. Microsoft Word - AL2005-13.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-13.doc PDF icon Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&#0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the West Hackberry Brine Tank-14 Resulting in Injury, Strategic Petroleum Reserve West Hackberry, LA Microsoft Word - AcqGuide37pt1 binney Nov 2010

  15. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  16. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  17. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  18. DOC-DOE China Mission Announcement Press Release | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPOEmail-Update001Through11

  19. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  20. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  1. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  2. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  4. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  5. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  6. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  7. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  8. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  9. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  10. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  11. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  12. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  13. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  14. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  15. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Environmental Management (EM)

    DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; PDF icon DOE HR Guidebook 12_15_05.DOC&#0; More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  16. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  17. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OP-PR-0015.001.doc Begin Shutdown Date: 2000/12/08 To eliminate the possibility of going into a state of operations when people may be working on ladders or in the ring, the following SOP's are required of every shutdown. A shutdown is defined as a period wherein there are no accelerator operations. This procedure is in effect for all scheduled shutdowns and for non-scheduled shutdowns lasting more than 24 hours. 1. The accelerator staff must inform the CAMD staff of a shutdown via e-mail. In

  18. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  19. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  20. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  1. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    09 August 2010 LMS/WEL/S06713 LMS/WEL/S06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS/WEL/S06713 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 This page intentionally left blank U.S. Department of Energy Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 Doc. No. S06713 Page i Contents

  2. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  3. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Annual Assessment Checklists For Parcels D, H, 4, and 3 and Phase I Land Parcel (Physical Walkover Conducted on April 14, 2009) This page intentionally left blank CHECKLIST WORKSHEET - COMBINED - ALL PARCELS Review of Effectiveness of Institutional Controls U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page A-1 Parcels reviewed: D, H, 3, 4, 6, 7, 8, and Phase I (A, B, and C) Preliminary inspections performed on:

  4. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 LMS/MND/S06401 This page intentionally left blank LMS/MND/S06401 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page i Contents

  5. energyefficiencyink12schoolsandstateapplications.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    energyefficiencyink12schoolsandstateapplications.doc Microsoft Office document icon energyefficiencyink12schoolsandstateapplications.doc More Documents & Publications Energy Efficiency in K-12 Schools & State Applications CERTIFICATE OF AUTHENTICITY Successful Partnerships and Lessons from the Field, Part 1, Webinar Transcript

  6. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 2007_5_05_08 rev 1.doc Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc PDF icon Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc More Documents & Publications FY 2007 Total System Life Cycle Cost, Pub 2008 Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc FY 2007 Fee Adequacy, Pub 2008

  7. AcqGuideChapter39pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuideChapter39pt2.doc&#0; AcqGuideChapter39pt2.doc&#0; PDF icon AcqGuideChapter39pt2.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology Department of Energy (DOE) Acquisition Guide Microsoft Word - AL2006-08.doc

  8. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party Agreement for Energy Savings Performance Contracts Photovoltaics at DOE's National Renewable Energy Laboratory License

  9. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf FAL2003-03.pdf

  10. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc Audit Report: IG-0857 Audit Report: OAS-M-13-07

  11. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  12. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  13. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Environmental Management (EM)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc PDF icon Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  14. Microsoft Word - 1_2011_CEG_Update_v2.doc | Department of Energy

    Office of Environmental Management (EM)

    1_2011_CEG_Update_v2.doc Microsoft Word - 1_2011_CEG_Update_v2.doc PDF icon Microsoft Word - 1_2011_CEG_Update_v2.doc More Documents & Publications OPAM Policy Acquisition Guides Microsoft Word - AL2006-07.doc IT Project Management Profile

  15. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Environmental Management (EM)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc PDF icon Microsoft Word - GC Mediation Evaluation _2-06-09_.doc More Documents & Publications Mediation Survey Form Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  16. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    NDEP Correspondence and Record of Review This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page D-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-3 Due Date 12-23-09 Review No. 1 Project Offsites -

  17. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  18. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&#0; Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  19. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Environmental Management (EM)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc PDF icon Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  20. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  1. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER (Sept 2010) (a) Definitions. (1)...

  2. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  3. Experimental Evaluation of DOC Performance Using Secondary Fuel Injection |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_Yetkin.pdf More Documents & Publications Engine Tests of an Active PM

  4. Design Potential of Metal Foil Substrates for Optimized DOC Performance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_rice.pdf More Documents & Publications Components for Optimized SCR

  5. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1.doc

  6. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

  7. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  8. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers [EERE]

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  9. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  10. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  11. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc PDF icon Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  12. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More Documents & Publications Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc USA RS Basic Contract - Contract No.: DE-RW0000005 Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  13. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers [EERE]

    RFQ DE-RQ01-04ME90001.doc&#0; RFQ DE-RQ01-04ME90001.doc&#0; PDF icon RFQ DE-RQ01-04ME90001.doc&#0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&#0; Operating Guidelines Appendix A B

  14. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FINAL1.DOC Microsoft Word - DP_cover_and_front matter_FINAL1.DOC PDF icon Microsoft Word - DP_cover_and_front matter_FINAL1.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC EA-1552: Final Environmental Assessment Probabilistic Modeling and Phase 2 Decision Making at the West Valley Demonstration Project and the Western New York Nuclear Service Center

  15. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc Microsoft Office document icon advanced_biofuels_pathways_webinar_alt_text.doc More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  16. First NESAP Post-doc Takes on BoxLib

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  17. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  18. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Legal Descriptions and Ownership Information of Institutional Control Areas U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that parcel of land lying within St. Charles County, Missouri, comprising the Federal facility identified as the

  19. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial Assistance Actions SEB Secretariat and Knowledge Manager Policy Flash 2015-09

  20. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications Policy Flash 2013-09 ACQUISITION PLANNING Policy Flash 2015-13

  1. Microsoft Word - Brochure_Senior Officials.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Brochure_Senior Officials.doc Microsoft Word - Brochure_Senior Officials.doc PDF icon Microsoft Word - Brochure_Senior Officials.doc More Documents & Publications Preservation of Department of Energy Federal Records Records Management Exit Procedures Procedures for Departing Employees

  2. Microsoft Word - FEMP-State MOU pdf version.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP-State MOU pdf version.doc Microsoft Word - FEMP-State MOU pdf version.doc PDF icon Microsoft Word - FEMP-State MOU pdf version.doc More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group Meeting: Washington Update

  3. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc PDF icon Microsoft Word - Fact Sheet Environment 100808 FINAL.doc More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  4. Microsoft Word - NationalPolicyAssurances5-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications Microsoft Word - NationalPolicyAssurances907.rtf

  5. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion | Department of Energy Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Performance of two commercially available DOCs with different precious

  6. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Environmental Management (EM)

    Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; PDF icon Fact Sheet -- Climate VISION 02-12-031.doc&#0; More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  7. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

  8. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Environmental Management (EM)

    va_Final3a_06-04-032.doc Microsoft Word - va_Final3a_06-04-032.doc PDF icon Microsoft Word - va_Final3a_06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters Facilities Master Security Plan - Chapter 1, Physical Security DOE F 473.2

  9. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Environmental Management (EM)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc PDF icon NDIA_PMSC_SurveillanceGuide_Oct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Enhancing Earned Value (EV) Analysis Using Project Assessment & Reporting System (PARS II) - Road Show Presentation

  10. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Environmental Management (EM)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc PDF icon Microsoft Word - ADR Revised Policy82508Reformatted.doc More Documents & Publications ADR Revised Policy ADR Policy Federal Register Document

  11. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Environmental Management (EM)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc PDF icon Microsoft Word - CHAP02ESH _REVISED1_3.doc More Documents & Publications Chapter 70 - DOE Management and Operating Contracts Regulatory Aspects of ISM COMMENTS&#0;

  12. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers [EERE]

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  13. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  14. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  15. Microsoft Word - S04674_2008VMR.doc

    Office of Legacy Management (LM)

    for the Durango, Colorado, Processing Site September 2008 LMS/DUP/S04674 This page intentionally left blank LMS/DUP/S04674 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2008 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2008 Doc. No. S0467400 Page iii Contents Acronyms and Abbreviations

  16. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  17. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  18. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  19. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  20. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  1. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  2. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  3. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  4. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  5. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  6. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  7. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  8. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  9. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,

  10. Microsoft Word - S06397_Apr09 thru Mar10.doc

    Office of Legacy Management (LM)

    Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 LMS/TUB/S06397 This page intentionally left blank LMS/TUB/S06397 Annual Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2009 through March 2010 July 2010 Doc. No. S06397 Page i Contents 1.0 Introduction

  11. Microsoft Word - S06430_JanMar.doc

    Office of Legacy Management (LM)

    31, 2010 April 2010 Doc. No. S06430 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: January 1-March 31, 2010 This report summarizes project status and activities implemented January through March 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly site

  12. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  13. Microsoft Word - S06584StSoil.doc

    Office of Legacy Management (LM)

    Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 LMS/MON/S06584 This page intentionally left blank LMS/MON/S06584 Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 Doc. No. S06584 Page i Contents

  14. Microsoft Word - S06770_AprJune.doc

    Office of Legacy Management (LM)

