National Library of Energy BETA

Sample records for lajos grof-tisza doc

  1. Lajos Grof-Tisza

    Broader source: Energy.gov [DOE]

    Mr. Lajos Grof-Tisza joined the Department of Energy in 2003 and currently serves as the Director of Corporate Information Systems. As the Director of Corporate Information Systems, Mr. Grof-Tisza...

  2. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  3. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  4. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  5. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  6. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  7. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  8. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  9. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  10. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  11. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  12. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  13. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  14. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  15. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  16. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  17. iManage Presentation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    iManage Presentation iManage Presentation Tuesday_Dallas_Ballroom_D_1425_Grof-Tisza.pdf (1.04 MB) More Documents & Publications Before the House Oversight and Government Reform Subcommittee on Technology, Information Policy, Intergovernmental Relations, and Procurement Reform FY 2009 E-Government Act Report Acquisition Planning: Revised DOE Acquisition Guide Chapter 7.1

  18. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  19. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  20. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  1. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  2. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  3. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  4. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  5. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  6. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  7. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  8. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  9. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  10. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  11. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  12. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  13. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  14. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  15. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  16. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  17. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  18. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  19. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  1. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  2. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  3. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  4. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  5. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  6. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  7. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  8. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  9. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers [EERE]

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  10. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers [EERE]

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  11. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  12. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  13. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  14. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  15. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  16. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  17. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  18. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  19. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  20. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  1. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  2. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  3. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  4. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  6. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  7. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  8. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  9. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  10. PIC DOC 01/08/11 ? SOS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  11. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  12. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  13. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  14. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  15. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  16. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers [EERE]

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  17. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  18. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11

  19. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  20. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  1. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  2. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  3. Microsoft Word - 99-04.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  4. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  5. Microsoft Word - AL2004-02.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  6. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers [EERE]

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  7. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  8. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  9. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  10. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  11. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  12. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  13. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  14. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  15. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  16. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  17. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  18. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  19. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  20. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  1. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  2. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  3. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  4. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  5. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  6. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  7. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  8. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  9. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  10. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  11. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  12. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  13. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  14. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  15. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  16. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  17. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  18. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  19. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  20. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  1. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  2. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  3. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  4. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  5. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  6. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  7. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  8. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  9. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  10. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  11. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  12. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  13. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  14. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  15. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  16. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  17. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  18. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  19. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  20. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  1. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  2. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  3. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  4. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  5. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  6. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  7. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  8. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  9. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL

  10. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  11. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  12. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  13. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  14. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  15. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  16. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  17. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  18. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  19. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  20. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  1. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  2. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  3. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  4. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  5. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  6. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  7. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  8. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  9. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  10. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  11. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  12. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  13. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  14. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  15. Microsoft Word - 6-19-06 TEC NOTES.doc

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 (100.66

  16. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  17. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  18. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  19. Microsoft Word - Report Cover.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 sdauber@redseal.net www.redseal.net RedSeal

  20. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  1. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  2. Microsoft Word - al2006-12.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  4. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  5. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  6. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  7. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  8. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  9. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  10. Microsoft Word - 8E2A4440.doc

    Broader source: Energy.gov (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

    Grant Amount Non-Fed Amount Project Location (City) Project Location (State) Description 1) Pilot and Demonstration Scale FOA - Pilot Scale Algenol Biofuels Inc. $25,000,000 $33,915,478 Freeport TX This project will make ethanol directly from carbon dioxide and seawater using algae. The

  11. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  12. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    ... - - - -- - -- -- ,Additional Quarterly Sun*cillancc RcquircHcnts Note: All ... Sites FFA Quarterly Report: July 1-September 30, 2009 U.S. Department of Energy Doc. No. ...

  13. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  14. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  15. Microsoft Word - S04268_Mar07 thru Mar08.doc

    Office of Legacy Management (LM)

    ... molybdenum, nitrate, selenium, sulfate, and uranium (DOE 1999). Restoration standards (see Table 1) for these Tuba City Annual Performance Evaluation U.S. Department of Energy Doc. ...

  16. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  17. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  18. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  19. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  20. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  1. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  2. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  3. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  4. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  5. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  6. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  7. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  8. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  9. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  10. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  11. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; (8.6 MB) More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  12. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  13. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  14. Microsoft Word - FY11 DNWD Budget CJ_Draft_20100124.doc

    Energy Savers [EERE]

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc (59.07 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCFed

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc (59.02 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor

    7

  15. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  16. Microsoft Word - Annual Report 2006_Final.doc

    Broader source: Energy.gov (indexed) [DOE]

    AcqGuide37pt1 binney Nov 2010 (201 KB) More Documents & Publications Chapter 37 - Service Contracting AcqGuide37pt1.doc&#0; Special Review: OAS-M-15-05

    AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

    0, Small Business Programs - An Overview Guiding Principles It is the policy of the Department of Energy to provide maximum

  17. Microsoft Word - 2007 NESHAP Final with Signature page.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof. Available for sale to the

  18. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  19. Microsoft Word - ex1b-ITER-mar07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ...

  20. Microsoft Word - AL2005-13.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  1. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  2. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    ... U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page ... if ingested at frequencies and amounts similar to those of residential use (DOE 1997). ...

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. ...

  4. Microsoft Word - N01058_LTSM Plan.doc

    Office of Legacy Management (LM)

    ... for the Pinellas Site U.S. Department of Energy Doc. No. ... replaced by an aboveground system that currently is in use (DOE 1997b). The Old Drum Storage Site is located at the ...

  5. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  6. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that ...

  7. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    ... Jefferson City, MO 65102-0180 Ms. Cynthia Green, Realty Specialist Missouri Department of ... Jefferson City, MO 65102 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. ...

  8. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    ... Swallows were observed throughout the spring and summer. Violet-green, Barn, and Cliff ... Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 U.S. Department of Energy Doc. ...

  9. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  10. FAQs Docs for the Buy American Provision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAQs Docs for the Buy American Provision FAQs Docs for the Buy American Provision These documents answer the most frequently asked questions about the Buy American Provision. International Trade Agreements and the Recovery Act Buy American Provisions: Frequently Asked Questions (57.16 KB) Computer Hardware and Software: Frequently Asked Questions (50.6 KB) More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Buy American Buy American Guidance

  11. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  12. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&0; Policy Flash 2014-26...

  13. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  14. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  15. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  16. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  17. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  18. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  19. First NESAP Post-doc Takes on BoxLib

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  20. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  1. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  2. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  3. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers [EERE]

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  4. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  5. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  6. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers [EERE]

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  7. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  8. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  9. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  10. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  11. Microsoft Word - Corp Impl 10-05-06.final.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  12. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  13. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  14. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc Microsoft Word - FAL2003-03R.doc (198.25 KB) More Documents & Publications WPN 06-8: Dun and Bradstreet Universal Numbering System (DUNS) and Central Contractor Registration (CCR) and Grants.Gov Reminder Microsoft Word - FAL2003-03Rattach.doc WPN 03-7: Grants.Gov: Dun and Bradstreet Universal Numbering System (Duns) and Central Contractor Registration (CCR)

  15. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion

    Broader source: Energy.gov [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  16. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  17. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  18. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Office of Environmental Management (EM)

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  19. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  20. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  1. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  2. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers [EERE]

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  3. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  4. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  5. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  6. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  7. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  8. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  9. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  10. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  11. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  12. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  13. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  14. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  15. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  16. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  17. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  18. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  19. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  20. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  1. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  2. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  3. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  4. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  5. Microsoft Word - ex1b-ITER-mar07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  6. Microsoft Word - ex9-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  7. Microsoft Word - ex9ed-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  8. Microsoft Word - ex9rdf-ITER-sept09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  9. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  10. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  11. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  12. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  13. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon NDIAPMSCSurveillanceGuideOct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIAPMSCEVMSIntentGuideNov2006.pdf ...

  14. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 ... Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. ...

  15. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    ... and maintenance program * Communicate with ... Salmon-Calendar Year 2008 U.S. Department of Energy Doc. No. ... businesses from nearby communities. * Continue the ...

  16. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  17. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    ... retention pond are cliff swallows, violet-green swallows, song sparrows, and black phoebes. 2008 Macroinvertebrate Sampling-Monticello, Utah U.S. Department of Energy Doc. No. ...

