Powered by Deep Web Technologies
Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Guadeloupe: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Guadeloupe: Energy Resources Guadeloupe: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":16.25,"lon":-61.58333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

2

Enhanced Operation Strategies for Air-Conditioning and Lighting Systems Toward Peak Power Reduction for an Office Building in Kuwait  

E-Print Network [OSTI]

Enhanced?Operation?Strategies?for?Air? Conditioning?and?Lighting? Systems?Toward?Peak?Power?Reduction? for?an?Office?Building?in?Kuwait F. Alghimlas A. Al-Mulla G.P. Maheshwari D. Al-Nakib Building and Energy Technologies Department... Environment and Urban Development Division ICEBO 2012 Manchester, United Kingdom October 23-26, 2012 Electricity?Use?by?Sector?in?Kuwait Percentages?of?Primary?Energy?Utilization Percentages?of?Electricity?Utilization Yearly?Increase?in...

Alghimlas, F.; Al-Mulla, A.; Maheshwari, G.P.; Al-Nakib, D.

2012-01-01T23:59:59.000Z

3

Kuwait: World Oil Report 1991  

SciTech Connect (OSTI)

This paper reports that the major event in Kuwait today is the ongoing effort to control blowouts stemming from Iraqi demolition of oil wells and producing facilities last February. A total of 732 wells---about two- thirds of all wells in Kuwait---were blown up. All but 80 caught on fire.

Not Available

1991-08-01T23:59:59.000Z

4

Kuwait City, Kuwait: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Kuwait: Energy Resources Kuwait: Energy Resources Jump to: navigation, search Name Kuwait City, Kuwait Equivalent URI DBpedia GeoNames ID 285787 Coordinates 29.369722°, 47.978333° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.369722,"lon":47.978333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

5

Kuwait; The blowouts are history  

SciTech Connect (OSTI)

This paper reports on the capping of oil well blowouts in Kuwait. It reports on how access to the wells was gained, the well kill methods used, and future work that must be done in order to restore productivity.

Not Available

1992-01-01T23:59:59.000Z

6

The Iraq-Kuwait Conflict  

Science Journals Connector (OSTI)

The reasons for Iraqs invasion of Kuwait on 2 August ... the links between the immediate factors that caused Iraqs invasion, and the historical forces that ... Specifically, the chapter will trace (a) Iraqs pa...

2009-01-01T23:59:59.000Z

7

Water demand management in Kuwait  

E-Print Network [OSTI]

Kuwait is an arid country located in the Middle East, with limited access to water resources. Yet water demand per capita is much higher than in other countries in the world, estimated to be around 450 L/capita/day. There ...

Milutinovic, Milan, M. Eng. Massachusetts Institute of Technology

2006-01-01T23:59:59.000Z

8

How postcapping put Kuwait`s wells back onstream  

SciTech Connect (OSTI)

In late february 1991, the retreating Iraqi army blew up, or otherwise caused to blowout, some 700 wells in Kuwait. Between March and November, all of the fires were extinguished and the wells were capped. Work began in July 1991 to recomplete the damaged wells with replaced or reworked tubulars and well heads so that production could be resumed. Except for some of the earlier-capped wells into which cement was pumped, thus requiring more extensive downhole work, many of the damaged wells, particularly in Burgan field, were put back into production mode by the procedure described here, which became known as postcapping. This paper describes the equipment and techniques used in postcapping damaged wellheads.

Wilson, D. [ABB Vetco Gray Inc., Houston, TX (United States)

1994-01-01T23:59:59.000Z

9

Kuwait poised for massive well kill effort  

SciTech Connect (OSTI)

This paper reports that full scale efforts to extinguish Kuwait's oil well fires are to begin. The campaign to combat history's worst oil fires, originally expected to begin in mid-March, has been hamstrung by logistical problems, including delays in equipment deliveries caused by damage to Kuwait's infrastructure. Meantime, production from a key field off Kuwait--largely unaffected by the war--is expected to resume in May, but Kuwaiti oil exports will still be hindered by damaged onshore facilities. In addition, Kuwait is lining up equipment and personnel to restore production from its heavily damaged oil fields. Elsewhere in the Persian Gulf, Saudi Arabia reports progress in combating history's worst oil spills but acknowledges a continuing threat.

Not Available

1991-04-08T23:59:59.000Z

10

Arsenic in shrimp from Kuwait  

SciTech Connect (OSTI)

Arsenic is ubiquitous in the environment and can accumulate in food via contaminated soil, water or air. It enters the food chain through dry and wet atmospheric deposition. Combustion of oil and coal, use of arsenical fertilizers and pesticides and smelting of ores contributes significantly to the natural background of arsenic in soils and sediments. The metal can be transferred from soil to man through plants. In spite of variation in acute, subacute, and chronic toxic effects to plants and animals, evidence of nutritional essentiality of arsenic for rats, goats, and guinea pigs has been suggested, but has not been confirmed for humans. Adverse toxic effects of arsenic as well as its widespread distribution in the environment raises concern about levels of arsenic in man`s diet. Higher levels of arsenic in the diet can result in a higher accumulation rate. Arsenic levels in marine organisms are influenced by species differences, size of organism, and human activities. Bottom dwellers such as shrimp, crab, and lobster accumulate more arsenic than fish due to their frequent contact with bottom sediments. Shrimp constitute approximately 30% of mean total seafood consumption in Kuwait. This study was designed to determine the accumulation of arsenic in the commercially important jinga shrimp (Metapenaeus affinis) and grooved tiger prawn (Penaeus semisulcatus). 13 refs., 3 figs., 1 tab.

Bou-Olayan, A.H. [Kuwait Univ. (Kuwait); Al-Yakoob, S.; Al-Hossaini, M. [Kuwait Institute for Scientific Research (Kuwait)

1995-04-01T23:59:59.000Z

11

Kuwait Petroleum Corporation | Open Energy Information  

Open Energy Info (EERE)

Petroleum Corporation Petroleum Corporation Jump to: navigation, search Logo: Kuwait Petroleum Corporation Name Kuwait Petroleum Corporation Place Safat, Kuwait Zip 13126 Year founded 1980 Phone number (965) 1 85 85 85 Website http://www.kpc.com.kw/default. Coordinates 29.3715092°, 47.9734334° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.3715092,"lon":47.9734334,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

12

Kuwait summons more fire fighting teams  

SciTech Connect (OSTI)

Kuwait is calling in more muscle to help kill its wild wells. This paper reports on the latest action in Kuwait, the leasing of well control contracts to Abel Engineering/Well Control Inc., Houston, and China Petroleum Engineering Construction Co. (CPEC). Abel is the sixth North American well control company called to the scene, while CPEC is the first summoned from the East. In addition, the service responsible for combating well fires and blowouts in the U.S.S.R.'s Azerbaijan oil fields signed an agreement with Kuwait's government, apparently involving a contract valued at more than $100 million, to extinguish fires at 150 Kuwaiti wells, reported Eastern Bloc Energy, a publication of Eastern Bloc Research Ltd., Newton Kyme, U.K. More help likely is on the way.