    April 1-June 30, 2010 July 2010 Doc. No. S06770 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: April 1-June 30, 2010 This report summarizes project status and activities implemented April through June 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly

  15. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  16. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  17. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU) consistent with the

  18. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  19. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    Distribution List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page G-3 Except for individual stakeholders, this distribution list is composed of people representing organizations, which have expressed interest in site activities. When individual turnover occurs in these positions, DOE will revise the list to reflect the current holder of these positions. This type of revision is considered minor and not subject to review. All individuals on this list

  20. Microsoft Word - Appendix I-LCRS Operating Plan.doc

    Office of Legacy Management (LM)

    July 2005 Doc. No. S0079000 Page I-3 I1.0 Purpose The purpose of this document is to provide information necessary for the proper operation and maintenance of the Leachate Collection and Removal System (LCRS). Specifically, the subsequent sections will provide the information relating to the management of leachate, maintenance and calibration of liquid level, general equipment maintenance, and reporting requirements. I2.0 Facility Description The LCRS facility is located at the north end of the

  1. Microsoft Word - Final TEC Meeting Summary_September_2004.doc

    Office of Environmental Management (EM)

    TEC Meeting Summary_September_2004.doc 1 U.S. Department of Energy Transportation External Coordination Working Group Meeting Minneapolis, Minnesota September 20-22, 2004 The U.S. Department of Energy (DOE), Transportation External Coordination Working Group (TEC) held its 23 rd meeting on September 20-22, 2004, in Minneapolis, Minnesota. Ninety-six participants, representing national, State, Tribal, and local government; industry; professional organizations; and other interested parties, met to

  2. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  3. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc PDF icon Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  4. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy PressRelease_Siting_2-8-06_Final.doc Microsoft Word - PressRelease_Siting_2-8-06_Final.doc PDF icon Microsoft Word - PressRelease_Siting_2-8-06_Final.doc More Documents & Publications EIS-0394: Advance Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Draft Environmental Impact Statement

  5. Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy SMail_Secure_Web-Based_Email_v3 _2_.doc Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc PDF icon Instructions for Using Secure Email via Outlook Web Access More Documents & Publications Using Two-Factor RSA Token with WebVPN Citrix_2FA_Authentication_09.09 Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc

  6. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Environmental Management (EM)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc PDF icon Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  7. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Environmental Management (EM)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 Mtg-09.09.10.doc More Documents & Publications Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Earthjustice, Appliance Standards Awareness Project, Natural Resources Defense Council - Comments in response to DOE solicitation of views on the implementation of test procedure waivers for large capacity clothes

  8. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy R1_Draft_3.DOC Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC PDF icon Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_FINAL1.DOC WVDP Waste Incidental to Reprocessing Evaluation for the Concentrator Feed Makeup Tank and the Melter Feed Hold Tank Waste-Incidental-to-Reprocessing Evaluation for the West Valley Demonstration Project Vitrification Melter

  9. Microsoft Word - 25 May Vienna GTR Fact Sheet_FINAL 1 .doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 .doc More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction InitiativeU.S.-Origin Nuclear Fuel Removals Global Threat Reduction Initiative...

  10. PIC DOC 01/08/11 … SOS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PIC DOC 01/08/11 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta [Meetings, of many kinds, are probably the most utilized of all the public involvement activities. Meetings are attempts at direct democracy, but often provide only limited opportunities for members of the public to engage with issues and decision makers. In many cases, this engagement is brief and comes only after the issues have been framed and a narrow menu of choices

  11. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  12. Microsoft Word - ex1b-ITER-mar07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  13. Microsoft Word - ex9-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  14. Microsoft Word - ex9ed-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  15. Microsoft Word - ex9rdf-ITER-sept09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  16. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    HTH-2 Data and 2009 Well Survey Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page A-1 Table A-1 Groundwater Quality Data by Location Groundwater Quality Data by Location (USEE100) FOR SITE CNT01, Central Nevada Test Area Site REPORT DATE: 9/11/2009 Location: HTH-2 WELL Parameter Units Sample Date ID Depth Range (Ft BLS) Result Qualifiers Lab Data QA Detection Limit Uncertainty Alkalinity, Total (As CaCO3)

  17. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  18. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  19. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  20. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Description of Groundwater Modeling This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page A-3 A1.0 Modeling Codes Groundwater flow in the Building 100 area is simulated with the finite-difference code MODFLOW, as developed by the U.S. Geological Survey (McDonald and Harbaugh 1988, Harbaugh and McDonald 1996). The particle tracking module MODPATH (Pollock 1989) is employed to

  1. Microsoft Word - S01187_RVT LTMP.doc

    Office of Legacy Management (LM)

    Management Plan for the Riverton, Wyoming, Processing Site September 2009 LMS/RVT/S001187-0.0 Formerly DOE-LM/1430-2007 This page intentionally left blank LMS/RVT/S01187-0.0 Formerly DOE-LM/1430-2007 Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 Doc. No. S01187-0.0 Page i Contents

  2. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  3. Microsoft Word - S04704_2008 PCI.doc

    Office of Legacy Management (LM)

    Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada January 2009 LMS/CNT/S04704 This page intentionally left blank LMS/CNT/S04704 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada January 2009 This page intentionally left blank U.S. Department of Energy CY 2008 Post-Closure Inspection & Monitoring Report for CAU 417 January 2009 Doc.

  4. Microsoft Word - S05418_NatEnhAttenuation.doc

    Office of Legacy Management (LM)

    Natural and Enhanced Attenuation of Soil and Groundwater at the Monument Valley, Arizona, DOE Legacy Waste Site 2008 Pilot Study Status Report August 2009 LMS/MON/S05418 This page intentionally left blank LMS/MON/S05418 Natural and Enhanced Attenuation of Soil and Groundwater at the Monument Valley, Arizona, DOE Legacy Waste Site 2008 Pilot Study Status Report August 2009 This page intentionally left blank U.S. Department of Energy 2008 Pilot Study Status Report August 2009 Doc. No. S05418 Page

  5. Microsoft Word - TEC Participants_Sep_2004rev.doc

    Office of Environmental Management (EM)

    TEC Participants_Sep_2004.doc 10/28/2004 1 PARTICIPANTS U.S. DEPARTMENT OF ENERGY (DOE) TRANSPORTATION EXTERNAL COORDINATION WORKING GROUP (TEC) MEETING MINNEAPOLIS, MINNESOTA SEPTEMBER 20-22, 2004 Catherine Anne, Transportation Manager NAC International 3930 East Jones Bridge Road Suite 200 Norcross, Georgia 30092 (678) 328-1343 FAX: (678) 328-1543 canne@nacintl.com Richard Arnold Native American Interactions 1180 N. Town Center Drive Las Vegas, Nevada 89144-6363 (702) 339-7200 FAX: (702)

  6. Microsoft Word - Appendix C_DisposalCellContents.doc

    Office of Legacy Management (LM)

    Disposal Cell Contents Table C-1. Contents of the Weldon Spring, Missouri, Disposal Cell U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page C-3 Work Zone Per WP437 and Material Description Cell Placement Considerations Occupied Cell Volume (cy) Raffinate Pits Work Zone CSS Grout Produced in CSS Plant and pumped to cell. Volume as determined at the plant. 188,443.00 Raffinate Pit 4 residual sludge Stabilized in situ with grout then mixed with TSA

  7. Microsoft Word - Appendix F_OfficialContactList.doc

    Office of Legacy Management (LM)

    Official Contact List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page F-3 Long-Term Surveillance and Maintenance Emergency Contact List Environmental Protection Agency Mr. Dan Wall Remedial Project Manager Superfund Division U.S. EPA Region 7 901 North 5 th Street Kansas City, Kansas 66101 (913) 551-7710 Missouri Department of Natural Resources Mr. Robert Geller Chief, Federal Facilities Section Missouri Department of Natural Resources 1738 East Elm

  8. Microsoft Word - Appendix H - InspectionChecklist.doc

    Office of Legacy Management (LM)

    H Annual Inspection Checklist U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page H-3 Annual Site Inspection Checklist Purpose of the Checklist This checklist has been developed from the EPA guidance document Comprehensive Five Year Review Guidance dated June 2001 (OSWER No. 9355.7-03B-P) and from Section 2.3 of the Long-Term Surveillance and Maintenance Plan for the Weldon Spring, Missouri, Site. The checklist was modified to site-specific conditions as

  9. Microsoft Word - Appendix L_ContingencyPlan.doc

    Office of Legacy Management (LM)

    Well Field Contingency Plan U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page L-3 L1.0 Planning and Preparation Under this contingency plan, which supersedes the Well Field Contingency Plan (DOE 1992b), any production capacity lost to the existing well field due to confirmed contaminant migration from the Weldon Spring Quarry (Quarry) will be replaced. While it is highly unlikely that such measures will be implemented, this plan defines the minimum

  10. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry

    2014-01-01

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western Russia.