  18. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  19. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  20. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry

    2014-01-01

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western

  1. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ...

  2. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ...

  3. Microsoft Word - Second_ ITER Council Press Release.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc (123.14 KB) More Documents & Publications Before the House Subcommittee on Energy - Committee on Science, Space, and Technology Joint Statement by Energy Ministers of G8, The People's Republic of China, India and The Republic of Korea (June 2008) Joint Statement by Energy Ministers of G8, The People's Republic of China, India and

  4. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 85: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  5. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc (65.18 KB) More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy

  6. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  7. Microsoft Word - FEMP-State MOU pdf version.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    FEMP-State MOU pdf version.doc (15.06 KB) More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group ...

  8. Microsoft Word - S04516_2008 GW Rpt Cover.doc

    Office of Legacy Management (LM)

    ... along the bank, and the pond becomes nearly choked with green algae in late summer. ... III Annual Groundwater Report October 2007-April 2008 U.S. Department of Energy Doc. No. ...

  9. An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition Addthis In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The competition provides undergraduate students real-world skills they need to enter tomorrow's clean energy workforce. The challenge is to: develop and deliver a business plan, establish a deployment strategy,

  10. Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    System | Department of Energy Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System effect and performance recovery studies at system level with typical diesel emission control consisting of diesel oxidation catalyst, catalyzed soot filter, and selective catalytic reduction deer11_tang.pdf (504.68 KB) More Documents & Publications Investigation of Sulfur Deactivation on Cu/Zeolite SCR

  11. Deactivation of Accelerated Engine-Aged and Field-Aged SCR Catalysts and the Role of the DOC

    Broader source: Energy.gov [DOE]

    A technique for accelerated aging of SCR system (DOC -> SCR-> DPF) reveals two deactivation mechanisms and replicates field-aged effects

  12. Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a U.S. HD Diesel Engine | Department of Energy a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Lower platinum-metal group catalysts can be used to save money while offering equivalent or better hydrocarbon performanc and longer life and durability. deer08_kramer.pdf (131.83 KB) More Documents & Publications Design Potential of Metal Foil Substrates for

  13. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    North America (US), L.P. | Department of Energy Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. EA-339-A Shell Energy (CN).pdf (423.87 KB) More Documents & Publications EA-339-A Shell Energy North America (US), L.P. EA-339 Shell Energy North America (US), L.P. EA-359-B Castleton Commodities Merchant Trading L.P.

  14. Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition July 5, 2016 - 11:15am Addthis Simon Edelman Simon Edelman Chief Creative Officer Paul Lester Paul Lester Digital Content Specialist, Office of Public Affairs In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The

  15. Microsoft Word - S05773_2009 VerifMonRpt.doc

    Office of Legacy Management (LM)

    September 2009 LMS/DUP/S05773 This page intentionally left blank LMS/DUP/S05773 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2009 Doc. No. S05773 Page i Contents

  16. Microsoft Word - S07693_5-yr review rpt.doc

    Office of Legacy Management (LM)

    Third Five-Year Review Report for the Rocky Flats Site Jefferson and Boulder Counties, Colorado July 2012 LMS/RFS/S07693 This page intentionally left blank U.S. Department of Energy Third Five-Year Review Report for the Rocky Flats, Colorado, Site July 2012 Doc. No. S07693 Page i Contents Abbreviations ................................................................................................................................. iv Executive Summary

  17. Microsoft Word - S09615_oct_dec2012 Quarterly Report.doc

    Office of Legacy Management (LM)

    31, 2012 January 2013 LMS/MNT/S09615 This page intentionally left blank LMS/MNT/S09615 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: October 1-December 31, 2012 January 2013 This page intentionally left blank U.S. Department of Energy Monticello NPL Sites FFA Quarterly Report: October-December 2012 January 2013 Doc. No. S09615 Page i Contents Abbreviations

  18. Microsoft Word - S09813_jan_march2013 Quarterly Report AMH2 March 27 2013.doc

    Office of Legacy Management (LM)

    January 1-March 31, 2013 April 2013 LMS/MNT/S09813 This page intentionally left blank LMS/MNT/S09813 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: January 1-March 31, 2013 April 2013 This page intentionally left blank U.S. Department of Energy Monticello NPL Sites FFA Quarterly Report: January-March 2013 April 2013 Doc. No. S09813 Page i Contents Abbreviations

  19. Microsoft Word - N01307_Sitewide semiannual June-Nov08.doc

    Office of Legacy Management (LM)

    Young - Rainey STAR Center June through November 2008 December 2008 LMS/PIN/N01307 LMS/PIN/N01307 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Semiannual Progress Report for the Young - Rainey STAR Center June through November 2008 December 2008 U.S. Department of Energy Sitewide Semiannual Progress Report for June through November 2008 December 2008 Doc. No. N0130700 Page i Contents Acronyms and Abbreviations

  20. Microsoft Word - N01308_4 5Acre June-Nov08_psd.doc

    Office of Legacy Management (LM)

    Young - Rainey STAR Center's 4.5 Acre Site June through November 2008 December 2008 LMS/PIN/N01308 LMS/PIN/N01308 Pinellas Environmental Restoration Project Semiannual Progress Report for the Young - Rainey STAR Center's 4.5 Acre Site June through November 2008 December 2008 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for June through November 2008 December 2008 Doc. No. N0130800 Page i Contents Acronyms and Abbreviations

  1. Microsoft Word - N01347_Sitewide semiannual Dec-May09.doc

    Office of Legacy Management (LM)

    for the Young - Rainey STAR Center December 2008 through May 2009 June 2009 LMS/PIN/N01347 LMS/PIN/N01347 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Semiannual Progress Report for the Young - Rainey STAR Center December 2008 through May 2009 June 2009 U.S. Department of Energy Sitewide Semiannual Progress Report for December 2008 through May 2009 June 2009 Doc. No. N01347 Page i Contents

  2. Microsoft Word - N01350_4 5Acre Dec-May09.doc

    Office of Legacy Management (LM)

    8 through May 2009 June 2009 LMS/PIN/N01350 LMS/PIN/N01350 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site December 2008 through May 2009 June 2009 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for December 2008 through May 2009 June 2009 Doc. No. N01350 Page i Contents Abbreviations ................................................................................................................................ iii 1.0 Introduction

  3. Microsoft Word - N01440_4 5Acre Jun-Nov09.doc

    Office of Legacy Management (LM)

    June through November 2009 December 2009 LMS/PIN/N01440 LMS/PIN/N01440 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site June through November 2009 December 2009 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for June through November 2009 December 2009 Doc. No. N01440 Page i Contents Abbreviations.................................................................................................................................. ii 1.0

  4. Microsoft Word - N01514_4 5Acre Dec09-May10.doc

    Office of Legacy Management (LM)

    9 through May 2010 June 2010 LMS/PIN/N01514 LMS/PIN/N01514 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site December 2009 through May 2010 June 2010 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for December 2009 through May 2010 June 2010 Doc. No. N01514 Page i Contents Abbreviations.................................................................................................................................. ii 1.0 Introduction

  5. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    Salmon, Mississippi, Site Calender Year 2008 March 2009 LMS/SAL/S05212 This page intentionally left blank LMS/SAL/S05212 Post-Closure Inspection, Sampling, and Maintenance Report for the Salmon, Mississippi, Site Calendar Year 2008 March 2009 This page intentionally left blank U.S. Department of Energy Post-Closure Inspection, Sampling, and Maintenance Report for Salmon-Calendar Year 2008 March 2009 Doc. No. S05212 Page i Contents

  6. Microsoft Word - S05516_AttachD1_OrigLndfl_MM_Plan.doc

    Office of Legacy Management (LM)

    Rocky Flats Site Original Landfill Monitoring and Maintenance Plan September 2009 LMS/RFS/S05516-1.0 This page intentionally left blank LMS/RFS/S05516-1.0 U.S. Department of Energy Rocky Flats Site Original Landfill Monitoring and Maintenance Plan September 2009 This page intentionally left blank U.S. Department of Energy Original Landfill Monitoring and Maintenance Plan-Rocky Flats Site September 2009 Doc. No. S05516-1.0 Page i Contents

  7. Microsoft Word - S06087_3rd qtr 2009 rpt - final.doc

    Office of Legacy Management (LM)

    Third Quarter Calendar Year 2009 January 2010 LMS/RFS/S06087 This page intentionally left blank LMS/RFS/S06087 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Third Quarter Calendar Year 2009 January 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-3rd Quarter CY 2009 January 2010 Doc. No. S06087 Page i Contents

  8. State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc

    Broader source: Energy.gov (indexed) [DOE]

    Weatherization and Intergovernmental Programs Office (WIPO) STATE: Mult PROJECT TITLE : State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (ALRD) Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number SEP-ALRD-2014 GFO-SEP-ALRD-2014 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following

  9. 101907.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... You 7 have to have -- I agree that you have to have 8 some kind of test of marginal ... 18 know that a statistical hypothesis test is 19 valid. 20 MR. LADY: It is a matter ...