Not Available

1991-08-05T23:59:59.000Z

13

Kuwait pressing toward preinvasion oil production capacity  

SciTech Connect (OSTI)

Oil field reconstruction is shifting focus in Kuwait as the country races toward prewar production capacity of 2 million b/d. Oil flow last month reached 1.7 million b/d, thanks largely to a massive workover program that has accomplished about as much as it can. By midyear, most of the 19 rigs in Kuwait will be drilling rather than working over wells vandalized by retreating Iraqi troops in February 1991. Seventeen gathering centers are at work, with capacities totaling 2.4 million b/d, according to state-owned Kuwait Oil Co. (KOC). This article describes current work, the production infrastructure, facilities strategy, oil recovery, well repairs, a horizontal pilot project, the drilling program, the constant reminders of war, and heightened tensions.

Tippee, B.

1993-03-15T23:59:59.000Z

14

Kuwait: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Kuwait: Energy Resources Kuwait: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.5,"lon":47.75,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

15

Minimizing casing corrosion in Kuwait oil fields  

SciTech Connect (OSTI)

Corrosion in production strings is a well known problem in Kuwait oil fields. Failure to remedy the affected wells results mainly in undesirable dump flooding of the oil reservoirs, or in oil seepage and hydrocarbon contamination in shallow water bearing strata. Any of these situations (unless properly handled) leads to a disastrous waste of oil resources. This study discusses casing leaks in Kuwait oil fields, the nature of the formations opposite the leaks and their contained fluids, and the field measures that can be adopted in order to avoid casing leak problems.

Agiza, M.N.; Awar, S.A.

1983-03-01T23:59:59.000Z

16

U.S. Energy Secretary Visits Kuwait | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Kuwait Kuwait U.S. Energy Secretary Visits Kuwait November 15, 2005 - 2:30pm Addthis Stop included meeting with U.S. business leaders and military troops KUWAIT CITY, KUWAIT - On Monday, November 14, 2005, U.S. Department of Energy Secretary Samuel W. Bodman toured the EQUATE petrochemical plant and met with U.S. business representatives while visiting Kuwait, as part of his trip through the Middle East. The EQUATE petrochemical plant is a joint venture between Kuwait's Petrochemical Industries Company (PIC) and U.S. company Union Carbide, a subsidiary of The Dow Chemical Company. "The EQUATE petrochemical plant is a wonderful example of international cooperation and investment. We are pleased that the joint venture between the Petrochemical Industries Company and Dow Chemical has been so

17

State of Kuwait Ministry of Oil | Open Energy Information  

Open Energy Info (EERE)

State of Kuwait Ministry of Oil State of Kuwait Ministry of Oil Jump to: navigation, search Logo: State of Kuwait Ministry of Oil Country Kuwait Name State of Kuwait Ministry of Oil City Kuwait City, Kuwait Website http://www.moo.gov.kw/ Coordinates 29.3697222°, 47.9783333° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.3697222,"lon":47.9783333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

18

Political Advertising in Kuwait A Functional Analysis  

E-Print Network [OSTI]

Political Advertising in Kuwait A Functional Analysis Jasem Alqaseer Abstract: Most political (Kaid, 2006). In general, political advertising studies focused on the content of political advertising especially on the subject of issues vs. images in advertising. In addition, many studies of political

Almor, Amit

19

Characterizing Surface Temperature and Clarity of Kuwait's Seawaters Using Remotely Sensed Measurements and GIS Analyses  

E-Print Network [OSTI]

Kuwait sea surface temperature (SST) and water clarity are important water characteristics that influence the entire Kuwait coastal ecosystem. The aim of this project was to study the spatial and temporal distributions of Kuwait SST using MODIS...

Alsahli, Mohammad M. M.

2009-11-30T23:59:59.000Z

20

Ecological disaster in Kuwait; A burning question  

SciTech Connect (OSTI)

Six million barrels of oil are going up in smoke each day in Kuwait, dumping 3.7 million pounds of toxic gases, soot, and smoke - including cancer-causing compounds - into the air each hour. This paper reports that the prognosis for the situation is dim. Even as specialized firefighting companies from the United States and Canada began arriving in Kuwait in March, oil officials there predicted dousing the fires would take at least two years and pumping up oil production to pre-war levels would take between five and 10 years. An oil well fire is a disaster. The effect on the ozone, the ecology, the marine life is massive. We aren't even breathing air here, we're just breathing smog.

Wray, T.K. (Waste Away Services, Perrysburg, OH (US))

1991-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Case histories of temperature surveys in Kuwait  

SciTech Connect (OSTI)

Most crude produced in Kuwait is from naturally flowing wells. Casing, tubing, and cement in these wells remain unchanged after completion. This study discusses the major application of temperature surveys in indicating fluid movement both inside and behind the production string, hence locating any holes in the casing. Some significant cases of temperature anomalies are examined qualitatively, and suggestions are made for a more quantitative interpretation of temperature profiles. 9 refs.

Gupta, B.S.

1981-12-01T23:59:59.000Z

22

Airborne Studies of the Smoke from the Kuwait Oil Fires  

Science Journals Connector (OSTI)

...smoke from the Kuwait fires produced a small-scale...Concluding Remarks The airborne studies of the smoke from the Kuwait fires provided a large...1. Uncontrolled releases of oil began in January...and the oil field fires began in late February...Zimmerman). 3. An airborne study of the smoke...