  11. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Environmental Management (EM)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings PDF icon Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL

  12. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc PDF icon Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc More Documents & Publications Electronic DOE Information Security System (eDISS) PIA, Office of Health Safety and Security FY 2010 E-Government Act Report DOE E-Government Act Report FY 2007

  13. Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Settlement Agreement - FINAL - 01-06-061.doc Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc PDF icon Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc More Documents & Publications Memorandum of Understanding Between the United States Department of Energy and the Washington State Department of Ecology for Development of the Hanford Site Tank Closure and Waste Management EIS ("TC&WM EIS") EIS-0391: Record of Decision Richland/Office of

  14. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  15. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Environmental Management (EM)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc PDF icon Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy R&D

  16. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  17. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    HTH-1RC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page E-1 Table E-1. HTH-1RC_Chronology Date Time Depth (ft bgs) Activity 05/26/09 15:45 - 21:00 NA DH rig (LK17) arrives on site, rig is inspected, tire replaced, and rig was moved to HTH-1 pad. 05/26/09 23:30 NA Fishing tool was run 180 ft down HTH-1 and the bladder pump was retrieved. 05/27/09 01:00 NA Rig is moved off HTH-1 and goes to UC-1-P-1S

  18. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Miscellaneous Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page F-1 Table F-1. MV-1 Tritium Results Sample Identification Date Time Depth (ft) MDA (dpm) Tritium (pCi/L) MDC (pCi/L) Upper Piezometer Development MV-1 - Air MV-1 Well Dev. 05/25/09 2250 WD 36.56 -1441 3294 MV-1 Well Dev. 05/26/09 0100 WD 35.86 540 3230 MV-1 Well Dev. 05/26/09 0216 WD 35.71 810 3217 MV-1 Well Dev. 05/26/09 0335 WD 36.80 450

  19. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - ... The vendor has issued a fix. Addthis Related Articles V-181: Oracle Java SE Critical Patch ...

  20. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. PDF icon...

  1. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  2. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii

    Office of Legacy Management (LM)

    DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction .........................................................................................................................................1 1.1 Purpose ................................................................................................................................1 1.2 Legal and Regulatory Requirements

  3. Impact of Biodiesel Metals on the Performance and Durability of DOC and DPF

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies | Department of Energy the Performance and Durability of DOC and DPF Technologies Impact of Biodiesel Metals on the Performance and Durability of DOC and DPF Technologies Poster presented at the 16th Directions in Engine-Efficiency and Emissions Research (DEER) Conference in Detroit, MI, September 27-30, 2010. PDF icon p-16_williams.pdf More Documents & Publications Impact of Fuel Metal Impurities on Diesel Exhaust Catalysts Deactivation of Accelerated Engine-Aged and

  4. Final Solar and Wind H2 Report EPAct 812.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar and Wind H2 Report EPAct 812.doc Final Solar and Wind H2 Report EPAct 812.doc Report to Congress (ESECS EE-3060) in response to section 812(e) of the Energy Policy Act of 2005 summarizing technology roadmaps for solar- and wind-based hydrogen production. PDF icon Solar and Wind Technologies for Hydrogen Production: Report to Congress More Documents & Publications Technoeconomic Boundary Analysis of Biological Pathways to Hydrogen Production Analysis Activities at National Renewable

  5. CIGNLCommentsDOECSCRulemaking11-30-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CIGNLCommentsDOECSCRulemaking11-30-10.doc CIGNLCommentsDOECSCRulemaking11-30-10.doc The Contractors International Group on Nuclear Liability (CIGNL) hereby submits comments in response to the U.S. Department of Energy (DOE) Notice of Inquiry (NOI) on the Convention on Supplementary Compensation for Nuclear Damage (CSC) Contingent Cost Allocation.1 75 Fed. Reg. 43945 (Jul. 27, 2010); 75 Fed. Reg. 51986 (Aug. 24, 2010); and, 75 Fed. Reg. 64717 (Oct. 20, 2010). PDF icon

  6. Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    System | Department of Energy Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System effect and performance recovery studies at system level with typical diesel emission control consisting of diesel oxidation catalyst, catalyzed soot filter, and selective catalytic reduction PDF icon deer11_tang.pdf More Documents & Publications Investigation of Sulfur Deactivation on Cu/Zeolite SCR

  7. Microsoft Word - DE-FOA-0000013 Amendment 000003.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - DE-FOA-0000013 Amendment 000003.doc Microsoft Word - DE-FOA-0000013 Amendment 000003.doc This amendment extends the application due date for State Applicants from May 11, 2009 to June 25, 2009 for Recovery Act Energy Efficiency and Conservation Block Grants (EECBG) formula grants. PDF icon de_foa_0000013_amendment_000003.pdf More Documents & Publications Funding Opportunity Announcement: Recovery Act … Energy Efficiency and Conversation Block Grants … Formula Grants

  8. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: 2009-02-01 OSTI Identifier: 1142774 Report Number(s): SAND2009-0912C 508394 DOE Contract Number: DE-AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: Doe peer review held March 9-10, 2009 in denver, CO.; Related Information: Proposed for presentation at the doe peer review held March

  9. Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a U.S. HD Diesel Engine | Department of Energy a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Lower platinum-metal group catalysts can be used to save money while offering equivalent or better hydrocarbon performanc and longer life and durability. PDF icon deer08_kramer.pdf More Documents & Publications Design Potential of Metal Foil Substrates for

  10. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    North America (US), L.P. | Department of Energy Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. PDF icon EA-339-A Shell Energy (CN).pdf More Documents & Publications EA-339-A Shell Energy North America (US), L.P. EA-339 Shell Energy North America (US), L.P. EA-359-B Castleton Commodities Merchant Trading L.P.

  11. Evaluation of SCR and DOC/CPF Tech in Diesel Exhaust Emission Control to

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Meet U.S. Tier 2 Bin 5 | Department of Energy SCR and DOC/CPF Tech in Diesel Exhaust Emission Control to Meet U.S. Tier 2 Bin 5 Evaluation of SCR and DOC/CPF Tech in Diesel Exhaust Emission Control to Meet U.S. Tier 2 Bin 5 The continuous regeneration trap may cause irreversibly negative effects on the NOx removal efficiency of the SCR system. PDF icon deer08_choung.pdf More Documents & Publications Experimental Studies for DPF and SCR Model, Control System, and OBD Development for

  12. Microsoft Word - S05773_2009 VerifMonRpt.doc

    Office of Legacy Management (LM)

    September 2009 LMS/DUP/S05773 This page intentionally left blank LMS/DUP/S05773 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2009 Doc. No. S05773 Page i Contents

  13. Microsoft Word - S03924_ITL STP Final RevisionA-3-1-10.doc

    Office of Legacy Management (LM)

    Office of Environmental Management and Office of Legacy Management Site Transition Plan for the Inhalation Toxicology Laboratory March 2010 This page intentionally left blank U.S. Department of Energy Site Transition Plan for the Inhalation Toxicology Laboratory March 2010 Doc. No. S03924 Rev. 0 Page i Contents Abbreviations...................................................................................................................................v Executive Summary

  14. Microsoft Word - S06087_3rd qtr 2009 rpt - final.doc

    Office of Legacy Management (LM)

    Third Quarter Calendar Year 2009 January 2010 LMS/RFS/S06087 This page intentionally left blank LMS/RFS/S06087 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Third Quarter Calendar Year 2009 January 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-3rd Quarter CY 2009 January 2010 Doc. No. S06087 Page i Contents

  15. Microsoft Word - Apr-June 2012 Monticello Quarterly_S09178_FFA -final.doc

    Office of Legacy Management (LM)

    2 June 2012 Doc. No. S09178 Page 1 Monticello, Utah, National Priorities List Sites Federal Facility Agreement Quarterly Report: April 1-June 30, 2012 1.0 Introduction This report summarizes the status of the Monticello Vicinity Properties (MVP) and the Monticello Mill Tailings Site (MMTS), located in and near Monticello, Utah, for the period of April through June 2012. The report also includes a summary of projected near-term activity and reporting requirements. Quarterly reports are submitted

  16. Microsoft Word - July-Sept 2012 FFA Monticello Quarterly Report.doc

    Office of Legacy Management (LM)

    2 October 2012 Doc. No. S09401 Page 1 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: July 1-September 30, 2012 1.0 Introduction This report summarizes the status of the Monticello Vicinity Properties (MVP) and the Monticello Mill Tailings Site (MMTS), located in and near Monticello, Utah, for the period of July through September 2012. The report also includes a summary of projected near-term activity and reporting requirements. Quarterly

  17. Microsoft Word - S04516_2008 GW Rpt Cover.doc

    Office of Legacy Management (LM)

    October 2007 through April 2008 September 2008 LMS/MNT/S04516 This page intentionally left blank LMS/MNT/S04516 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report October 2007 through April 2008 September 2008 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report October 2007-April 2008 September 2008 Doc. No. S0451600 Page iii Contents 1.0

  18. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    Macroinvertebrate Sampling for 2008 and Summary of Biomonitoring Studies December 2008 LMS/MNT/S04916 This page intentionally left blank LMS/MNT/S04916 Monticello Mill Tailings Site Macroinvertebrate Sampling for 2008 and Summary of Biomonitoring Studies December 2008 This page intentionally left blank U.S. Department of Energy 2008 Macroinvertebrate Sampling-Monticello, Utah December 2008 Doc. No. S0491600 Page i Contents Executive