  10. 101807.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... There's 13 going to be a full test later this fall. And 14 you will hear more about ... have been using since 1998 to 21 generate test cases for ADL researchers, 22 statistical, ...

  11. Microsoft Word - S09330_2ndQtr2012.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2012 October 2012 LMS/RFS/S09930 This page intentionally left blank LMS/RFS/S09930 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2012 October 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2012 October 2012 Doc. No. S09330

  12. Associate Research Physicist (Post-doc) - NSTX-U | Princeton Plasma Physics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lab (Post-doc) - NSTX-U Department: Experimental Supervisor(s): Dr. Luis F. Delgado-Aparicio Staff: RM 1 Requisition Number: 1600451 The Princeton University Plasma Physics Laboratory (PPPL) seeks to fill a post-doctoral research physicist position at the National Spherical Torus Experiment Upgrade (NSTX-U) in Princeton, NJ. For tokamaks and future facilities to operate safely in a high-pressure long-pulse discharge, it is imperative to address key issues associated with impurity sources,

  13. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies: Preprint

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-04-01

    An accelerated durability test method determined the potential impact of biodiesel ash impurities, including engine testing with multiple diesel particulate filter substrate types, as well as diesel oxidation catalyst and selective catalyst reduction catalysts. The results showed no significant degradation in the thermo-mechanical properties of a DPF after exposure to 150,000-mile equivalent biodiesel ash and thermal aging. However, exposure to 435,000-mile equivalent aging resulted in a 69% decrease in thermal shock resistance. A decrease in DOC activity was seen after exposure to 150,000-mile equivalent aging, resulting in higher hydrocarbon slip and a reduction in NO2 formation. The SCR catalyst experienced a slight loss in activity after exposure to 435,000-mile equivalent aging. The SCR catalyst, placed downstream of the DPF and exposed to B20 exhaust suffered a 5% reduction in overall NOx conversion activity over the HDDT test cycle. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. The results of this study suggest that long-term operation with B20 at the current specification limits for alkali and alkaline earth metal impurities will adversely impact the performance of DOC, DPF and SCR systems.

  14. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies

    SciTech Connect (OSTI)

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-06-01

    It is estimated that operating continuously on a B20 fuel containing the current allowable ASTM specification limits for metal impurities in biodiesel could result in a doubling of ash exposure relative to lube-oil derived ash. The purpose of this study was to determine if a fuel containing metals at the ASTM limits could cause adverse impacts on the performance and durability of diesel emission control systems. An accelerated durability test method was developed to determine the potential impact of these biodiesel impurities. The test program included engine testing with multiple DPF substrate types as well as DOC and SCR catalysts. The results showed no significant degradation in the thermo-mechanical properties of cordierite, aluminum titanate, or silicon carbide DPFs after exposure to 150,000 mile equivalent biodiesel ash and thermal aging. However, exposure of a cordierite DPF to 435,000 mile equivalent aging resulted in a 69% decrease in the thermal shock resistance parameter. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. A decrease in DOC activity was seen after exposure to 150,000 mile equivalent aging, resulting in higher HC slip and a reduction in NO{sub 2} formation. The metal-zeolite SCR catalyst experienced a slight loss in activity after exposure to 435,000 mile equivalent aging. This catalyst, placed downstream of the DPF, showed a 5% reduction in overall NOx conversion activity over the HDDT test cycle.

  15. Cycling of DOC and DON by Novel Heterotrophic and Photoheterotrophic Bacteria in the Ocean: Final Report

    SciTech Connect (OSTI)

    Kirchman, David L

    2008-12-09

    The flux of dissolved organic matter (DOM) through aquatic bacterial communities is a major process in carbon cycling in the oceans and other aquatic systems. Our work addressed the general hypothesis that the phylogenetic make-up of bacterial communities and the abundances of key types of bacteria are important factors influencing the processing of DOM in aquatic ecosystems. Since most bacteria are not easily cultivated, the phylogenetic diversity of these microbes has to be assessed using culture-independent approaches. Even if the relevant bacteria were cultivated, their activity in the lab would likely differ from that under environmental conditions. This project found variation in DOM uptake by the major bacterial groups found in coastal waters. In brief, the data suggest substantial differences among groups in the use of high and molecular weight DOM components. It also made key discoveries about the role of light in affecting this uptake especially by cyanobacteria. In the North Atlantic Ocean, for example, over half of the light-stimulated uptake was by the coccoid cyanobacterium, Prochlorococcus, with the remaining uptake due to Synechococcus and other photoheterotrophic bacteria. The project also examined in detail the degradation of one organic matter component, chitin, which is often said to be the second most abundant compound in the biosphere. The findings of this project contribute to our understanding of DOM fluxes and microbial dynamics supported by those fluxes. It is possible that these findings will lead to improvements in models of the carbon cycle that have compartments for dissolved organic carbon (DOC), the largest pool of organic carbon in the oceans.

  16. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    ... Location Specific Information: Ticket Number Location Sample Date Description GIS 005 40-SC 812008 Cat. I GIS 006 5-SC 8122008 Cat. I GIS 007 51-SC 8132008 Cat. II; ...

  17. Microsoft Word - 08101898_DocProd.doc

    Office of Legacy Management (LM)

    ... Site U.S. Department of Energy RIN 08101898 February 2009 Page 12 Inductively Coupled Plasma (ICP) Interference Check Sample (ICS) Analysis ICP interference check samples ICSA and ...

  18. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    ... Inductively Coupled Plasma (ICP) Interference Check Sample Analysis Inductively coupled plasma interference check samples were analyzed at the required frequency to verify the ...

  19. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    ... Valley, Arizona, Processing Site March 2008 RIN 07121310 Page 11 Inductively Coupled Plasma (ICP) Interference Check Sample (ICS) Analysis ICP interference check samples ICSA and ...

  20. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    ... The internal standard and surrogate recoveries were within the acceptance ranges for all samples. Inductively Coupled Plasma (ICP) Interference Check Sample (ICS) Analysis U.S. ...

  1. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    Shirley Basin South, Wyoming Disposal Site January 2009 LMS/SBS/S00808 This page intentionally left blank This page intentionally left blank U.S. Department of Energy DVP-August 2008, Shirley Basin South, Wyoming, Disposal Site January 2009 RIN 08071744 Page i Contents Sampling Event Summary ...............................................................................................................1 Shirley Basin South, Wyoming, Disposal Site Sample Location Map

  2. "V Doc with logo.doc"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    information with each other to carry out treatment, payment, or health care operations. ... for purposes of health care treatment, payment activities, and health care operations. ...

  3. HABAdv#167.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: Stop Work Authority Adopted: November 5, 2004 Page 1 November 5, 2004 Paul Golan, Assistant Secretary of Energy U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 John Shaw, Acting Assistant Secretary Division of Environmental Safety and Health U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy

  4. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  5. HABadv-117.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: Low-Level Waste Burial Ground Expansion Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Re: Low-Level Waste Burial Ground Expansion Dear Mr. Klein Hanford continues to face pressure to accept offsite waste while also facing severe challenges in dealing with its own waste. Now the U.S. Department of Energy (DOE) proposes to construct up to four new waste disposal trenches in Hanford's low-

  6. HABadv-118.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 Subject: HAMMER Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy P.O. Box 550 (A7-50) Richland, WA 99352 Re: Hazardous Materials Management and Emergency Response Training and Education Center (HAMMER) Dear Mr. Klein Worker, public, and environmental health and safety are a fundamental concern at the Hanford Site. Protection requires prevention of accidents and disease, and prevention requires a work force that is well- trained and drilled in safe work

  7. TsaiFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Characterization of Glass, Carbon, and Hybrid-Fiber SCRIMP Panels Akira Kuraishi, Stephen W. Tsai, and Julie Wang Stanford University Department of Aeronautics and...