Peter V. Hobbs; Lawrence F. Radke

1992-05-15T23:59:59.000Z

23

An option pricing theory explanation of the invasion of Kuwait  

SciTech Connect (OSTI)

The objective of this paper is to explain the invasion of Kuwait by making an analogy between a call option and the Iraq-Kuwait situation before the invasion on August 2, 1990. A number of factors contributed to the issuance of a deep-in-the money European call option to Iraq against Kuwait. The underlying asset is the crude oil reserves under Kuwait. Price of crude oil is determined in world spot markets. The exercise price is equal to the cost of permanently annexing and retaining Kuwait. The volatility is measured by the annualized variance of the weekly rate of return of the spot price of crude oil. Time-to-expiration is equal to the time period between decision date and actual invasion date. Finally, since crude oil prices are quoted in U.S. dollars, the U.S. Treasury bill rate is assumed to be the risk-free rate. In a base-case scenario, Kuwait`s oil reserves amount to 94,500 million barrels valued at $18 a barrell in early February 1990 resulting in a market value of $1,701 billion. Because the cost of the war to Iraq is not known, we assume it is comparable to that of the U.S.-led coalition of $51.0 billion. Time-to-expiration is six months. The treasury bill rate in early 1990 was around 7.5 percent. Annualized standard deviation of weekly rates of return is 0.216. The value of Kuwait`s invasion option is $1,642.25 billion. Depending on the scenario, the value of this special option ranged between $1,450 billion and $3.624 billion. 10 refs., 1 tab.

Muhtaseb, M.R.

1995-12-31T23:59:59.000Z

24

Hydrogeological model of a high energy geothermal field (Bouillante area, Guadeloupe, French West Indies)  

E-Print Network [OSTI]

1 Hydrogeological model of a high energy geothermal field (Bouillante area, Guadeloupe, French West, France 3. BRGM, Department of Geothermal Energy 3, Av. Claude Guillemin - 45060 Orléans Cedex 2, France Abstract The Bouillante geothermal field presently provides about 8% of the annual electricity needs

Paris-Sud XI, Université de

25

Analysis of sustainable water supply options for Kuwait  

E-Print Network [OSTI]

This thesis considers several options for improving the sustainability of Kuwait's water supply system. The country currently relies heavily on desalination and brackish groundwater extraction. The options considered for ...

Murtaugh, Katharine A. (Katharine Ann)

2006-01-01T23:59:59.000Z

26

Physical properties of soils contaminated by oil lakes, Kuwait  

SciTech Connect (OSTI)

In preparation for a marine assault by the coalition forces, the Iraqi Army heavily mined Kuwait`s coastal zone and the oil fields. Over a million mines were placed on the Kuwait soil. Burning of 732 oil wells in the State of Kuwait due to the Iraqi invasion caused damages which had direct and indirect effect on environment. A total of 20-22 million barrels of spilled crude oil were collected in natural desert depressions and drainage network which formed more than 300 oil lakes. The total area covered with oil reached 49 km{sup 2}. More than 375 trenches revealed the existence of hard, massive caliche (CaCO{sub 3}) subsoil which prevent leached oil from reaching deeper horizons, and limited the maximum depth of penetration to 1.75 m. Total volume of soil contaminated reached 22,652,500 m{sup 3} is still causing environmental problems and needs an urgent cleaning and rehabilitation. Kuwait Oil Company has recovered approximately 21 million barrels from the oil lakes since the liberation of Kuwait. In our examined representative soil profiles the oil penetration was not deeper than 45 cm. Infiltration rate, soil permeability, grain size distribution, aggregates formation and water holding capacity were assessed. 15 refs., 5 figs., 5 tabs.

Mohammad, A.S. [Kuwait Univ., Safat (Kuwait); Wahba, S.A.; Al-Khatieb, S.O. [Arabian Gulf Univ. (Bahrain)

1996-08-01T23:59:59.000Z

27

Impact of Kuwait`s oil-fire smoke cloud on the sky of Bahrain  

SciTech Connect (OSTI)

The effects of the Kuwaiti oil well fires of 1991 on the atmospheric parameters of Bahrain (approximately 600 km southeast of Kuwait) were observed. Solar radiation, optical thickness, ultraviolet radiation, horizontal visibility, temperature, and solar spectral distribution were measured for 1991 and compared to the long-term values of 1985-1990. The relative monthly solar radiation in Bahrain was reduced by 8% (February) when 50 oil wells were burning and reduced further to 20% when 470 oil wells were on fire (April-July). In November 1991, when there were 12 oil wells burning, the recorded solar radiation became nearly equal to the long-term average. The monthly average daily optical thickness, {tau}, for the direct or beam solar radiation was calculated. The values of {tau} were found to be larger in 1991 than the average for the years 1985-1990 by nearly 58% during June and returned to normal in October (after nearly all the oil well fires were extinguished). The clear and smoked sky solar spectra distribution were detected before and during the burning of the Kuwait oil wells. Large absorption of the solar radiation was noticed on the 2nd and 3rd of March, 1991. The daily average infrared radiation during 1990 was found to be 6700.4 Whm{sup -2} and shifted to 9182.1 Whm{sup -2} in 1991. Comparison was also made between 1990 and 1991 data of the global solar radiation and the temperature. 13 refs., 12 figs., 1 tab.

Alnaser, W.E. [Univ. of Bahrain (Bahrain)] [Univ. of Bahrain (Bahrain)

1995-06-01T23:59:59.000Z

28

Ground level concentration of sulfur dioxide at Kuwait`s major population centers during the oil-field fires  

SciTech Connect (OSTI)

During the Iraqi occupation, Kuwait`s oil wells were ignited. the fires were damaging to the country`s oil resources and air quality. The impact of the oil-field fires on the air quality was studied to determine the level of exposure to pollutants in major population centers. The period of July-September 1991 was selected for examination. A mathematical model was used to compute the ground-level concentration isopleths. The results of these computations are supported by significant concentrations measured and reported by the Environmental Protection Council, Kuwait. The ground-level concentrations of sulfur dioxide in the major population centers, whether measure or estimated, were less than the ambient standards of the U.S. Environmental Protection Agency`s air pollution index. The dispersive characteristics were classified according to wind conditions. The results of this assessment provide historical data on Kuwait`s oil fires and may be useful in assessing risks resulting from this catastrophe. 6 refs., 10 fig., 2 tab.

Al-Ajmi, D.N.; Marmoush, Y.R. [Kuwait Institute for Scientific Research (Kuwait)] [Kuwait Institute for Scientific Research (Kuwait)

1996-08-01T23:59:59.000Z

29

EA-319 Fortis Energy Marketing & Trading GP | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Fortis Energy Marketing & Trading GP EA-319 Fortis Energy Marketing & Trading GP Order authorizing Fortis Energy Marketing & Trading GP to export electric energy to Canada EA-319...