  19. Microsoft Word - S05037_Trench2_03-02-09.doc

    Office of Legacy Management (LM)

    Trench 2 Groundwater Remediation System at the Shiprock, New Mexico, Legacy Management Site March 2009 LMS/SHP/S05037 This page intentionally left blank LMS/SHP/S05037 Evaluation of the Trench 2 Groundwater Remediation System at the Shiprock, New Mexico, Legacy Management Site March 2009 This page intentionally left blank U.S. Department of Energy Evaluation of Trench 2 Groundwater Remediation System at Shiprock March 2009 Doc. No. S05037 Page i Contents 1.0 Introduction

  20. Microsoft Word - S05263_2009 Annual IC Assmt Rpt.doc

    Office of Legacy Management (LM)

    Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2009 LMS/MND/S05263 This page intentionally left blank LMS/MND/S05263 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2009 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2009 Doc. No. S05263 Page i Contents

  1. Microsoft Word - S08399_2012 MMTS 5yrRev.doc

    Office of Legacy Management (LM)

    Five-Year Review Report Fourth Five-Year Review Report For Monticello Mill Tailings (USDOE) Site, San Juan County, Monticello, Utah June 2012 LMS/MNT/S08399 This page intentionally left blank June 18, 2012 This page intentionally left blank This page intentionally left blank U.S. Department of Energy Fourth Five-Year Review for MMTS June 2012 Doc. No. S08399 Page i Contents Abbreviations

  2. Microsoft Word - S08400_2012_MVP_5yrRev.doc

    Office of Legacy Management (LM)

    Fourth Five-Year Review Report For Monticello Radioactively Contaminated Properties Superfund Site San Juan County Monticello, Utah June 2012 LMS/MNT/S08400 This page intentionally left blank June 18, 2012 This page intentionally left blank This page intentionally left blank U.S. Department of Energy Fourth Five-Year Review Report for MVP June 2012 Doc. No. S08400 Page i Contents Abbreviations

  3. Microsoft Word - S09615_oct_dec2012 Quarterly Report.doc

    Office of Legacy Management (LM)

    31, 2012 January 2013 LMS/MNT/S09615 This page intentionally left blank LMS/MNT/S09615 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: October 1-December 31, 2012 January 2013 This page intentionally left blank U.S. Department of Energy Monticello NPL Sites FFA Quarterly Report: October-December 2012 January 2013 Doc. No. S09615 Page i Contents Abbreviations

  4. Microsoft Word - N01357_NE Site Final LDA Report.doc

    Office of Legacy Management (LM)

    Interim Remedial Action for Source Removal at the Northeast Site Final Report September 2009 LMS/PIN/N01357 This page intentionally left blank LMS/PIN/N01357 Pinellas Environmental Restoration Project Interim Remedial Action for Source Removal at the Northeast Site Final Report September 2009 This page intentionally left blank U.S. Department of Energy Interim Remedial Action for Source Removal at the Northeast Site-Final Report September 2009 Doc. No. N01357 Page i Contents

  5. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    Salmon, Mississippi, Site Calender Year 2008 March 2009 LMS/SAL/S05212 This page intentionally left blank LMS/SAL/S05212 Post-Closure Inspection, Sampling, and Maintenance Report for the Salmon, Mississippi, Site Calendar Year 2008 March 2009 This page intentionally left blank U.S. Department of Energy Post-Closure Inspection, Sampling, and Maintenance Report for Salmon-Calendar Year 2008 March 2009 Doc. No. S05212 Page i Contents

  6. Microsoft Word - Appendix J-LCRS-Train 3 Treament Contingency Plan1.doc

    Office of Legacy Management (LM)

    February 2005 Second Draft Final Doc. No. S00790AG Page I-3 I1.0 Purpose The purpose of this document is to provide information necessary for the proper operation and maintenance of the Leachate Collection and Removal System (LCRS). Specifically, the subsequent sections will provide the information relating to the management of leachate, maintenance and calibration of liquid level, general equipment maintenance, and reporting requirements. I2.0 Facility Description The LCRS facility is located

  7. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    Ground Water Model-Predicted Uranium Concentrations This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. No. S0245900 Page G-3 Table G-1. Uranium Concentration Variation: Background Locations Observations Loc 92-01 Loc 92-03 Loc 92-05 Loc MW00-01 Loc MW00-02 Date Sampled Uranium (mg/L) Uranium (mg/L) Uranium (mg/L) Uranium (mg/L) Uranium (mg/L) 11/12/1992 0.0058 0.0048 03/08/1993

  8. Microsoft Word - S09330_2ndQtr2012.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2012 October 2012 LMS/RFS/S09930 This page intentionally left blank LMS/RFS/S09930 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2012 October 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2012 October 2012 Doc. No. S09330

  9. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    312-2006 Monticello Mill Tailings Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 September 2006 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. No. S0245900 Page iii Contents 1.0

  10. Microsoft Word - S09187_1stQtr2012.doc

    Office of Legacy Management (LM)

    First Quarter Calendar Year 2012 July 2012 LMS/RFS/S09187 This page intentionally left blank LMS/RFS/S09187 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2012 July 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2012 July 2012 Doc. No. S09187 Page i

  11. Microsoft Word - U0200600-Semi-Annual Report Sept 03 to March 04.doc

    Office of Legacy Management (LM)

    200600 DOE-LM/GJ725-2004 Semiannual Performance Report September 2003 through March 2004 for the Shiprock, New Mexico, Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Semi-Annual Performance Report, Shiprock, New Mexico September 2004 Doc. No. U0200600 Page iii Contents 1.0

  12. Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray

    Office of Legacy Management (LM)

    Dames & Moore Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray MANAGED BY LOCKHEED MARTIN rNERGY RESEARCH CORPORATION PHONE: (423) 574-5838 FOR THE U.S. DEPARTMENT OF ENERGY FAX: (423) POST OFFICE Box 2 INTERNET: r'0 March 31, 1997 Mr. Andrew Meloy DuPont Environmental Remediation Services DuPont Chambers Works Route 130, Anti-Knocks Building G Deepwater, New Jersey 08023 Dear Mr. Meloy: Radiological Sampling Requirements for the B Ditch Remediation Project, DuPont Chamber

  13. Microsoft Word - N01359_4.5AcreLDA Final Report.doc

    Office of Legacy Management (LM)

    Environmental Restoration Project Interim Remedial Action for Source Removal at the 4.5 Acre Site Final Report September 2009 LMS/PIN/N01359 This page intentionally left blank LMS/PIN/N01359 Pinellas Environmental Restoration Project Interim Remedial Action for Source Removal at the 4.5 Acre Site Final Report September 2009 This page intentionally left blank U.S. Department of Energy Interim Remedial Action for Source Removal at the 4.5 Acre Site-Final Report September 2009 Doc. No. N01359 Page

  14. Microsoft Word - N01401_NE and 4-5 Closure Mon Plan.doc

    Office of Legacy Management (LM)

    Closure Monitoring Plan for the Northeast Site and 4.5 Acre Site August 2009 LMS/PIN/N01401 This page intentionally left blank LMS/PIN/N01401 Pinellas Environmental Restoration Project Closure Monitoring Plan for the Northeast Site and 4.5 Acre Site August 2009 This page intentionally left blank U.S. Department of Energy Closure Monitoring Plan for the Northeast Site and 4.5 Acre Site July 2009 Doc. No. N01401 Page i Contents 1.0

  15. Microsoft Word - OPC Security WP 3 _Version 1-3c_.doc

    Office of Environmental Management (EM)

    intrinsically secure po box 178 #5 - 7217 Lantzville rd lantzville, bc canada v0r 2h0 office 250.390.1333 fax 250.390.3899 www.byressecurity.com Digital Bond suite 130 1580 sawgrass corp pkwy sunrise, FL 33323 office 954.315.4633 www.digitalbond.com OPC Security Whitepaper #3 Hardening Guidelines for OPC Hosts PREPARED BY: Digital Bond British Columbia Institute of Technology Byres Research November 13, 2007 OPC Security WP 3 (Version 1-3c).doc OPC Security Whitepaper #3 Hardening Guidelines for

  16. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies: Preprint

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-04-01

    An accelerated durability test method determined the potential impact of biodiesel ash impurities, including engine testing with multiple diesel particulate filter substrate types, as well as diesel oxidation catalyst and selective catalyst reduction catalysts. The results showed no significant degradation in the thermo-mechanical properties of a DPF after exposure to 150,000-mile equivalent biodiesel ash and thermal aging. However, exposure to 435,000-mile equivalent aging resulted in a 69% decrease in thermal shock resistance. A decrease in DOC activity was seen after exposure to 150,000-mile equivalent aging, resulting in higher hydrocarbon slip and a reduction in NO2 formation. The SCR catalyst experienced a slight loss in activity after exposure to 435,000-mile equivalent aging. The SCR catalyst, placed downstream of the DPF and exposed to B20 exhaust suffered a 5% reduction in overall NOx conversion activity over the HDDT test cycle. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. The results of this study suggest that long-term operation with B20 at the current specification limits for alkali and alkaline earth metal impurities will adversely impact the performance of DOC, DPF and SCR systems.