  8. HABadv-121.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens...

  9. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  10. Feb09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Donna J. Holdridge Contributor: Lynne Roeder Website: http:www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago...

  11. DOEF46001705.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ORGANIZATION LOCAL GOV'T INSTITUTION OF OTHER NONPROFIT C P SP OTHER (Specify) HIGHER EDUCATION ORGANIZATION 14. ACCOUNTING AND APPROPRIATIONS DATA: 15. EMPLOYER I.D. a. TIN: b. ...

  12. Fonsi.Leo.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... empty and 147 full); uranium dioxide (UO 2 ) (UO 2 inventory on the Hanford Site consists of depleted and normal uranium pellets, powder, and fuel pins containing UO 2 pellets). ...

  13. Microsoft Word - 20.doc

    Office of Scientific and Technical Information (OSTI)

    ... resistance due to the reported formation of a layer of SiO 2 at the surface. (9-11) It has been suggested this film can ... favoring the formation of a thin, adherent chromia layer. ...

  14. Oct08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-10 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: John Schatz Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Leadership Noble County Members Tour SGP Site Members of the non-profit organization Leadership Noble County

  15. craig_IAEA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EX/P5-3 New Observations Concerning the Origin and Consequences of MHD Activity in the MST Reversed Field Pinch D. Craig 1), A.F. Almagri 1), J.K. Anderson 1), D.L. Brower 2), B.E. Chapman 1), S.H. Choi 1), D.J. Den Hartog 1), W.X. Ding 2), F. Ebrahimi 1), G. Fiksel 1), R. Fitzpatrick 3), C.B. Forest 1), P. Martin 4), L. Marrelli 4), R. O'Connell 1), P. Piovesan 4), S.C. Prager 1), J.S. Sarff 1), G. Spizzo 4) 1) University of Wisconsin, Madison, WI USA and the Center for Magnetic Self-

  16. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EA - 0993 ENVIRONMENTAL ASSESSMENT SHUTDOWN OF THE FAST FLUX TEST FACILITY HANFORD SITE, RICHLAND, WASHINGTON U.S. DEPARTMENT OF ENERGY MAY 1995 This page intentionally left blank. U.S. Department of Energy Glossary Environmental Assessment G-1 May 1995 Glossary Acronyms and Initialisms ALARA As Low As Reasonably Achievable CCC Core Component Container CFR Code of Federal Regulations CY Calendar Year D&D decontamination and decommissioning DOE U.S. Department of Energy DOT U.S. Department of

  17. fftf ea 05292001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  18. Microsoft Word - 13045.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    from Environmental Health Risks and Safety Risks By ... as follows: Section 1. Policy. 1-101. A growing body of ... jobs, the environment, public health or safety, or ...

  19. Annual Report 2008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electric Power Annual Update / Revision Data for 2014 updated: February 16, 2016 February 16, 2016 Table update: The following tables are being withheld pending the availability of additional data: Table 8.5. Revenue and Expense Statistics for U.S. Cooperative Borrower-Owned Electric Utilities Table 8.6.A. Noncoincident Peak Load by North American Electric Reliability Corporation Assessment Area, Actual Table 8.6.B. Noncoincident Peak Load by North American Electric Reliability Corporation

  20. sr0801.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office, P.O. Box A, Aiken, S.C. 29802 NEWS MEDIA CONTACTS: For Immediate Release June 19, 2008 Julie Petersen (803) 952-7690 julie.petersen@srs.gov Jim Giusti (803) 952-7684 james-r.giusti@srs.gov DOE Marks Key Cleanup and Closure Milestones at its Savannah River Site AIKEN, S.C. - U.S. Department of Energy (DOE) Assistant Secretary for Environmental Management (EM) James A. Rispoli today marked the start of normal operations of interim salt waste processing facilities - the Actinide Removal

  1. sr0930.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CONTACTS FOR IMMEDIATE RELEASE Julie Petersen, (803) 952-7690 Monday, October 26, 2009 julie.petersen@srs.gov Kelly Ling, (803) 952-9172 kelly.ling@srs.gov DOE to Honor Nuclear Weapons Patriots of SRS at National Day of Remembrance Program Aiken, SC (Oct. 26) - In commemoration of a National Day of Remembrance, the U.S. Department of Energy (DOE) will honor past, present and future nuclear weapons program employees of the Savannah River Site (SRS) at a special program on Friday, October, 30,

  2. TentativeAgreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  3. 032102ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... One, you want to interest them in you, but you also want to test them to see whether they ... But this is also a test to see if anybody has a sense of humor. Okay. Here's where we ...

  4. 102501ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... The goal: We look at the properties and try and develop some ideas and test the ideas and ... gas production series, and Texas is our test case, that has the following things: The ...

  5. Brooks - administrator.doc

    National Nuclear Security Administration (NNSA)

    maintains the U.S. nuclear weapons stockpile, promotes international nuclear non-proliferation and safety, reduces global danger from weapons of mass destruction, provides the ...

  6. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ......... 10 HIPAA CERTIFICATE OF CREDITABLE COVERAGE ......... 22 HIPAA CERTIFICATE OF CREDITABLE COVERAGE ...

  7. Microsoft Word - 1111062.doc

    Office of Scientific and Technical Information (OSTI)

    ... feedstock availability and cost for fueling ethanol production in South Dakota counties. ... Rawls, W. J., D. L. Brakensiek, and K. E. Saxton. 1982. Estimation of soil water ...

  8. 022996A.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mike Zuteck MDZ Consulting 601 Clear Lake Road Clear Lake Shores, TX Abstract Improving wind turbine blades via bend-twist coupling confronts two difficult challenges. ...

  9. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  10. Microsoft Word - ~2432658.doc

    Office of Scientific and Technical Information (OSTI)

    ... Salt Thermocline Thermal Storage System for Parabolic Trough Plants", Journal of Solar Energy Engineering, Proof Copy 002202SLE, May 2002 DE-FG36-08GO18149 Revision: - Date: 06...

  11. Microsoft Word - 033302.doc

    Office of Scientific and Technical Information (OSTI)

    processes coupled with special enzymes. This combination could be used to design a solar panel to capture solar energy for use in carbon fixing reactions aimed at the...

  12. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  13. SubcontractingGuidelines.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Table of Contents ABBREVIATIONS AND ACRONYMS.................................................................3 1. INTRODUCTION................................................................................................................. 4 1.1. PURPOSE .......................................................................................................................................................................4 1.2.

  14. 2B-05.doc

    Office of Environmental Management (EM)

    ... Sampling and monitoring approaches, as well as the full data set for this remediation, were published in the final report (U.S. DOE, 2003). The remedial activities were conducted ...

  15. Index2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    41666 18. Letter to Jo Ann Estevez from Abel Lopez, dated December 23, 2003. 3 pages. ... 41668 20. Letter to Michael Ravnitzky from Abel Lopez, dated February 12, 2004. 9 pages. ...

  16. 1146627_7.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PacifiCorp; NextEra Energy Resources, LLC; Invenergy Wind North America LLC; and Horizon Wind Energy LLC Complainants, v. Bonneville Power Administration Respondent. ) ) ) ) ) ) )...

  17. win0203.doc

    Gasoline and Diesel Fuel Update (EIA)

    Winter Fuels Outlook: 2002-2003 Introduction This report provides a summary of the winter outlook for demand, supply and prices for several key domestic heating fuels, including natural gas, heating oil and propane. The results discussed here are based on the forecast results obtained for the October 2002 Short-Term Energy Outlook plus special scenarios generated for this article. For the purposes of the analysis, winter is defined as the period from October through March. Highlights * Higher

  18. 2B-01.doc

    Energy Savers [EERE]

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  19. 032202ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... for any possible energy emergency, and ESAR is an important ... and worldwide, to avoid any Y2K-related energy problems. ... ? to look at things differently than you had been planning? ...

  20. Environmental Records.doc

    Office of Environmental Management (EM)

    Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of ... of management services organizations dedicated to solving waste cleanup problems. ...