30

Fate and control of blistering chemical warfare agents in Kuwait`s desalination industry  

SciTech Connect (OSTI)

Kuwait, as most of the other states located along the Western shores of the Arabian Gulf, relies upon the Gulf as its main drinking water resource via desalination. In case of seawater contamination with blistering chemical warfare agents, traces of the agents and/or degradation products in the finished water might pose a serious health hazard. The objective of the present review is to study the potential contamination, transport, fate, effect and control of blistering chemical warfare agents (CWAs), in the Kuwaiti desalination industry. In general, all the environmental factors involved in the aquatic degradation of CWAs in Kuwait marine environment except for the high salinity in case of blistering agents such as sulphur mustard, and in favor of a fast degradation process. In case of massive releases of CWAs near the Kuwaiti shorelines, turbulence resulting from tidal cycles and high temperature will affect the dissolution process and extend the toxicity of the insoluble agent. Post- and pre-chlorination during the course of seawater desalination will catalyze and significantly accelerate the hydrolysis processes of the CWAs. The heat exerted on CWAs during the power generation-desalination processes is not expected to thermally decompose them. However, the steam heat will augment the agent`s rate of hydrolysis with subsequent acceleration in their rate of detoxification. Conventional pretreatment of feed seawater for reverse-osmosis desalination is theoretically capable of reducing the concentration of CWAs by coprecipitation and adsorption on flocs formed during coagulation. Prechlorination and prolonged detention in time in pretreatment units will simultaneously promote hydrolysis reactions. 50 refs.

Khordagui, H.K. [United Nations Economic and Social Commission for West Asia, Amman (Jordan)

1997-01-01T23:59:59.000Z

31

MEW Efforts in Reducing Electricity and Water Consumption in Government and Private Sectors in Kuwait  

E-Print Network [OSTI]

of Engineers, membership No. 1715. MEW EFFORTS IN REDUCING ELECTRICITY AND WATER CONSUMPTION IN GOVERNMENT AND PRIVATE SECTORS IN KUWAIT Eng. Iqbal Al-Tayar Manager ? Technical Supervision Department Planning and Training Sector Ministry... of Electricity & Water (MEW) - Kuwait Historical Background - Electricity ? In 1913, the first electric machine was installed in Kuwait to operate 400 lambs for Al-Saif Palace. ? In 1934, two electric generators were installed with a total capacity of 60 k...

Al-Tayar, I.

2011-01-01T23:59:59.000Z

32

Origin and diagenesis of lignin and carbohydrates in mangrove sediments of Guadeloupe (French West Indies): Evidence for a  

E-Print Network [OSTI]

Origin and diagenesis of lignin and carbohydrates in mangrove sediments of Guadeloupe (French West the molecular composition (carbohydrates and lignin-derived phenols) of these organic deposits in relationship synthesized by bacteria. On the other hand, lignin phenols were lost rather slowly, i.e. at a similar or lower

Paris-Sud XI, Université de

33

Reply to comment on "Electrical Tomography of La Soufrire of Guadeloupe Volcano: Field experiments, 1D inversion and  

E-Print Network [OSTI]

Discussion Reply to comment on "Electrical Tomography of La Soufrière of Guadeloupe Volcano: Field.25.Qi; 91.35.Pn; 91.40.-k; 93.30.Vs 1. Introduction We thank Linde and Revil for their comment [1 and discuss our approach for interpreting electrical resistivity data acquired over complex geological

Beauducel, François

34

E-Print Network 3.0 - algeria iraq kuwait Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya Source: Capecchi, Mario R. - Department of Biology, University...

35

The crisis in Kuwait and U. S. refiners' travail  

SciTech Connect (OSTI)

The August 2, 1990, invasion of Kuwait on the part of Iraq has set in motion an accelerated domino affect in US fuels markets. The impact on US refiners has been generally negative, both in terms of margins and perceptions of same. This issue of Energy Detente (ED) updates a few directional indicators that affect refining margins and considers longer-term refining capacity requirements in the US. ED feels the invasion of Kuwait might force oil companies to allocate more talent, time, and financial resources to public affairs. This issue also contains the following: (1) The ED Refining Netback Data Series for the US Gulf and West Coasts, Rotterdam, and Singapore as of Aug. 24, 1990; and (2) the ED Fuel Price/Tax Series for countries of the Eastern Hemisphere Aug. 1990 edition. 4 figs., 5 tabs.

Not Available

1990-08-31T23:59:59.000Z

36

EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy...  

Broader source: Energy.gov (indexed) [DOE]

-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) Order authorizing Fortis...

37

Trace gas measurements in the Kuwait oil fire smoke plume  

SciTech Connect (OSTI)

The authors report trace gas measurements made both inside and outside the Kuwait oil-fire smoke plume during a flight of an instrumented research aircraft on May 30, 1991. Concentrations of SO{sub 2}, CO, and NO{sub x} averaged vertically and horizontally throughout the plume 80 km downwind of Kuwait City were 106, 127, and 9.1 parts per billion by volume (ppbv), respectively, above background concentrations. With the exception of SO{sub 2}, trace gas concentrations were far below typical US urban levels and primary national ambient air quality standards. Ambient ozone was titrated by NO in the dark, dense core of the smoke plume close to the fires, and photochemical ozone production was limited to the diffuse edge of the plume. Photochemical O{sub 3} production was noted throughout the plume at a distance of 160 km downwind of Kuwait City, and averaged 2.3 ppbv per hour during the first 3 hours of transport. Little additional photochemical production was noted at a downwind range of 340 km. The fluxes of sulfur dioxide, carbon monoxide, and reactive nitrogen from the roughly 520 fires still burning on May 30, 1991 are estimated at 1.4 x 10{sup 7} kg SO{sub 2}/d, 6.9 x 10{sup 6} kg CO/d, and 2.7 x 10{sup 5} kg N/d, respectively. Generally low concentrations of CO and NO{sub x} indicate that the combustion was efficient and occurred at low temperatures. Low total nonmethane hydrocarbon concentrations suggest that the volatile components of the petroleum were burned efficiently. 37 refs., 4 figs., 4 tabs.