  17. 101807.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... the log of the cell 2 value. As you can see, controlled tabular 3 adjustment fix minimal changes to the 4 non-sensitive cells overall, but the noise 5 spread is kind of ...

  18. 101907.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... of data from the Mine Safety 22 and Health Administration. ... 11 thing to have in a journal. 12 Even what you have ... First is the invitation to 15 public comments, so if any ...

  19. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-06-01

    It is estimated that operating continuously on a B20 fuel containing the current allowable ASTM specification limits for metal impurities in biodiesel could result in a doubling of ash exposure relative to lube-oil derived ash. The purpose of this study was to determine if a fuel containing metals at the ASTM limits could cause adverse impacts on the performance and durability of diesel emission control systems. An accelerated durability test method was developed to determine the potential impact of these biodiesel impurities. The test program included engine testing with multiple DPF substrate types as well as DOC and SCR catalysts. The results showed no significant degradation in the thermo-mechanical properties of cordierite, aluminum titanate, or silicon carbide DPFs after exposure to 150,000 mile equivalent biodiesel ash and thermal aging. However, exposure of a cordierite DPF to 435,000 mile equivalent aging resulted in a 69% decrease in the thermal shock resistance parameter. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. A decrease in DOC activity was seen after exposure to 150,000 mile equivalent aging, resulting in higher HC slip and a reduction in NO{sub 2} formation. The metal-zeolite SCR catalyst experienced a slight loss in activity after exposure to 435,000 mile equivalent aging. This catalyst, placed downstream of the DPF, showed a 5% reduction in overall NOx conversion activity over the HDDT test cycle.

  20. Cycling of DOC and DON by Novel Heterotrophic and Photoheterotrophic Bacteria in the Ocean: Final Report

    SciTech Connect (OSTI)

    Kirchman, David L

    2008-12-09

    The flux of dissolved organic matter (DOM) through aquatic bacterial communities is a major process in carbon cycling in the oceans and other aquatic systems. Our work addressed the general hypothesis that the phylogenetic make-up of bacterial communities and the abundances of key types of bacteria are important factors influencing the processing of DOM in aquatic ecosystems. Since most bacteria are not easily cultivated, the phylogenetic diversity of these microbes has to be assessed using culture-independent approaches. Even if the relevant bacteria were cultivated, their activity in the lab would likely differ from that under environmental conditions. This project found variation in DOM uptake by the major bacterial groups found in coastal waters. In brief, the data suggest substantial differences among groups in the use of high and molecular weight DOM components. It also made key discoveries about the role of light in affecting this uptake especially by cyanobacteria. In the North Atlantic Ocean, for example, over half of the light-stimulated uptake was by the coccoid cyanobacterium, Prochlorococcus, with the remaining uptake due to Synechococcus and other photoheterotrophic bacteria. The project also examined in detail the degradation of one organic matter component, chitin, which is often said to be the second most abundant compound in the biosphere. The findings of this project contribute to our understanding of DOM fluxes and microbial dynamics supported by those fluxes. It is possible that these findings will lead to improvements in models of the carbon cycle that have compartments for dissolved organic carbon (DOC), the largest pool of organic carbon in the oceans.

  1. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    Energy Oflice of Legacy Management Sites. The water level was measured at each sampled well. Monitor wells with an "SC" suffix are completed in the Upper Sand aquifer of the Wind ...

  2. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    613 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - December 2007 Groundwater Sampling at the Monument Valley, Arizona, Processing Site March 2008 This page intentionally left blank U.S. Department of Energy DVP-December 2007, Monument Valley, Arizona, Processing Site March

  3. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    SHP/S04483 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - March 2008 Groundwater and Surface Water Sampling at the Shiprock, New Mexico, Disposal Site July 2008 This page intentionally left blank U.S. Department of Energy DVP-March 2008, Shiprock, New Mexico, Disposal Site July

  4. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    Shirley Basin South, Wyoming Disposal Site January 2009 LMS/SBS/S00808 This page intentionally left blank This page intentionally left blank U.S. Department of Energy DVP-August 2008, Shirley Basin South, Wyoming, Disposal Site January 2009 RIN 08071744 Page i Contents Sampling Event Summary ...............................................................................................................1 Shirley Basin South, Wyoming, Disposal Site Sample Location Map

  5. Microsoft Word - 08101898_DocProd.doc

    Office of Legacy Management (LM)

    and Surface Water Sampling at the Riverton, Wyoming, Processing Site February 2009 LMS/RVT/S01108 This page intentionally left blank U.S. Department of Energy DVP-November 2008, Riverton, Wyoming, Processing Site February 2009 RIN 08101898 Page i Contents Sampling Event Summary ...............................................................................................................1 Riverton, Wyoming, Processing Site, Sample Locations

  6. "V Doc with logo.doc"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and improvement activities, customer service, and internal grievance resolution. Health care operations also include vendor evaluations, credentialing, training,...

  7. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    SAL/S04639 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - April 2008 Groundwater and Surface Water Sampling at the Salmon, Mississippi, Site August 2008 U.S. Department of Energy DVP-April 2008, Salmon, Mississippi, Site August 2008 RIN 08031475 Page iii Contents Sampling Event

  8. 2009 Federal Register, 74 FR 50239; Centralized Library: U.S. Fish and Wildlife Service - FR Doc E9-23556

    National Nuclear Security Administration (NNSA)

    0239 Federal Register / Vol. 74, No. 188 / Wednesday, September 30, 2009 / Notices Dated: July 13, 2009. Cynthia K. Dohner, Acting Regional Director. [FR Doc. E9-23559 Filed 9-29-09; 8:45 am] BILLING CODE 4310-55-P DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-ES-2009-N141; 80221-1112- 0000-F2] Amendment of the Clark County Multiple Species Habitat Conservation Plan and Issuance of an Amended Incidental Take Permit, Clark County, NV AGENCY: Fish and Wildlife Service, Interior.

  9. TsaiFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3538 Unlimited Release Printed December 2002 Material Characterization of Glass, Carbon, and Hybrid-Fiber SCRIMP Panels Akira Kuraishi, Stephen W. Tsai, and Julie Wang Stanford University Department of Aeronautics and Astronautics Stanford, California Abstract The purpose of this study was to generate the material database for carbon and glass composite panels created by the SCRIMP process. The materials tested were glass/polyester composites, two types of carbon/polyester composites, and carbon

  10. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  11. Tentative Agreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Keith A. Klein, Manager Linda Hoffman, Acting Director U. S. Department of Energy, Richland State of Washington, Department...

  12. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 2006, and who, within 120 days of termination from UC, elected to receive a monthly pension from the University of California Retirement Plan ("UCRP"); or Category C. A former...

  13. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 21, 2014 IMPORTANT This Summary Plan Description (SPD) is intended to provide a summary of the principal features of the LANS Welfare Benefit Plan for Retirees ("Plan"). Additional information about component Benefit Programs is found in the Benefit Program Materials referenced in Appendix C. The documents referred to in Appendix C are hereby incorporated by reference into the SPD and the Plan. This SPD will continue to be updated. Please check back on a regular basis for the most

  14. sr0801.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office, P.O. Box A, Aiken, S.C. 29802 NEWS MEDIA CONTACTS: For Immediate Release June 19, 2008 Julie Petersen (803) 952-7690 julie.petersen@srs.gov Jim Giusti (803) 952-7684 james-r.giusti@srs.gov DOE Marks Key Cleanup and Closure Milestones at its Savannah River Site AIKEN, S.C. - U.S. Department of Energy (DOE) Assistant Secretary for Environmental Management (EM) James A. Rispoli today marked the start of normal operations of interim salt waste processing facilities - the Actinide Removal

  15. 022996A.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    996 Unlimited Release Printed October 2002 Adaptive Blade Concept Assessment: Curved Planform Induced Twist Investigation Mike Zuteck MDZ Consulting 601 Clear Lake Road Clear Lake Shores, TX Abstract Improving wind turbine blades via bend-twist coupling confronts two difficult challenges. The first is that off-axis fiber for the major structure is difficult to fabricate. Suitable fabrics with the primary fiber ~20 degrees off-axis are not commonplace and may present dimensional stability

  16. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RICHLAND, WASHINGTON U.S. DEPARTMENT OF ENERGY MAY 1995 This page intentionally left blank. ... Additional details regarding the overall transition activities, including costs, is ...

  17. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Core Status: new users must complete 2 trouble-free training sessions and pass a sample exchange exam to work independently during Core sessions. Flex Status: core users must complete 4 "trouble-free" sessions and pass a driving test to work independently during Flex sessions To reserve a 3010 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time.

  18. Nov08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-11 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Site Operations Centralized Through New Tracking System With more than 300 instrument systems operating at remote sites around the

  19. Oct08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    at the site. John Schatz conveys the tale of the new site mascot, Wild Bill the kitty cat: Wild Bill came to the site about a year ago and was dubbed "Wild Bill," not because he...

  20. sr0934.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and about 25 people during permanent operations," said Secretary Chu in addressing an audience of over 150 stakeholders and employees during the groundbreaking ceremony at SRS....

  1. Index2.doc

    Office of Environmental Management (EM)

    --- 41664 1. Serious Accidents Issue No. 107, Atomic Energy Commission, dated August 20, 1956. 6 pages. (F2004-00101) 41665 17. Electronic FOIA...