  1. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  2. Microsoft Word - 64490001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449, pp. 1-25, 2011. © Springer-Verlag Berlin Heidelberg 2011 Exascale Computing Technology Challenges John Shalf 1 , Sudip Dosanjh 2 , and John Morrison 3 1 NERSC Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, California 94611 2 Sandia National Laboratories, New Mexico 87185 3 Los Alamos National Laboratory, Los Alamos, New Mexico 87544 jshalf@lbl.gov, sudip@sandia.gov, jfm@lanl.gov Abstract. High Performance

  3. Chakrapani-V.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cloud Thickness Estimation from GOES-8 Satellite Data Over the ARM-SGP Site V. Chakrapani, D. R. Doelling, and A. D. Rapp Analytical Services and Materials, Inc. Hampton, Virginia P. Minnis National Aeronautics and Space Administration Langley Research Center Hampton, Virginia Introduction The effects of clouds on radiative forcing are topics of intense interest and of direct relevance to climate change. They remain the greatest source of uncertainty in global climate models. There are many

  4. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    Short-Term Energy Outlook April 2002 Overview World Oil Markets: Average crude oil prices moved up strongly in March, rising nearly $4 from the average February level to $24.50 per barrel for West Texas Intermediate (WTI). A stronger sentiment on the side of OPEC production discipline, a growing sense by the market that economic growth may accelerate more rapidly than previously thought, and continued uncertainty surrounding tensions in the Middle East have elevated near-term prices above

  5. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    2 1 Short-Term Energy Outlook August 2002 Overview World Oil Markets: Oil prices remained relatively high in July, averaging close to the expectations reported in the July Outlook. The average spot West Texas Intermediate (WTI) price in July was approximately $27 per barrel. As always, a wide range of possibilities exists for oil price movements over the next year and a half. However, given the amount of growth in world demand expected through 2003, we think that likely scenarios for OPEC and

  6. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    (Energy Information Administration/Short-Term Energy Outlook -- February 2002) 1 Short-Term Energy Outlook February 2002 Overview World Oil Markets. OPEC's stated intention to reduce crude oil output beginning in January has been mostly successful. OPEC-10 crude oil output (OPEC less Iraq) fell by an estimated 1.1 million barrels per day in January, or about 70 percent of the officially announced quota reductions. Compliance rates at these levels tend to validate our expectations for steadily

  7. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    July 2002 1 Short-Term Energy Outlook July 2002 Overview World Oil Markets: World oil price markers fell in June, with both Brent crude oil and the OPEC basket prices averaging $1.00 - $1.50 per barrel below May averages. Nevertheless, June marked the fourth consecutive month that the OPEC basket price averaged above $22 per barrel, the lower end of OPEC's target range. The basket price has been above $22 per barrel since March 8 and is projected to remain within the target range ($22-28 per

  8. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    July 2003 1 Short-Term Energy Outlook July 2003 Overview World Oil Markets. The average West Texas Intermediate (WTI) crude oil price for June was up by about $2.50 per barrel from the May average, in part because OECD oil inventories remain low by historical standards. Oil prices are not likely to fall significantly until commercial inventories rise to levels observed in recent years. EIA's Outlook is for prices to remain firm throughout the rest of 2003 (in the $29- $30 per barrel range for

  9. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    June 2003 1 Short-Term Energy Outlook June 2003 Overview World Oil Markets. Average crude oil prices rose in May as continued reports of low oil inventories trumped expectations that Iraqi oil production would quickly return to pre-war levels. Those hopes faded on the news that post-war looting would postpone for some months the return of the Iraqi oil sector to normal operations. In addition, a terrorist attack in Saudi Arabia and estimates of lower production in Saudi Arabia by some analysts

  10. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    March 2002 1 Short-Term Energy Outlook March 2002 Overview World Oil Markets. Average crude oil prices strengthened by $1 per barrel in February on evidence that the United States and other industrialized countries trimmed slightly the year-over-year surplus in commercial inventories and on concerns that the U.S. may be turning its attention toward Iraq in its ongoing battle against world terrorism. The West Texas Intermediate price in February was $20.72 per barrel, compared to $19.71 per

  11. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    May 2002 1 Short-Term Energy Outlook May 2002 Overview World Oil Markets: World oil prices continued to rise in April, with OPEC Basket and Brent prices rising by $2 per barrel on average from March levels. April marked the second consecutive month that the OPEC basket price finished above $22 per barrel, the lower end of the target range for the OPEC basket price. The U.S. benchmark West Texas Intermediate (WTI) crude oil price averaged over $26 per barrel in April, and closed over $27 per

  12. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    September 2002 1 Short-Term Energy Outlook September 2002 Overview World Oil Markets: The waxing and waning intensities of concern surrounding potential military action against Iraq and uncertainty over OPEC production policy leading up to their September 19 meeting have contributed to WTI spot crude oil prices bouncing between $26 and $30 per barrel since early August. The average spot WTI price in August was $28.40 per barrel. Developments suggesting an easing of tensions could temporarily

  13. Report2003.doc

    Broader source: Energy.gov (indexed) [DOE]

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  14. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    97 (9/12) Page 1 of 4 Form 1897 Onsite Non-US Government-Owned Controlled Article Authorization Form When properly executed, this form authorizes the described controlled article (see P217 Controlled Articles) to reside at, or be removed from, LANL during the specified period of time. No other controlled article may be substituted under this authorization. The original, signed form must be kept with the controlled article at all times, and a copy sent to the Information Security Office by fax at

  15. Habadv-115.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    115 Subject: Proposed River Corridor and Performance Measures Adopted: April 6, 2001 Page 1 April 6, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 999352 Subject: Proposed River Corridor Contract and Performance Measures Dear Mr. Klein, Clean- up of the River Corridor is important. The proposed River Corridor contract should authorize and direct the contractor to perform the full scope of work of the Hanford Clean-Up Agreement more

  16. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  17. Habadv-120.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  18. 2010SR05.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Big Top Tent Keeps TRU Waste Trucks, Tanks Dry before Inspection and Shipping Big Top Aids Solid Waste Management in Shipping Protocol Aiken, S.C. - Important projects for the Recovery Act - and not a circus act - are being performed under the Big Top at Solid Waste Management facility at the Department of Energy's (DOE) Savannah River Site (SRS). The jumbo-size vinyl tent with a metal frame measuring 160 feet long, 24 feet wide, and 20 feet high is used in the Site's E Area to shelter trucks

  19. 2010sr07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 23, 2010 james-r.giusti@srs.gov Kyle Bryant, EPA-4, (404) 562-9073 bryant.kyle@epa.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov SRS Moves Forward With Final Closure of Cold War Reactors AIKEN, S.C. - With the beginning of a new decade, the U.S. Department of Energy's (DOE) Savannah River Site (SRS) is moving forward with its decommissioning activities for the SRS Cold War Production Reactors. The Department approved the construction start of the in-situ decommissioning

  20. 2010sr14.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Regional Businesses Benefit as Recovery Act Funding Flows into the Economy at SRS More than $11 million in local and small business contracts awarded Aiken, SC -- Local and small businesses in the Central Savannah River Area (CSRA) have benefited from more than $11 million worth of new business since last October, as part of the Department of Energy's (DOE) American Recovery and Reinvestment Act projects at the Savannah River Site (SRS).