Luke, W.T.; Kok, G.L.; Schillawski, R.D.; Zimmerman, P.R.; Greenberg, J.P.; Kadavanich, M. [National Center for Atmospheric Research, Boulder, CO (United States)

1992-09-20T23:59:59.000Z

38

Effect of oil pollution on fresh groundwater in Kuwait  

SciTech Connect (OSTI)

Massive oil fires in Kuwait were the aftermath of the Gulf War. This resulted in the pollution of air, water, and soil, the magnitude of which is unparalleled in the history of mankind. Oil fires damaged several oil well heads, resulting in the flow of oil, forming large oil lakes. Products of combustion from oil well fires deposited over large areas. Infiltrating rainwater, leaching out contaminants from oil lakes and products of combustion at ground surface, can reach the water table and contaminate the groundwater. Field investigations, supported by laboratory studies and mathematical models, show that infiltration of oil from oil lakes will be limited to a depth of about 2 m from ground surface. Preliminary mathematical models showed that contaminated rainwater can infiltrate and reach the water table within a period of three to four days, particularly at the Raudhatain and Umm Al-Aish regions. These are the only regions in Kuwait where fresh groundwater exists. After reaching the water table, the lateral movement of contaminants is expected to be very slow under prevailing hydraulic gradients. Groundwater monitoring at the above regions during 1992 showed minor levels of vanadium, nickel, and total hydrocarbons at certain wells. Since average annual rainfall in the region is only 120 mm/yr, groundwater contamination due to the infiltration of contaminated rainwater is expected to be a long-term one. 13 refs., 15 figs., 2 tabs.

Al-Sulaimi, J.; Viswanathan, M.N.; Szekely, F. [Kuwait Institute for Scientific Research, Safat (Kuwait)

1993-11-01T23:59:59.000Z

39

Chemical and physical properties of emissions from Kuwait oil fires  

SciTech Connect (OSTI)

After the Iraqi retreat from Kuwait in 1991, airborne sampling was conducted in the oil fire plumes near Kuwait City and ground-level samples were taken of the air within the city. For the airborne sampling, a versatile air pollution sampler was used to determine the SO(2), elemental concentrations, the aerosol mass loadings and SO4(2-) and NO3(1-) concentrations. Striking differences between the black and white plumes were associated with high concentrations of NaCl and CaCl(2) measured in the white plumes and large numbers of carbon chain agglomerates in the black plumes. For the ground-based measurements, an annular denuder system was used to determine levels of SO(2), SO4(2-), trace elements, and mass loadings. Certain pollutant levels rose in the city during inversion conditions, when winds were too weak to continue moving the combustion products directly to the Persian Gulf, and the increased levels of Pb and certain trace elements were comparable to those in other large urban areas in Europe.

Stevens, R.; Pinto, J.; Mamane, Y.; Ondov, J.; Abdulraheem, M.

1992-01-01T23:59:59.000Z

40

New results on GP Com  

E-Print Network [OSTI]

We present high resolution optical and UV spectra of the 46 min orbital period, helium binary, GP Com. Our data contains simultaneous photometric correction which confirms the flaring behaviour observed in previous optical and UV data. In this system all lines show a triple peaked structure where the outer two peaks are associated with the accretion disc around the compact object. The main aim of this paper is to constrain the origin of the central peak, also called ``central spike''. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is ~10 km/s indicating that its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. Our resolution is higher than that of previous data which allows us to resolve structure in the central peak of the line. The central spike in three of the HeI lines shows another peak blueshifted with respect to the main peak. We propose that one of the peaks is a neutral helium forbidden transition excited in a high electron density region. This forbidden transition is associated with the permitted one (the stronger peak in two of the lines). The presence of a high electron density region again favours the white dwarf as their origin.

L. Morales-Rueda; T. R. Marsh; D. Steeghs; E. Unda-Sanzana; Janet H. Wood; R. C. North

2003-04-14T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Social and Economic Challenges of Implementing Sustainable Materials on Buildings in Kuwait  

E-Print Network [OSTI]

electrical load reached in 2012 was 11,850MW and according to 2011 statistics each person in Kuwait consumes 600L of water a day. By implementing LEED we hope these figures will significantly decrease. There will be economic benefits from an obvious... for the materials and resources credit for an existing building in Kuwait will be highlighted LEED EB O&M Points Scale Building Owners and Decision Makers in Kuwait have to Understand the Benefits of Implementing LEED A green building will reduce the negative...

Al-Foraih, R.; Al-Fahad, F.

2012-01-01T23:59:59.000Z

42

Implementation of Simple Measures for Savings Water and Energy Consumption in Kuwait Government Buildings  

E-Print Network [OSTI]

This paper gives in details the efforts made by the Public Services Department (PSD) to reduce water and energy consumptions in the Ministry of Social Affairs and Labour's (MOSAL) buildings in Kuwait. PSD manages around 125 buildings distributed...

Albaharani, H.; Al-Mulla, A.

2012-01-01T23:59:59.000Z

43

International project finance : the case of Kuwait Fund for Arab Economic Development  

E-Print Network [OSTI]

This thesis examines the record of the Kuwait Fund for Arab Economic Development (KFAED) in light of changing fashions regarding the proper role and management of such funds in the development finance process. The key ...

Al-Jassar, Sulaiman Ahmed

2005-01-01T23:59:59.000Z

44

Offshore sedimentary facies of a modern carbonate ramp, Kuwait, northwestern Arabian-Persian Gulf  

Science Journals Connector (OSTI)

The Kuwait example studied here may serve as a model for ancient carbonate ramp systems just as the classicalbut markedly differentsouthern Arabian-Persian Gulf ramp of the Trucial Coast (United Arab...

Eberhard Gischler; Anthony J. Lomando

2005-04-01T23:59:59.000Z

45

Ozone chemistry in the smoke from the Kuwait oil fires  

SciTech Connect (OSTI)

Ozone depletion occurred in the core of the plume of smoke from the Kuwait oil fires within 100 km of the fires, primarily in regions where NO{sub x} concentrations were high and ultraviolet flux was near zero. Rapid conversion of NO to NO{sub 2} can explain almost all of the ozone loss. Ozone was produced in diffuse regions of the plume, where the ultraviolet flux was higher than in the core. However, due to the relatively high ratio of nonmethane hydrocarbons to NO{sub x}, ozone production was slow. Since ozone was produced in a much larger volume than it was depleted, the plume as a whole was a source of ozone on a regional scale. 27 refs., 4 figs., 1 tab.