  2. DOC182.PDF

    Energy Savers [EERE]

    line item. This fee is similar to those paid by commercial firms to belong to trade and industry associations related to their government contracts, and is considered an...

  3. 1B-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1B-03, in: A.R. Gavaskar and A.S.C. Chen (Eds.), Remediation of Chlorinated and Recalcitrant Compounds -2004. Proceedings of the Fourth International Conference on Remediation of Chlorinated and Recalcitrant Compounds (Monterey, CA; May 2004). ISBN 1-57477-145-0, published by Battelle Press, Columbus, OH, www.battelle.org/bookstore. NONAQUEOUS-PHASE LIQUID CHARACTERIZATION AND POST-REMEDIATION VERIFICATION SAMPLING ABSTRACT: Light and dense nonaqueous-phase liquids (NAPLs) were identified in the

  4. 2B-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1, in: A.R. Gavaskar and A.S.C. Chen (Eds.), Remediation of Chlorinated and Recalcitrant Compounds -2004. Proceedings of the Fourth International Conference on Remediation of Chlorinated and Recalcitrant Compounds (Monterey, CA; May 2004). ISBN 1-57477-145-0, published by Battelle Press, Columbus, OH, www.battelle.org/bookstore. SUCCESSFUL FIELD-SCALE IN SITU THERMAL NAPL REMEDIATION AT THE YOUNG-RAINEY STAR CENTER ABSTRACT: The U.S. Department of Energy (DOE) successfully completed a field-

  5. Report2003.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2003 Annual Report I. Basic Information Regarding Report. A. Abel Lopez, Director FOIA/Privacy Act Group, ME-73 Office of the Executive Secretariat U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 202-586-5955 Sandi Beatty, Information Specialist FOIA/Privacy Act Group, ME-73 Office of the Executive Secretariat U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 202-586-5955 B. The World Wide Web address to obtain an electronic copy of the

  6. Habadv-115.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    115 Subject: Proposed River Corridor and Performance Measures Adopted: April 6, 2001 Page 1 April 6, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 999352 Subject: Proposed River Corridor Contract and Performance Measures Dear Mr. Klein, Clean- up of the River Corridor is important. The proposed River Corridor contract should authorize and direct the contractor to perform the full scope of work of the Hanford Clean-Up Agreement more

  7. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  8. Habadv-120.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  9. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Short-Term Energy Outlook April 2002 Overview World Oil Markets: Average crude oil prices moved up strongly in March, rising nearly $4 from the average February level to $24.50 per barrel for West Texas Intermediate (WTI). A stronger sentiment on the side of OPEC production discipline, a growing sense by the market that economic growth may accelerate more rapidly than previously thought, and continued uncertainty surrounding tensions in the Middle East have elevated near-term prices above

  10. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 1 Short-Term Energy Outlook August 2002 Overview World Oil Markets: Oil prices remained relatively high in July, averaging close to the expectations reported in the July Outlook. The average spot West Texas Intermediate (WTI) price in July was approximately $27 per barrel. As always, a wide range of possibilities exists for oil price movements over the next year and a half. However, given the amount of growth in world demand expected through 2003, we think that likely scenarios for OPEC and

  11. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (Energy Information Administration/Short-Term Energy Outlook -- February 2002) 1 Short-Term Energy Outlook February 2002 Overview World Oil Markets. OPEC's stated intention to reduce crude oil output beginning in January has been mostly successful. OPEC-10 crude oil output (OPEC less Iraq) fell by an estimated 1.1 million barrels per day in January, or about 70 percent of the officially announced quota reductions. Compliance rates at these levels tend to validate our expectations for steadily

  12. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 2002 1 Short-Term Energy Outlook July 2002 Overview World Oil Markets: World oil price markers fell in June, with both Brent crude oil and the OPEC basket prices averaging $1.00 - $1.50 per barrel below May averages. Nevertheless, June marked the fourth consecutive month that the OPEC basket price averaged above $22 per barrel, the lower end of OPEC's target range. The basket price has been above $22 per barrel since March 8 and is projected to remain within the target range ($22-28 per

  13. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 2003 1 Short-Term Energy Outlook July 2003 Overview World Oil Markets. The average West Texas Intermediate (WTI) crude oil price for June was up by about $2.50 per barrel from the May average, in part because OECD oil inventories remain low by historical standards. Oil prices are not likely to fall significantly until commercial inventories rise to levels observed in recent years. EIA's Outlook is for prices to remain firm throughout the rest of 2003 (in the $29- $30 per barrel range for

  14. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 2003 1 Short-Term Energy Outlook June 2003 Overview World Oil Markets. Average crude oil prices rose in May as continued reports of low oil inventories trumped expectations that Iraqi oil production would quickly return to pre-war levels. Those hopes faded on the news that post-war looting would postpone for some months the return of the Iraqi oil sector to normal operations. In addition, a terrorist attack in Saudi Arabia and estimates of lower production in Saudi Arabia by some analysts

  15. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 2002 1 Short-Term Energy Outlook March 2002 Overview World Oil Markets. Average crude oil prices strengthened by $1 per barrel in February on evidence that the United States and other industrialized countries trimmed slightly the year-over-year surplus in commercial inventories and on concerns that the U.S. may be turning its attention toward Iraq in its ongoing battle against world terrorism. The West Texas Intermediate price in February was $20.72 per barrel, compared to $19.71 per

  16. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 2002 1 Short-Term Energy Outlook May 2002 Overview World Oil Markets: World oil prices continued to rise in April, with OPEC Basket and Brent prices rising by $2 per barrel on average from March levels. April marked the second consecutive month that the OPEC basket price finished above $22 per barrel, the lower end of the target range for the OPEC basket price. The U.S. benchmark West Texas Intermediate (WTI) crude oil price averaged over $26 per barrel in April, and closed over $27 per

  17. Highlights.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 2002 1 Short-Term Energy Outlook September 2002 Overview World Oil Markets: The waxing and waning intensities of concern surrounding potential military action against Iraq and uncertainty over OPEC production policy leading up to their September 19 meeting have contributed to WTI spot crude oil prices bouncing between $26 and $30 per barrel since early August. The average spot WTI price in August was $28.40 per barrel. Developments suggesting an easing of tensions could temporarily

  18. HABAdv#167.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: Stop Work Authority Adopted: November 5, 2004 Page 1 November 5, 2004 Paul Golan, Assistant Secretary of Energy U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 John Shaw, Acting Assistant Secretary Division of Environmental Safety and Health U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy

  19. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  20. HABadv-118.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 Subject: HAMMER Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy P.O. Box 550 (A7-50) Richland, WA 99352 Re: Hazardous Materials Management and Emergency Response Training and Education Center (HAMMER) Dear Mr. Klein Worker, public, and environmental health and safety are a fundamental concern at the Hanford Site. Protection requires prevention of accidents and disease, and prevention requires a work force that is well- trained and drilled in safe work

  1. HABadv-121.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: Principles for New and Existing Hanford Cleanup Contracts Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Principles for New and Existing Hanford Cleanup Contracts The Hanford Advisory Board (HAB) has provided many pieces of advice in the past regarding contracts. The following not only

  2. Sep08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    measurements, three scanning, compact microwave radiometers were deployed, each 10 kilometers (6.2 miles) apart, to form a triangle. One of the radiometers was based at the SGP...

  3. craig_IAEA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the MST Reversed Field Pinch D. Craig 1), A.F. ... WI USA and the Center for Magnetic Self- Organization in ... In this model, the rotating mode induces eddy ...

  4. Microsoft Word - 20.doc

    Office of Scientific and Technical Information (OSTI)

    EFFECT OF SILICON AND ALUMINUM ADDITIONS ON THE OXIDATION RESISTANCE OF LEAN CHROMIUM STAINLESS STEELS J. S. Dunning, D. E. Alman, and J. C. Rawers United States Department of Energy Albany Research Center 1450 Queen Avenue, SW Albany, OR 97321 ABSTRACT The effect of Si and Al additions on the oxidation of lean chromium austenitic stainless steels has been studied. A baseline composition of Fe-16Cr-16Ni-2Mn-1Mo was selected to allow combined Si and Al additions of up to 5 wt. pct. in a fully

  5. Microsoft Word - ~2432658.doc

    Office of Scientific and Technical Information (OSTI)

    FG36-08GO18149 Revision: - Date: 06/15/10 ABENGOA SOLAR Advanced Thermal Storage for Central Receivers with Supercritical Coolants Section: Page: 1/184 ABENGOA SOLAR INC 11500 West 13 th Avenue Lakewood, CO, 80215 TEL: 303-928-8500 FAX: 303-928-8510 Advanced Thermal Storage for Central Receivers with Supercritical Coolants Grant DE-FG36-08GO18149 Signatures: Name Signature Date Prepared by Bruce Kelly 6/15/10 Checked by Approved by Signatures Rev. Description Prepared Approved Date - Initial

  6. sr0905.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    julie.petersen@srs.gov DOE Sets Energy Savings Contract in Motion for New Renewable Energy Fueled Plant at SRS New Steam Production Biomass Plant and Boilers to Yield Public...