  1. 2010sr15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    With ARRA Funds, P-Reactor Disassembly Basin Project Moves One Step Closer to Final Decommissioning Aiken, S.C. - Funding through the American Recovery and Reinvestment Act has moved the Department of Energy one step closer to closing the book on the Cold War-era P- Reactor facility at the Savannah River Site (SRS). With the installation, testing and startup of six evaporator units, SRS can begin removing about 4.6 million gallons of water from the 105-P Reactor Disassembly Basin - a phase of in

  2. 2010sr16.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Recovery Act Funds Put Aiken Technical College Rad Con Graduates to Work Early Aiken, S.C. - Using $200,000 in American Recovery and Reinvestment Act funds from the U.S. Department of Energy's Savannah River Site (SRS), the Aiken Technical College's (ATC) Radiation Protection Technology Program will be able to catapult 16 graduates into the local work force nearly six months ahead of schedule. "The program's first graduates are a success story that has come to life in a short period of

  3. 2010sr18.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, May 25, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov SRS Demolishes Massive Cooling Tower, Continues Progress on Environmental Footprint Reduction (Aiken, S.C.) - The Savannah River Site's (SRS) massive K Cooling Tower was safely demolished today as part of the Site-wide Footprint Reduction Initiative funded by the American Recovery and Reinvestment Act (ARRA). As the second-largest cooling tower to be demolished worldwide, the 450 foot-tall and

  4. 2010sr20.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Monday, June 21, 2009 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov New Robot Supports SRS Waste Tank Closures Aiken, SC (June 21) - Movie-goers may have Iron Man 2, but thanks to the American Recovery and Reinvestment Act, the Department of Energy's (DOE) Savannah River Site (SRS) has its own super hero - "Tizzy," a tank-cleaning robot. Tizzy will remove high- level solid radioactive material from the floor of SRS waste tanks and transfer the material

  5. 2010sr21.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday July 7, 2010 james-r.giusti@srs.gov DOE and NRC to Hold Public Meeting on SRS F Tank Farm Waste Determination Draft Basis Document Aiken, SC - The U.S. Department of Energy (DOE) will hold a public meeting with the Nuclear Regulatory Commission (NRC) on the development of the Section 3116 Draft Basis Document for F Tank Farm at the Savannah River Site on July 13 and 14, 2010. The meeting is to help DOE in the identification of issues with the reasonability of the approach to

  6. 2010sr22.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, August 10, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov Use of Successful Decontamination Technology Expanded at Savannah River Site, Accelerates Cleanup High Heat Removes Tritium from Contaminated D-Area Soil and Concrete Aiken, S.C. - After a successful pilot project, DOE's Savannah River Site (SRS) will expand the use of new decontamination technology funded by the American Recovery and Reinvestment Act. The process will rid soil and concrete

  7. 2010sr23.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    11, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov Recovery Act Funding Improves Stormwater Drainage at the Largest Closed Seepage Basins on SRS Aiken, S.C. - Preventing the migration of contamination from rainwater runoff at a closed seepage basin at the Department of Energy's (DOE) Savannah River Site (SRS) can be as simple as a new concrete ditch and as complicated as making sure the runoff flows correctly. The American Recovery and Reinvestment Act is

  8. 2010sr24.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    25, 2010 james-r.giusti@srs.gov DOE Presents "Star of Excellence" Award to Savannah River Site Contractor AIKEN, S.C. - U.S. Department of Energy (DOE) recently awarded its Voluntary Protection Program "Star of Excellence" to Savannah River Nuclear Solutions for 2010. "Time and again Savannah River Nuclear Solutions has proven how highly they value employee safety," said Inés Triay, Ph.D., DOE Assistant Secretary for Environmental Management. "We recognize

  9. 2010sr26.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thursday, September 2, 2010 james-r.giusti@srs.gov SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  10. 2010sr32.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Monday, December 6, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov SRNL Specially Invented Grout Aids SRS Reactor Closure AIKEN, S.C. - A combination of teamwork and cutting-edge science is responsible for the unique flowable and self-leveling cement slurry that on November 22 completely filled the P Reactor vessel at the Savannah River Site (SRS). This American Recovery and Reinvestment Act project utilized the technical expertise of the U.S. Department of

  11. 2011_sr_03.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday, February 23, 2011 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 646-6075 paivi.nettamo@srs.gov Recovery Act's HWCTR Project Empty of Equipment, Ready for Grouting AIKEN, S.C. - Thanks to investments from the American Recovery and Reinvestment Act, the next phase has begun on decommissioning the Heavy Water Components Test Reactor (HWCTR) at the Savannah River Site (SRS). With the reactor building now empty of its two steam generators and the reactor vessel, work can start on

  12. 2011sr01.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, February 1, 2011 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 646-6075 paivi.nettamo@srs.gov Recovery Act Funds Test Reactor Dome Removal in Historic D&D Project AIKEN, S.C. - The landscape of the Savannah River Site (SRS) is a little flatter and a little less colorful with the removal today of the 75-foot-tall rusty-orange dome from the Cold War-era test reactor. This $25-million reactor decommissioning and deactivation project is funded By the American Recovery and

  13. Activation.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    as it becomes available. The Joint Information Center (JIC), located at 4021 National Parks Highway, has been activated to provide public information. For updated information,...

  14. 1B-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1B-03, in: A.R. Gavaskar and A.S.C. Chen (Eds.), Remediation of Chlorinated and Recalcitrant Compounds -2004. Proceedings of the Fourth International Conference on Remediation of Chlorinated and Recalcitrant Compounds (Monterey, CA; May 2004). ISBN 1-57477-145-0, published by Battelle Press, Columbus, OH, www.battelle.org/bookstore. NONAQUEOUS-PHASE LIQUID CHARACTERIZATION AND POST-REMEDIATION VERIFICATION SAMPLING ABSTRACT: Light and dense nonaqueous-phase liquids (NAPLs) were identified in the

  15. U0174100.doc

    Office of Legacy Management (LM)

    Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA ... DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November ...

  16. U0004500.DOC

    Office of Legacy Management (LM)

    155 Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill ... Environmental Assessment of Ground-Water Compliance Activities At the Uranium Mill ...

  17. guide.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guide to the Authors of the Book DYNAMICS AND THERMODYNAMICS WITH NUCLEONIC DEGREES OF FREEDOM Edited by the WCI Steering Committee To be published by Springer (2006) 1. Deadline: send you review article before February the 14 th , 2006 to the editorial committee of your section. 2. Length: papers should not exceed 14 pages using the EPJ L A T E X 2e macro package available via anonymous ftp from the ftp server : ftp.edpsciences.org in the directory /pub/epj 3. What to send: please send a

  18. weatherwksht.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    weapons NNSA Reaches Important Milestone with B61-12 Life Extension Program WASHINGTON - The Department of Energy's National Nuclear Security Administration (DOE/NNSA) announced that they recently formally authorized the production engineering phase of its B61-12 warhead life extension program (LEP). This important milestone comes after four years of work in... DOD/DOE NNSA Joint Munitions Program: 30 years of collaborative innovation As part of NNSA's commitment to protecting and preserving the

  19. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  20. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  1. 2010sr25.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tuesday, August 31, 2010 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Tank 37 Salt Removal Marks Second Liquid Waste Project Completed Recovery...

  2. 2010sr13.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 13, 2010 james-r.giusti@srs.gov DOE Announces Intention to Offer State of Georgia Additional Enviromental Monitoring Funds AIKEN, SC - The Department of Energy (DOE) today...

  3. 2010sr17.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thursday, May 13, 2010 james-r.giusti@srs.gov DOE to Host Public Education Forum on Use of Performance Assessments Aiken, SC -- The U.S. Department of Energy (DOE) will host a...

  4. 2010sr19.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wednesday, June 2, 2010 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Blowing Bubbles Using Recovery Act Funds, SRS Looks to Apply Novel Solutions...

  5. doeadm-17.doc

    Energy Savers [EERE]

    ... or ice on the ground, water equivalent, and unmelted ... readings, and atmospheric pressure over 24- ADM 17 ... of fluorine or other generators, reflecting such data as ...

  6. Aug08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Energy Aug. 31 Webinar to Focus on Project Regulatory Considerations Aug. 31 Webinar to Focus on Project Regulatory Considerations August 23, 2016 - 11:43am Addthis The U.S. Department of Energy Office of Indian Energy, in partnership with Western Area Power Administration, is hosting a free webinar on "Project Regulatory Considerations" Wednesday, Aug. 31, from 11 a.m. to 12:30 p.m. Mountain Daylight Time. Attendees will get an overview of the many permitting and project

  7. LibraDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a Libra session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 1 Core sessions and 1 Flex ...

  8. FIBDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a FIB session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 2 Core sessions and 2 Flex ...

  9. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time. ...

  10. TecnaiDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a Tecnai session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 1 Core session and 1 ...

  11. Tentative Agreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Keith A. Klein, Manager Linda Hoffman, Acting Director U. S. Department of Energy, Richland State of Washington, Department...

  12. SWPPPMH1.doc

    National Nuclear Security Administration (NNSA)

    ... and where detergents are not used * air conditioning condensate * uncontaminated ... Members of the Storm Water Pollution Prevention Team conducted a walk-down of ...

  13. Index2.doc

    Energy Savers [EERE]

    --- 41664 1. Serious Accidents Issue No. 107, Atomic Energy Commission, dated August 20, 1956. 6 pages. (F2004-00101) 41665 17. Electronic FOIA...