Herring, J.A.; Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)

1992-09-20T23:59:59.000Z

46

Studies of the Kuwait oil fire plume during midsummer 1991  

SciTech Connect (OSTI)

This paper reports aircraft observations of the Kuwait oil fire plume conducted during the period July 31-August 17, 1991. During this study the plume was transported almost exclusively to the south of Kuwait over the Persian Gulf and the Arabian Peninsula. The plume base was generally found to be well above the surface, in some cases as high as 1-2 km; plume tops did not exceed 5 km. Aerosol mass (based on measured aerosol constituents) in the central section of the plume, ca. 150-200 km downwind of the source region, was found to be >500 {mu}g/m{sup 3}, with number densities in the size range (approximate) 0.2 < d < 3 {mu}m (where d is diameter) as high as 30,000/cm{sup 3}. The aerosol was composed of (in order of approximate contribution to mass) inorganic salts, elemental carbon, and organic carbon. Sodium chloride constituted a surprisingly large component of the soluble inorganic mass. The aerosol particles appeared to function as good cloud condensation nuclei, with a large fraction of accumulation mode particles (by number) activated at a supersaturation of 0.6%. Under conditions in which the plume was relatively compact, transmittance of solar radiation to the surface was only 10-20%. Plume albedo was observed to be as low as 2-3% close to the source region, consistent with the high elemental-carbon concentrations present in the plume. Trace gas concentrations were consistent with fuel composition and with current knowledge of atmospheric chemical processes. Sulfur dioxide concentrations close to the source region were found to be as high as 300-400 ppb. The emissions factor for S (expressed as a percentage) was estimated to be 1.8%, which is consistent with estimates of a fuel sulfur content of 2-2.5%. SO{sub 2} was found to be only slowly oxidized (<1%/h). Nitrogen oxide concentrations were found to be quite low (<50 ppb near the source, decreasing to 1-2 ppb well downwind), which is consistent with a crude oil nitrogen source. 32 refs., 15 figs., 7 tabs.

Daum, P.H.; Al-Sunaid, A.; Busness, K.M.; Hales, J.M.; Mazurek, M. [Brookhaven National Lab., Upton, NY (United States)

1993-09-20T23:59:59.000Z

47

Chemical composition of emissions from the Kuwait oil fires  

SciTech Connect (OSTI)

Airborne measurements in the smoke from the Kuwait oil fires in May and June 1991 indicate that the combined oil and gas emissions were equivalent to the consumption of about 4.6 million barrels of oil per day. The combustion was relatively efficient, with about 96% of the fuel carbon burned emitted as CO{sub 2}. Particulate smoke emissions averaged 2% of the fuel burned, of which about 20% was soot. About two-thirds of the mass of the smoke was accounted for by salt, soot, and sulfate. The salt most likely originated from oil field brines, which were ejected from the wells along with the oil. The salt accounts for the fact that many of the plumes were white. SO{sub 2} and NO{sub x} were removed from the smoke at rates of about 6 and 22% per hour, respectively. The high salt and sulfate contents explain why a large fraction of the particles in the smoke were efficient cloud condensation nuclei. 14 refs., 3 figs., 1 tab.

Ferek, R.J.; Hobbs, P.V.; Herring, J.A. [Univ. of Washington, Seattle, WA (United States); Laursen, K.K. [National Center for Atmospheric Research, Boulder, CO (United States); Weiss, R.E. [Oregon Graduate Institute of Science and Technology, Beaverton, OR (United States); Rasmussen, R.A. [Radiance Research, Inc., Seattle, WA (United States)

1992-09-20T23:59:59.000Z

48

Taking stock of Saddam's fiery legacy in Kuwait  

SciTech Connect (OSTI)

Six months after Saddam Hussein's torching of more than 700 Kuwaiti oil wells, health officials, meteorologists, and environmental experts convened during mid-August in Cambridge, Massachusetts, to assess the impact of the fires. The soot cloud produced by the fires hasn't produced a nuclear winter, nor are the carbon dioxide and other gases released going to have an appreciable effect on global warming, although regional weather changes are possible. So far adverse health effects from the heavy pall of pollution caused by the fires have been surprisingly mild. This isn't to say that premature deaths will not occur, but many scientists had feared much worse. Nevertheless, all researchers concede that the data for this particular conclusion are still preliminary, and they expressed concerns that health problems may worsen in the coming months. Most of the health effects are expected in a region blanketed by a plume of smoke 800 to 1,000 kilometers long. The average concentrations of the primary pollutants it contains, carbon-based particles and sulfur dioxide, are similar to those in any large urban center. Still, the oil fires increase the pollution burden on Kuwait, which already had a problem with particulates in the air, and some epidemiologists expect that the extra pollutants will take their toll.

Hoffman, M.

1991-08-30T23:59:59.000Z

49

Optical extinction of smoke from the Kuwait oil fires  

SciTech Connect (OSTI)

Aircraft-based measurements of optical extinction, optical scattering, and particle mass concentrations were obtained in the smoke from the Kuwait oil fires during May and June 1991. These measurements were used to derive optical absorption, single-scattering albedo ({anti {omega}}), specific absorption and the amount of soot in the smoke. Measurements were made in smoke from individual oil wells, pool fires and in composite smoke plumes. The value of {anti {omega}} for smoke from the individual fires was either 0.35-0.4 (for the black smoke) or 0.85-0.95 (for the white smoke). For the aged composite plume from all of the fires, {anti {omega}} ranged from 0.52 to 0.6. The specific absorption of the composite smoke varied from about 2 m{sup 2} g{sup {minus}1} near the fires to about 1.5 m{sup 2} g{sup {minus}1} well downwind. 8 refs., 2 figs., 1 tab.

Weiss, R.E. [Radiance Research, Inc., Seattle, WA (United States); Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)

1992-09-20T23:59:59.000Z

50

Greater Burgan of Kuwait: world's second largest oil field  

SciTech Connect (OSTI)

Greater Burgan (Main burgan, Magwa, and Ahmadi) field is located in the Arabian Platform geologic province and the stable shelf tectonic environment of the Mesopotamian geosyncline, a sedimentary basin extending from the Arabian shield on the west to the complexly folded and faulted Zagros Mountains on the east. The structural development in Cretaceous time represents a major anticlinorium bounded by a basin to the west and a synclinorium to the east. Greater Burgan is located within this anticlinorium. The field consists of three dome structures 25 km wide and 65 km long with gentle dips of only few degrees. Faults have little throw and did not contribute to the trapping mechanism. The structural deformation may have been caused by halokinetic movements and most likely by basement block faulting that may have started in the Paleozoic. Greater Burgan was discovered in 1938. All production during the last 40 years has been by its natural pressure. Although natural gas injection has been carried out for some time, no waterflooding has been initiated yet. Recoverable reserves of the field are 87 billion bbl of oil. During the last 5 years giant reserves have been added in this field from the deeper strata of Jurassic age. Several deep wells have been drilled to the Permian for the purpose of discovering gas. So far, no Permian gas has been found in Kuwait. The Permian is 25,000 ft deep, and it is unlikely gas will be found there in the future. However, the potential of the Jurassic reservoirs will be a major target in the future. Also, there is a great possibility of discovering oil in stratigraphic traps, as several producing strata in the nearby fields pinch out on the flanks of this giant structure. Enhanced oil recovery should add significant reserves in the future.