  7. SubcontractingGuidelines.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Table of Contents ABBREVIATIONS AND ACRONYMS.................................................................3 1. INTRODUCTION................................................................................................................. 4 1.1. PURPOSE .......................................................................................................................................................................4 1.2.

  8. Microsoft Word - 033302.doc

    Office of Scientific and Technical Information (OSTI)

    processes coupled with special enzymes. This combination could be used to design a solar panel to capture solar energy for use in carbon fixing reactions aimed at the...

  9. titlepg.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 (Released October 8, 1997) Energy Information Administration DOE/EIA-0202(97/4Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections Fourth Quarter 1997 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be

  10. weatherwksht.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Name_______________________________ Date____________________ 1. Copy these two paragraphs, and complete the missing words. Weather refers to changes in atmospheric ________________________ over a very ________________________ time period, such as a minute, an hour, or a ________________________. Atmospheric conditions include ________________________, ________________________, ________________________, ________________________, ________________________, and ________________________. Climate

  11. win0203.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Winter Fuels Outlook: 2002-2003 Introduction This report provides a summary of the winter outlook for demand, supply and prices for several key domestic heating fuels, including natural gas, heating oil and propane. The results discussed here are based on the forecast results obtained for the October 2002 Short-Term Energy Outlook plus special scenarios generated for this article. For the purposes of the analysis, winter is defined as the period from October through March. Highlights * Higher

  12. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  13. Fonsi.Leo.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AGENCY: U.S. Department of Energy ACTION: Finding of No Significant Impact SUMMARY: The U.S. Department of Energy (DOE) has prepared an Environmental Assessment (EA), DOE/EA-1319, to assess environmental impacts associated with the disposition of surplus Hanford Site uranium. DOE has identified 1,866 metric tons of uranium (MTU) on the Hanford Site as surplus. As of late calendar year 1999, the predominant amount of approximately 1,700 MTU [1,866 MTU minus 140 MTU (135 MTU of contaminated fuel

  14. Feb09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-02 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Radiometers Used to Close Gap in Climate Models In late January, scientists initiated a five-month field campaign involving routine

  15. Activation.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joint Information Center Activated at the Waste Isolation Pilot Plant CARLSBAD, N.M., 2/15/2014 3:09 PM1:30 PM (MST) - The Joint Information Center (JIC) has been activated at the Waste Isolation Pilot Plant (WIPP) 26 miles east of Carlsbad, New Mexico. The activation occurred as a precautionary measure. More information will be provided as it becomes available. The Joint Information Center (JIC), located at 4021 National Parks Highway, has been activated to provide public information. For

  16. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    97 (9/12) Page 1 of 4 Form 1897 Onsite Non-US Government-Owned Controlled Article Authorization Form When properly executed, this form authorizes the described controlled article (see P217 Controlled Articles) to reside at, or be removed from, LANL during the specified period of time. No other controlled article may be substituted under this authorization. The original, signed form must be kept with the controlled article at all times, and a copy sent to the Information Security Office by fax at

  17. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  18. 2010SR05.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Big Top Tent Keeps TRU Waste Trucks, Tanks Dry before Inspection and Shipping Big Top Aids Solid Waste Management in Shipping Protocol Aiken, S.C. - Important projects for the Recovery Act - and not a circus act - are being performed under the Big Top at Solid Waste Management facility at the Department of Energy's (DOE) Savannah River Site (SRS). The jumbo-size vinyl tent with a metal frame measuring 160 feet long, 24 feet wide, and 20 feet high is used in the Site's E Area to shelter trucks

  19. 2010sr07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 23, 2010 james-r.giusti@srs.gov Kyle Bryant, EPA-4, (404) 562-9073 bryant.kyle@epa.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov SRS Moves Forward With Final Closure of Cold War Reactors AIKEN, S.C. - With the beginning of a new decade, the U.S. Department of Energy's (DOE) Savannah River Site (SRS) is moving forward with its decommissioning activities for the SRS Cold War Production Reactors. The Department approved the construction start of the in-situ decommissioning

  20. 2010sr13.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 13, 2010 james-r.giusti@srs.gov DOE Announces Intention to Offer State of Georgia Additional Enviromental Monitoring Funds AIKEN, SC - The Department of Energy (DOE) today announced its intention to fund additional independent environmental monitoring of the Savannah River Site (SRS) by the State of Georgia. Through its grant program, DOE's Savannah River Operations Office will provide the Georgia Department of Natural Resources financial assistance to conduct independent environmental

  1. 2010sr14.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Regional Businesses Benefit as Recovery Act Funding Flows into the Economy at SRS More than $11 million in local and small business contracts awarded Aiken, SC -- Local and small businesses in the Central Savannah River Area (CSRA) have benefited from more than $11 million worth of new business since last October, as part of the Department of Energy's (DOE) American Recovery and Reinvestment Act projects at the Savannah River Site (SRS).

  2. 2010sr15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    With ARRA Funds, P-Reactor Disassembly Basin Project Moves One Step Closer to Final Decommissioning Aiken, S.C. - Funding through the American Recovery and Reinvestment Act has moved the Department of Energy one step closer to closing the book on the Cold War-era P- Reactor facility at the Savannah River Site (SRS). With the installation, testing and startup of six evaporator units, SRS can begin removing about 4.6 million gallons of water from the 105-P Reactor Disassembly Basin - a phase of in

  3. 2010sr16.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Recovery Act Funds Put Aiken Technical College Rad Con Graduates to Work Early Aiken, S.C. - Using $200,000 in American Recovery and Reinvestment Act funds from the U.S. Department of Energy's Savannah River Site (SRS), the Aiken Technical College's (ATC) Radiation Protection Technology Program will be able to catapult 16 graduates into the local work force nearly six months ahead of schedule. "The program's first graduates are a success story that has come to life in a short period of

  4. 2010sr17.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thursday, May 13, 2010 james-r.giusti@srs.gov DOE to Host Public Education Forum on Use of Performance Assessments Aiken, SC -- The U.S. Department of Energy (DOE) will host a public education forum on the development and use of Performance Assessments (PAs) for making waste management decisions at DOE sites across the complex. The educational forum, planned in coordination with the Savannah River Site (SRS) Citizen's Advisory Board Waste Management Committee, will facilitate public involvement

  5. 2010sr18.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, May 25, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov SRS Demolishes Massive Cooling Tower, Continues Progress on Environmental Footprint Reduction (Aiken, S.C.) - The Savannah River Site's (SRS) massive K Cooling Tower was safely demolished today as part of the Site-wide Footprint Reduction Initiative funded by the American Recovery and Reinvestment Act (ARRA). As the second-largest cooling tower to be demolished worldwide, the 450 foot-tall and

  6. 2010sr19.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday, June 2, 2010 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Blowing Bubbles Using Recovery Act Funds, SRS Looks to Apply Novel Solutions to Unique Challenges Aiken, SC - Blowing bubbles is not usually associated with processing liquid radioactive waste. Nevertheless, new bubbler technology and other enhancements are soon expected to double the amount of radioactive waste processed annually at the Department of Energy's (DOE) Savannah River Site (SRS).

  7. 2010sr20.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Monday, June 21, 2009 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov New Robot Supports SRS Waste Tank Closures Aiken, SC (June 21) - Movie-goers may have Iron Man 2, but thanks to the American Recovery and Reinvestment Act, the Department of Energy's (DOE) Savannah River Site (SRS) has its own super hero - "Tizzy," a tank-cleaning robot. Tizzy will remove high- level solid radioactive material from the floor of SRS waste tanks and transfer the material

  8. 2010sr21.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday July 7, 2010 james-r.giusti@srs.gov DOE and NRC to Hold Public Meeting on SRS F Tank Farm Waste Determination Draft Basis Document Aiken, SC - The U.S. Department of Energy (DOE) will hold a public meeting with the Nuclear Regulatory Commission (NRC) on the development of the Section 3116 Draft Basis Document for F Tank Farm at the Savannah River Site on July 13 and 14, 2010. The meeting is to help DOE in the identification of issues with the reasonability of the approach to

  9. 2010sr24.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    25, 2010 james-r.giusti@srs.gov DOE Presents "Star of Excellence" Award to Savannah River Site Contractor AIKEN, S.C. - U.S. Department of Energy (DOE) recently awarded its Voluntary Protection Program "Star of Excellence" to Savannah River Nuclear Solutions for 2010. "Time and again Savannah River Nuclear Solutions has proven how highly they value employee safety," said Inés Triay, Ph.D., DOE Assistant Secretary for Environmental Management. "We recognize

  10. 2010sr25.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, August 31, 2010 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Tank 37 Salt Removal Marks Second Liquid Waste Project Completed Recovery Act Project at SRS Aiken, SC -- Moving radioactive salt safely, closing liquid waste tanks and saving money are the drivers behind the successful completion of another American Recovery and Reinvestment Act project at the Department of Energy's Savannah River Site (SRS). Acknowledging the Tank 37 achievement, Terrel

  11. 2010sr26.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thursday, September 2, 2010 james-r.giusti@srs.gov SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  12. 2011_sr_03.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday, February 23, 2011 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 646-6075 paivi.nettamo@srs.gov Recovery Act's HWCTR Project Empty of Equipment, Ready for Grouting AIKEN, S.C. - Thanks to investments from the American Recovery and Reinvestment Act, the next phase has begun on decommissioning the Heavy Water Components Test Reactor (HWCTR) at the Savannah River Site (SRS). With the reactor building now empty of its two steam generators and the reactor vessel, work can start on

  13. 2011sr01.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, February 1, 2011 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 646-6075 paivi.nettamo@srs.gov Recovery Act Funds Test Reactor Dome Removal in Historic D&D Project AIKEN, S.C. - The landscape of the Savannah River Site (SRS) is a little flatter and a little less colorful with the removal today of the 75-foot-tall rusty-orange dome from the Cold War-era test reactor. This $25-million reactor decommissioning and deactivation project is funded By the American Recovery and

  14. Aug08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Instrumentation to obtain water-specific measurements, such as temperature, salinity, current speed and ocean surface state (e.g., calm or rough) will also be included to help ...