  14. shprkEA.doc

    Office of Legacy Management (LM)

    ... Name Agency or Company Madeline Roanhorse Ray Russell Harlen Charlie Navajo UMTRA Program ... Quality, 13(1):146-150. International Atomic Energy Agency (IAEA), 1994. Handbook of ...

  15. Sep08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-09 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. 3D Water Vapor Field Campaign Concludes Researchers from the Colorado State University recently concluded a week-long field experiment at the SGP (August

  16. Nov08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    System With more than 300 instrument systems operating at remote sites around the globe, ACRF Instrument Mentors can now use the centralized Operations Support System (OSS)...

  17. May08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to be minor, but solving them was critical to ensuring the quality of data obtained in past and future field campaigns. With their high sensitivity for detecting cloud...

  18. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Plan is governed by a Federal law (known as ERISA), which provides rights and ... to spouses (as defined under federal law), same-sex domestic partners, and children ...

  19. LLNLKEYSFINAL.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Inspections Inspection Report Reporting of Security Incidents at the Lawrence Livermore National Laboratory DOE/IG-0625 November 2003 * Did not take timely compensatory measures to mitigate the potential vulnerabilities resulting from the missing master keys and master Tesa card. During our review we learned that during a May 2003 inventory, Livermore officials identified an additional three master keys and two master Tesa cards that were missing. Although two of the three master keys had been

  20. Microsoft Word - 10063154.doc

    Office of Legacy Management (LM)

    ... were sampled to monitor plume movement and natural flushing. ... Chromatography Peak Integration The integration of analyte ... by the Colorado Oil and Gas Conservation Commission to ...

  1. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  2. DOC182.PDF

    Energy Savers [EERE]

    line item. This fee is similar to those paid by commercial firms to belong to trade and industry associations related to their government contracts, and is considered an...

  3. sr0905.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The 795 million project replaces a deteriorating, inefficient coal powerhouse and oil-fired boilers ... Ameresco is constructing a steam cogeneration plant and installing two steam ...

  4. sr0934.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a deteriorating, inefficient coal powerhouse and oil-fired boilers at a savings of ... support 125 permanent positions in plant operations and maintenance and in ...

  5. titlepg.doc

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    ... Thus, coal plant utilization is expected to be pushed rapidly to new highs early in 1998. ... electricity demand, declines in gas-fired electricity generation, and little growth ...

  6. U0083900.doc

    Office of Legacy Management (LM)

    ... Grand Junction Office) Robert Bleil (Compliance Specialist) (970) 248-6503 Michelle Smith (Public Relations) (970) 248-6583 Project Description DOE has (1) installed wells to ...

  7. SEC A.doc

    National Nuclear Security Administration (NNSA)

    SOLICITATION, OFFER AND AWARD 1. THIS CONTRACT IS A RATED ORDER UNDER DPAS (15 CFR 350) RATING DO E-2 PAGE 1 OF 291 PAGES 2. CONTRACT NO. 3. SOLICITATION NO. DE-SOL-0007749 4. TYPE OF SOLICITATION SEALED BID (IFB) NEGOTIATED (RFP) 5. DATE ISSUED 12/12/2014 6. REQUISITION/PURCHASE NO. See Section B 7. ISSUED BY CODE MOSD 8. ADDRESS OFFER TO (If other than Item 7) U.S. DEPARTMENT OF ENERGY NATIONAL NUCLEAR SECURITY ADMINISTRATION M&O CONTRACTING BRANCH (NA-APM-131) PO BOX 5400, ALBUQUERQUE, NM

  8. "V Doc with logo.doc"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LANL HIPAA Privacy Notice: This notice describes how medical information about you may be used and disclosed and how you can get access to this information. Please review it carefully. The Health Insurance Portability and Accountability Act of 1996 (HIPAA) imposes numerous requirements on employer health Plans concerning the use and disclosure of individual health information. This information, known as protected health information, includes virtually all individually identifiable health

  9. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    448 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 December 2006, Monument Valley, Arizona This page intentionally left blank U.S. Department of Energy DVP⎯December 2006, Monument Valley, Arizona March 2007 RIN 06110582 Page iii Contents Sampling Event Summary

  10. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    85 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2007 Groundwater and Surface Water Sampling at the Shiprock, New Mexico, Disposal Site January 2008 This page intentionally left blank U.S. Department of Energy DVP-September 2007, Shiprock, New Mexico, Disposal Site

  11. Microsoft Word - RIN 08061655 DocProd.doc

    Office of Legacy Management (LM)

    8 Groundwater Sampling at the Monument Valley, Arizona, Processing Site November 2008 LMS/MON/S00608 This page intentionally left blank U.S. Department of Energy DVP-June 2008, Monument Valley, Arizona, Processing Site November 2008 RIN 08061655 Page i Contents Sampling Event Summary ...............................................................................................................1 Monument Valley, Arizona, Processing Site Sample Locations

  12. Microsoft Word - 08041519_08051593_DocProd.doc

    Office of Legacy Management (LM)

    LMS/GUP/S04641 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - May and June 2008 Groundwater and Surface Water Sampling at the Gunnison, Colorado, Processing, Site August 2008 This page intentionally left blank U.S. Department of Energy DVP-May and June 2008, Gunnison, Colorado,

  13. Microsoft Word - RIN 07040836 DocProd.doc

    Office of Legacy Management (LM)

    Data Validation Package - - U.S. Department of Energy Office of Legacy Management This page intentionally left blank U.S. Department of Energy DVPMay 2007, Gunnison, Colorado, Processing Site August 2007 RIN 07040836 Page iii Contents Sampling Event Summary ...............................................................................................................1 Gunnison, Colorado, Processing Site Sample Location Map ..........................................................3 Data

  14. Microsoft Word - RIN 08051595 DocProd.doc

    Office of Legacy Management (LM)

    08 Groundwater and Surface Water Sampling at the Durango, Colorado Disposal and Processing Sites August 2008 LMS/DUR/S00608 This page intentionally left blank U.S. Department of Energy DVP-June 2008, Durango, Colorado, Disposal and Processing Sites August 2008 RIN 08051595 Page iii Contents Sampling Event Summary ...............................................................................................................1 Durango, Colorado, Disposal Site Sample Location

  15. Microsoft Word - RIN 08071743 DocProd.doc

    Office of Legacy Management (LM)

    Grand Junction, Colorado Disposal Site January 2009 LMS/GRJ/S00808 This page intentionally left blank U.S. Department of Energy DVP-August 2008, Grand Junction, Colorado, Disposal Site January 2009 RIN 08071743 Page i Contents Sampling Event Summary ...............................................................................................................1 Grand Junction, Colorado, Disposal Site Sample Location Map ....................................................3 Data Assessment

  16. Microsoft Word - RIN07050889_ DocProd.doc

    Office of Legacy Management (LM)

    512 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 May 2007 Ground Water and Surface Water Sampling at the Durango, Colorado, Disposal and Processing Sites August 2007 This page intentionally left blank U.S. Department of Energy DVP-May 2007, Durango, Colorado, Disposal and

  17. Microsoft Word - Final Transportation Doc _7-13-06_.doc

    Gasoline and Diesel Fuel Update (EIA)

    cost changes due to production volume economies of scale and potential scientific, manufacturing, and design advances. Manufacturing advances can generally be thought of as...

  18. Microsoft Word - Final AEO2007 Commercial Doc.doc

    Gasoline and Diesel Fuel Update (EIA)

    the State Energy Data System (SEDS) historical commercial sector consumption, applying an additive correction term to ensure that simulated model results correspond to published...

  19. Microsoft Word - draft2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    several features of the mode, the high-frequency companions, a geodesic- acoustic wave and an Alfvenic mode have clearly not been observed. Improvements to the optical arrays...

  20. Scan_Doc0002.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  1. Microsoft Word - LLNLHRPfinal062606.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report The Human Reliability Program at Lawrence Livermore National Laboratory DOE/IG-0732 June 2006 THE HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Drug and Alcohol Test Random Selection

  2. Microsoft Word - FORM46002.doc

    Office of Environmental Management (EM)

    ... These standard forms are available at http:www.whitehouse.govombgrantsindex.html. Fillable forms are available at http:grants.pr.doe.gov. IV. CLOSEOUT ...