Youash, Y.Y.

1989-03-01T23:59:59.000Z

51

Change in regime and transfer function models of global solar radiation in Kuwait  

Science Journals Connector (OSTI)

The development of the models for global solar radiation in Kuwait is based on removing the annual periodicity and seasonal variation. The first methodology used here is the change in regime technique that relies on dividing the observations into two ... Keywords: ARMA model, Harmonic analysis, Solar radiation, Transfer function

S. A. Al-Awadhi

2005-09-01T23:59:59.000Z

52

NNSA Signs Memorandum with Kuwait to Increase Cooperation on Nuclear Safeguards and Nonproliferation  

ScienceCinema (OSTI)

On June 23, 2010, the National Nuclear Security Administration (NNSA) signed a Memorandum of Cooperation on nuclear safeguards and other nonproliferation topics with the Kuwait National Nuclear Energy Committee (KNNEC). NNSA Administrator Thomas D'Agostino and KNNEC's Secretary General, Dr. Ahmad Bishara, signed the memorandum at a ceremony at U.S. Department of Energy headquarters in Washington.

Thomas D'Agostino

2010-09-01T23:59:59.000Z

53

NNSA Signs Memorandum with Kuwait to Increase Cooperation on Nuclear Safeguards and Nonproliferation  

SciTech Connect (OSTI)

On June 23, 2010, the National Nuclear Security Administration (NNSA) signed a Memorandum of Cooperation on nuclear safeguards and other nonproliferation topics with the Kuwait National Nuclear Energy Committee (KNNEC). NNSA Administrator Thomas D'Agostino and KNNEC's Secretary General, Dr. Ahmad Bishara, signed the memorandum at a ceremony at U.S. Department of Energy headquarters in Washington.

Thomas D'Agostino

2010-06-23T23:59:59.000Z

54

Kinematics of the helium accretor GP Com  

E-Print Network [OSTI]

We present time-resolved spectra of the double-degenerate binary star, GP Com. The spectra confirm the presence and period (46.5 min) of the `S'-wave feature found by Nather, Robinson and Stover. GP Com is erratically variable at X-ray and UV wavelengths. We have found the equivalent variability in our data, which, as also seen in UV data, is mostly confined to the emission lines. The HeII 4686 changes by the largest amount, consistent with X-ray driven photo-ionisation. The flaring part of the line profiles is broader than the average, as expected if they are dominated by the inner disc. The HeII 4686 profile is especially remarkable in that its blue-shifted peak is 1400 km/s from line centre compared to 700 km/s for the HeI lines (the red-shifted peak is blended with HeI 4713). We deduce that HeII 4686 emission is confined to the inner 1/4 of the disc. We suggest that the activity of the inner disc indicates that accretion is significant (and unstable) there, in contrast to quiescent dwarf novae, in support of models in which GP Com is in a (quasi-)steady-state of low mass transfer rate. GP Com shows triple-peaked lines profiles which consist of the usual double-peaked profiles from a disc plus a narrow component at line centre. We find evidence for both radial velocity and flux variability in this component, inconsistent with a nebula origin. The radial velocity amplitude and its phase relative to the `S'-wave are consistent with an origin on the accreting white dwarf, if the mass ratio, q = M2/M1, is of order 0.02, as expected on evolutionary grounds. However this explanation is still not satisfactory as the systemic velocity of the narrow component shows significant variation from line to line, and we have no explanation for this.

T. R. Marsh

1998-12-23T23:59:59.000Z

55

An examination of the perceived need and recommended body of knowledge for architectural internship programs in Kuwait  

E-Print Network [OSTI]

This study stresses and reflects a professional concern for the state of architecture in Kuwait, with a specific emphasis on the development of competence of architectural students and recent graduates on professional knowledge areas...

Abdullah, Mohammad

2007-09-17T23:59:59.000Z

56

Sustainable water resources development in Kuwait : an integrated approach with comparative analysis of the case of Singapore  

E-Print Network [OSTI]

This thesis assesses the water resource status of Kuwait and Singapore, both countries considered as water scarce. The institutional aspect of Integrated Water Resource Management (IWRM) efforts in both countries is closely ...

Nazerali, Nasruddin A

2007-01-01T23:59:59.000Z

57

MB GP IN MODELLING AND PREDICTION Carlos Oliver-Morales  

E-Print Network [OSTI]

. Universitaria O4510 Mexico City, MEXICO Abstract. The paper describes a hybrid approach for dynamic system), relative humidity (H), solar radiation (R) and wind speed (V) and direction (D) were recorded. The time system modelling and prediction was presented. This MB-GP approach has used small values of GP parameters

Fernandez, Thomas

58

Markov Models for GP and Variablelength GAs with Homologous Crossover  

E-Print Network [OSTI]

Markov Models for GP and Variable­length GAs with Homologous Crossover Riccardo Poli School Abstract In this paper we present a Markov model for GP and variable­length GAs with homolo­ gous crossover from the parents. We obtain this result by using the core of Vose's model for GAs in conjunction

Fernandez, Thomas

59

Mapping the peculiar binary GP Com  

E-Print Network [OSTI]

We present high resolution spectra of the AM CVn helium binary GP Com at two different wavelength ranges. The spectra show the same flaring behaviour observed in previous UV and optical data. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is \\~10 km/s which indicates its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. The Stark effect seems to affect significantly the central spike of some of the lines suggesting that it forms in a high electron density region. This again favours the idea that the central spike originates in the white dwarf. We present Doppler maps obtained for the emission lines which show three clear emission regions.