  15. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  16. sr0930.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CONTACTS FOR IMMEDIATE RELEASE Julie Petersen, (803) 952-7690 Monday, October 26, 2009 julie.petersen@srs.gov Kelly Ling, (803) 952-9172 kelly.ling@srs.gov DOE to Honor Nuclear...

  17. guide.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (2006) 1. Deadline: send you review article before February the 14 th , 2006 to the editorial committee of your section. 2. Length: papers should not exceed 14 pages using the...

  18. 2010sr32.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and twenty cubic yards of the cement slurry, the approximate volume of large at-home swimming pool, was poured into the reactor vessel over two days. The next step in the reactor...

  19. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  20. Annual Report 2008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Advisory Council for Historic Preservation (ACHP), the SRS Citizens Advisory Board (CAB), SRS Heritage Foundation, the City of Aiken, the City of Augusta, and the City of New...

  1. 032102ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... MS. HUTZLER: My future plan is to resume my old job, which was Director of the Office of ... And we talked about the issues in the redesign. I think the recommendation was that we ...

  2. Microsoft Word - 58285.doc

    Office of Scientific and Technical Information (OSTI)

    ... The best programs are probably the information programs that provide data on ... This amounts to 40 TWhyear savings, worth over 4B per year by 2015 in cooling-electricity savings ...

  3. 032202ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... to the IEA, spend a month there, go back to China, mainly on definitional and methodology. ... We are fortunate enough to have this relationship with the China Energy Research Institute ...

  4. HABadv-117.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    released and publicly reviewed, and a Record of Decision issued. DOE must honor the legal process, and to continually propose interim actions while release of the HSW-EIS is...

  5. May08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 2008 ANL/EVS/NL-08-05 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Cloud Radars at the Southern Great Plains Site The flip of a switch in February solved a dilemma in detection of cirrus clouds

  6. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  7. Microsoft Word - 64490001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449, pp. 1-25, 2011. © Springer-Verlag Berlin Heidelberg 2011 Exascale Computing Technology Challenges John Shalf 1 , Sudip Dosanjh 2 , and John Morrison 3 1 NERSC Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, California 94611 2 Sandia National Laboratories, New Mexico 87185 3 Los Alamos National Laboratory, Los Alamos, New Mexico 87544 jshalf@lbl.gov, sudip@sandia.gov, jfm@lanl.gov Abstract. High Performance

  8. U0004500.DOC

    Office of Legacy Management (LM)

    155 Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site, Spook, Wyoming February 1997 DOE/EA-1155 Uranium Mill Tailing Remedial Action Project Environmental Assessment of Ground-Water Compliance Activities At the Uranium Mill Tailings Site Spook, Wyoming February 1997 Prepared by U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site

  9. U0083900.doc

    Office of Legacy Management (LM)

    GJO-2002-304-TAR MAC-GWTUB 11.11.2 Plan for Injection of Treated Ground Water at the Tuba City, Arizona, UMTRA Project Site March 2002 Prepared by U. S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0023-17-000 Document Number U0083900 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 Document Number U0083900 DOE/Grand Junction Office Plan for Injection of Treated Ground Water at the Tuba City UMTRA Site March 2002 Page 1 Introduction This plan

  10. shprkEA.doc

    Office of Legacy Management (LM)

    EA-1388 Environmental Assessment of Ground Water Compliance at the Shiprock Uranium Mill Tailings Site Final September 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-96GJ87335 This Page Intentionally Blank DOE Grand Junction Office EA of Ground Water Compliance at the Shiprock Site September 2001 Final Page iii Contents Page Acronyms and Abbreviations

  11. Microsoft Word - 10063154.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites October 2010 LMS/RFL/S00610 This page intentionally left blank U.S. Department of Energy DVP-June 2010, Rifle, Colorado October 2010 RIN 10063154 Page i Contents Sampling Event Summary ...............................................................................................................1 Rifle Old Sample Location Map ......................................................................................................5 Rifle Nerw Sample

  12. U0174100.doc

    Office of Legacy Management (LM)

    4100 DOE/EA-1452 Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA Project Site Final November 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junctio n, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November 2002 Final Page iii Contents Page Acronyms and Abbreviations

  13. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  14. 2010sr23.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Drainage at the Largest Closed Seepage Basins on SRS Aiken, S.C. - Preventing the migration of contamination from rainwater runoff at a closed seepage basin at the Department...

  15. DOC00004.pdf

    National Nuclear Security Administration (NNSA)

  16. DOC00005.pdf

    National Nuclear Security Administration (NNSA)

  17. DOC00009.pdf

    National Nuclear Security Administration (NNSA)

  18. DOC00010.pdf

    National Nuclear Security Administration (NNSA)

  19. DOC00011.pdf

    National Nuclear Security Administration (NNSA)

  20. DOC00016.pdf

    National Nuclear Security Administration (NNSA)

  1. DOC00018.pdf

    National Nuclear Security Administration (NNSA)

  2. DOC00019.pdf

    National Nuclear Security Administration (NNSA)

  3. DOC00022.pdf

    National Nuclear Security Administration (NNSA)

  4. DOC00023.pdf

    National Nuclear Security Administration (NNSA)

  5. DOC00024.pdf

    National Nuclear Security Administration (NNSA)

  6. DOC00026.pdf

    National Nuclear Security Administration (NNSA)

  7. DOC00027.pdf

    National Nuclear Security Administration (NNSA)

  8. DOC00029.pdf

    National Nuclear Security Administration (NNSA)

  9. DOC00030.pdf

    National Nuclear Security Administration (NNSA)

  10. Chakrapani-V.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    are routinely derived from satellite data; however, obtaining cloud base is not as straightforward. Minnis et al. (1990) and Smith et al. (1992) developed methods for inferring the...

  11. 102501ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... I mean, if the marginal cost to you is minimal, fine. But otherwise, to the energy ... the cost is almost minimal for you, I don't think -- I don't see that buying you anything. ...

  12. FIBDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FIB CORE STATUS: new users must complete 2 trouble-free training sessions and pass the Core driver's test to work independently during Core sessions. FLEX STATUS: core users must...

  13. LibraDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Libra Core Status: New users must complete 2 trouble-free sessions and pass the drivers test to work independently during Core sessions. Flex Status: Core users must complete 5...

  14. TecnaiDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tecnai Core Status: new users must complete 2 trouble-free training sessions , execute a sample exchange and pass the drivers test to work independently during Core sessions. Flex...

  15. TentativeAgreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  16. Microsoft Word - ??????.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SAFETY TRIP REPORT ON US-JAPAN EXCHANGE PROGRAM (FuY 2007) Report on the 12 th Meeting of the Joint Working Group of the U.S.-Japan Coordinating Committee of Fusion Energy on...

  17. Environmental Records.doc

    Office of Environmental Management (EM)

    LIST OF TERMS ALARA as low as reasonably achievable CAA Clean Air Act CEQ Council on Environmental Quality CERCLA Comprehensive Environmental Response, Compensation, and Liability Act CFR Code of Federal Regulations CX categorical exclusion DOE U.S. Department of Energy EA environmental assessment ECL environmental checklist EIS environmental impact statement EPA U.S. Environmental Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of 1986 FFA&CO Federal Facility

  18. LLNLKEYSFINAL.doc

    Office of Environmental Management (EM)

    Inspections Inspection Report Reporting of Security Incidents at the Lawrence Livermore National Laboratory DOE/IG-0625 November 2003 * Did not take timely compensatory measures to mitigate the potential vulnerabilities resulting from the missing master keys and master Tesa card. During our review we learned that during a May 2003 inventory, Livermore officials identified an additional three master keys and two master Tesa cards that were missing. Although two of the three master keys had been

  19. 2B-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Final Report UCRL-ID-116964, Vol. 1-4. Lawrence Livermore National Laboratory, Livermore, California. Udell, K.S., N. Sitar, J.R. Hunt, and L.D. Stewart. 1991. Process for In Situ ...

  20. 1146627_7.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PacifiCorp; NextEra Energy Resources, LLC; Invenergy Wind North America LLC; and Horizon Wind Energy LLC Complainants, v. Bonneville Power Administration Respondent. ) ) ) ) ) ) )...