  3. Microsoft Word - PURPA 2009.doc

    Energy Savers [EERE]

    ... STATE: ALABAMA Regulatory Authority: Alabama Public Service Commission Private Companies: ... Arizona Corporation Commission Private Companies: Arizona Public Service Co ...

  4. Microsoft Word - nanoparticles.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and WAXS, they were able to remove the small-particle size contribution to x-ray diffraction peak broadening and quantify the excess disorder and strain in the nanoparticles...

  5. Microsoft Word - Part 6.doc

    Office of Environmental Management (EM)

    NMAC (incorporating 40 CFR 264.110 through 264.116 and 264.178), this Permit Part, and the procedures described in Permit Attachment G (Closure Plan). 6.2. PERFORMANCE...

  6. Microsoft Word - Part 7.doc

    Office of Environmental Management (EM)

    7 Page 7-1 of 6 PART 7 - POST-CLOSURE CARE PLAN 7.1. OVERVIEW This Part specifies the post-closure care requirements for the WIPP facility. Post-closure care requirements are...

  7. Microsoft Word - M084.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  8. Microsoft Word - PART 970.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... concerning any rate of remuneration ... under the control of the United States Government, and ... laws for injury or death to employees arising out ...

  9. Microsoft Word - April2005.doc

    National Nuclear Security Administration (NNSA)

    5 SPONSORED BY DOE AND NRC PREPARED BY NAC INTERNATIONAL 2005 NMMSS Users Annual Training Meeting The 2005 NMMSS Users Annual Training Meeting will be held May 24-26 at the Ritz-Carlton, 921 Canal Street, New Orleans. The theme for this year's meeting is Building on the Foundation: Materials Accounting for the Future. The training meeting will focus on: * Unified DOE/NRC reporting * Reporting changes that will result from the NMMSS Upgrade * Yucca Mountain reporting requirements * Improving

  10. Microsoft Word - ESA.doc

    National Nuclear Security Administration (NNSA)

    ... issued pursuant to this chapter. (d) Imports and exports (1) In general It is unlawful ... species part" means- (i) any sperm whale oil, including derivatives thereof, which was ...

  11. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    problems. The Coal Report, currently available only to the STB and parties to the UP recovery proceedings, measures coal delivery service in terms of cycle times, sets in...

  12. ATS Recertification Final.doc

    Office of Environmental Management (EM)

    Program Onsite Review January 7-17, 2008 U.S. Department of Energy Office of Health, Safety and Security Office of Health and Safety Office of Worker Safety and Health...

  13. Microsoft Word - taylor.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Tropical Western Pacific P. Taylor and R.G. Ellingson Florida State University Tallahassee, Florida Introduction The effective cloud fraction, N e , has been suggested to ...

  14. AL2007-08.doc

    Broader source: Energy.gov (indexed) [DOE]

    Assessment Tool, IEEE Standard 1680-2006 for Environmental Assessment of Personal Computer Products. When is this Acquisition Letter (AL) Effective? This AL is effective...

  15. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  16. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  17. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  18. Microsoft Word - OS.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    obligations under the Net Billing Agreements are not general obligations of the United States of America and are not secured by the full faith and credit of the United States of...

  19. Microsoft Word - Chapter 01.doc

    National Nuclear Security Administration (NNSA)

    ... be shipped to the Waste Isolation Pilot Plant near Carlsbad, New Mexico, for disposal. ... Los Alamos National Laboratory, Oak Ridge Reservation, and the Savannah River Site. ...

  20. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    p o i n t o f t h e i r h i g h a n d lo w p r ic e f o r a d a y . T h e d a t e s m a r k e d b y v e r t i c a l li n e s a r e t h e N Y M E X n e a r - m o n t h c o n t r a c...

  1. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    1 0 1 6 9 8 1 0 1 7 9 8 Degrees in Fahrenheit A c tu a l N o rm a l ( C h i c a g o , K a n s a s C i ty , N e w Y o r k , a n d P i tts b u r g h ) E x p e c te d R a n g e T...

  2. Microsoft Word - winter.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    o i n t o f t h e i r h ig h a n d l o w p r i c e f o r a d a y . T h e d a t e s m a r k e d b y v e r t i c a l li n e s a r e t h e N Y M E X n e a r - m o n t h c o n t r a c...

  3. Microsoft Word - FORM46001.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDIVIDUAL ORGANIZATION LOCAL GOV'T INSTITUTION OF OTHER NONPROFIT C P SP OTHER (Specify) HIGHER EDUCATION ORGANIZATION 14. ACCOUNTING AND APPROPRIATIONS DATA: 15. EMPLOYER I.D. a. ...

  4. FinalProgramReportfinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... In 1992 the Department of Energy's (DOE) office of Occupational Medicine and Medical Surveillance provided support to formalize what had been an informal dosimetry recall program ...

  5. Microsoft Word - M008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... for exposure-based services (e.g., those of the American College of Occupational and Environmental Medicine), and examinations that are for specifically-defined legacy issues. ...

  6. Microsoft Word - datuminstr.doc

    Gasoline and Diesel Fuel Update (EIA)

    The web-based procedures (options 1 and 2) take about 10 minutes to apply and require that you have access to the internet. Determine which of the following options best suits your ...

  7. Microsoft Word - $ASQrpt78028.DOC

    Office of Scientific and Technical Information (OSTI)

    ... To date, the optimization of bioethanol production has involved considerable metabolic engineering, including the use of efficient alternate routes and enzymes from multiple and ...

  8. Microsoft Word - Test4.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    March contract, are not readily identified. Market fundamentals, excluding the week of cold weather in early March, remain generally constant: above normal average temperatures,...

  9. Microsoft Word - SAND2001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Don W. Lobitz Structural Dynamics Engineering Paul S. Veers Wind Energy Technology G. Richard Eisler Engineering and Manufacturing Software Sandia National Laboratories P.O.Box...

  10. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME RI ...

  11. DOE EIR FM.doc

    Office of Environmental Management (EM)

    ... For example, the CD-3 review for the Microsystems and Engineering Science Applications (MESA) project at Sandia National Laboratories conducted by Burns & Roe Enterprises in ...

  12. Microsoft Word - Chapter 07.doc

    National Nuclear Security Administration (NNSA)

    ... in the State of Nevada 7-8 7.8 Air Quality and Climate To reduce emissions from ... generated from the solar power projects proposed under all of the alternatives. ...

  13. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    ... Taken Total 133-213 163-346 131-181 216 Commercial Solar Power Generation Facilities 0-41 0-161 0-19 S.3.1.6 Air Quality Ambient air quality in Clark and Nye Counties would be ...

  14. Microsoft Word - Chapter 03.doc

    National Nuclear Security Administration (NNSA)

    ... 25 visible to viewers on U.S. Route 95. A Geothermal Power Project could alter the visual character and reduce visual quality if facilities are built along U.S. Route 95. ...

  15. Microsoft Word - questionaire.doc

    Gasoline and Diesel Fuel Update (EIA)

    ......... 19 Section E: WATER HEATING......A full bathroom is one that has a sink with running water, and a toilet, and either a ...

  16. Microsoft Word - S0150800.doc

    Office of Legacy Management (LM)

    Office of Legacy Management DOE MGJ881-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. ...

  17. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Preference: In merit reviewer selection, there should be no preference based on race, ethnic identity, gender, religion, region, age, or institutional affiliation. 3 Number of ...

  18. AcqGuide353.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Competition under the Energy Policy Act of 2005 References Public Law 109-58, Energy Policy Act of 2005 and FAR Part 35, Research and Development Contracting Overview This section discusses implementation of the competition requirements in Section 989 of the Energy Policy Act (EPAct) of 2005, Public Law 109-58. Background Section 989, Merit Review of Proposals, provides general provisions covering the award of funds for programs authorized by EPAct 05. Awards of funds for programs aut horized

  19. Microsoft Word - Kir.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in yellow merged with KirBac1.1 transmembrane region's backbone and surface in gray. The gate forming tip of the G- loop, amino acids 304-306, is highlighted in red....

  20. Microsoft Word - sharifgm-2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Media contact Susan Scott Public Affairs (505) 234-7204 w w w. wipp.energy.gov Washington TRU Solutions LLC Waste Isolation Pilot Plant P.O. Box 2078 Carlsbad, New Mexico 88221 For...