L. Morales-Rueda; T. R. Marsh; R. C. North

2000-08-29T23:59:59.000Z

60

Emission factors for particles, elemental carbon, and trace gases from the Kuwait oil fires  

SciTech Connect (OSTI)

Emission factors are presented for particles, elemental carbon (i.e., soot), total organic carbon in particles and vapor, and for various trace gases from the 1991 Kuwait oil fires. Particle emissions accounted for {approximately} 2% of the fuel burned. In general, soot emission factors were substantially lower than those used in recent {open_quotes}nuclear winter{close_quotes} calculations. Differences in the emissions and appearances of some of the individual fires are discussed. Carbon budget data for the composite plumes from the Kuwait fires are summarized; most of the burned carbon in the plumes was in the form of CO{sub 2}. Fluxes are presented for several combustion products. 26 refs., 1 fig., 5 tabs.

Laursen, K.K.; Ferek, R.J.; Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States); Rasmussen, R.A. [Oregon Graduate Institute of Science and Technology, Beaverton, OR (United States)

1992-09-20T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Assessment of damage to the desert surfaces of Kuwait due to the Gulf War  

SciTech Connect (OSTI)

This is a preliminary report on a joint research project by Boston University and the Kuwait Institute for Scientific Research that commenced in April 1992. The project aim is to establish the extent and nature of environmental damage to the desert surface and coastal zone of Kuwait due to the Gulf War and its aftermath. Change detection image enhancement techniques were employed to enhance environmental change by comparison of Landsat Thematic Mapper images obtained before the wars and after the cessation of the oil and well fires. Higher resolution SPOT images were also utilized to evaluate the nature of the environmental damage to specific areas. The most prominent changes were due to: (1) the deposition of oil and course-grained soot on the desert surface as a result of oil rain'' from the plume that emanated from the oil well fires; (2) the formation of hundreds of oil lakes, from oil seepage at the damaged oil well heads; (3) the mobilization of sand and dust and (4) the pollution of segments of the coastal zone by the deposition of oil from several oil spills. Interpretation of satellite image data are checked in the field to confirm the observations, and to assess the nature of the damage. Final results will be utilized in establishing the needs for remedial action to counteract the harmful effects of the various types of damage to the environment of Kuwait.

El-Baz, F. (Boston Univ., MA (United States). Center for Remote Sensing); Al-Ajmi, D. (Kuwait Inst. for Scientific Research (Kuwait). Environmental and Earth Sciences Div.)

1993-01-01T23:59:59.000Z

62

Measurement of polynuclear aromatic hydrocarbon concentrations in the plume of Kuwait oil well fires  

SciTech Connect (OSTI)

Following their retreat from Kuwait during February and March of 1991, the Iraqi Army set fire to over 500 oil wells dispersed throughout the Kuwait oil fields. During the period of sampling from July to August 1991, it was estimated that between 3.29 {times} 10{sup 6} barrels per day of crude oil were combusted. The resulting fires produced several plumes of black and white smoke that coalesced to form a composite ``super`` plume. Because these fires were uncontrolled, significant quantities of organic materials were dispersed into the atmosphere and drifted throughout the Middle East. The organic particulants associated with the plume of the oil well fires had a potential to be rich in polynuclear aromatic hydrocarbon (PAH) compounds. Based on the extreme mutagenic and carcinogenic activities of PAHs found in laboratory testing, a serious health threat to the population of that region potentially existed. Furthermore, the Kuwait oil fire plumes represented a unique opportunity to study the atmospheric chemistry associated with PAHs in the plume. If samples were collected near the plume source and from the plume many kilometers downwind from the source, comparisons could be made to better understand atmospheric reactions associated with particle-bound and gas-phase PAHs. To help answer health-related concerns and to better understand the fate and transport of PAHs in an atmospheric environment, a sampling and analysis program was developed.

Olsen, K.B.; Wright, C.W.; Veverka, C. [Pacific Northwest Lab., Richland, WA (United States); Ball, J.C. [Ford Motor Co., Dearborn, MI (United States). Scientific Research Lab.; Stevens, R. [US Environmental Protection Agency (United States). Atmospheric Research and Exposure Assessment Lab.

1995-03-01T23:59:59.000Z

63

Radiative effects of the smoke clouds from the Kuwait oil fires  

SciTech Connect (OSTI)

The radiative effects of the smoke from the Kuwait oil fires were assessed by measuring downwelling and upwelling solar flux, as well as spectral solar extinction beneath, above, and within the smoke plume. Seven radiation flight missions were undertaken between May 16 and June 2, 1991, to characterize the plume between the source region in Kuwait and approximately 200 km south, near Manama, Bahrain. The authors present results from one flight representative of conditions of the composite plume. On May 18, 1991, in a homogeneous, well-mixed region of smoke approximately 100 km downstream of the fires, visible optical depths as high as 2 were measured, at which time transmission to the surface was 8%, while 78% of the solar radiation was absorbed by the smoke. The calculated instantaneous heating rate inside the plume reached 24 K/d. While these effects are probably typical of those regions in the Persian Gulf area directly covered by the smoke, there is no evidence to suggest significant climatic effects in other regions. 13 refs., 3 figs., 1 tab.

Pilewskie, P.; Valero, F.P.J. [NASA/Ames Research Center, Moffett Field, CA (United States)

1992-09-20T23:59:59.000Z

64

Geological model of the Jurassic section in the State of Kuwait  

SciTech Connect (OSTI)

Until the end of the seventies, the knowledge of Jurassic Geology in the State of Kuwait was very limited, since only one deep well was drilled and bottomed in the Triassic sediments. Few scattered wells partially penetrated the Jurassic sequence. During the eighties, appreciable number of wells were drilled through the Jurassic, and added a remarkable volume of information. consequently it was necessary to analyze the new data, in order to try to construct a geological model for the Jurassic in the State of Kuwait. This paper includes a number of isopach maps explaining the Jurassic depositional basin which also helps in trying to explain the Jurassic basin in the Arabian Gulf basin. Structural evolution of the Jurassic sequence indicated an inversion of relief when compared with the Cretaceous sequence. In fact, the main Cretaceous arches were sites of sedimentation troughs during the Jurassic period. This fact marks a revolution in the concepts for the Jurassic oil exploration. One of the very effective methods of the definition of the Jurassic structures is the isopaching of the Gotnia Formation. Najmah, Sargelu and Marrat Formations include the main Jurassic reservoirs which were detected as a result of the exploration activities during the eighties. Selective stratigraphic and structural cross sections have been prepared to demonstrate and explain the nature of the Jurassic sediments.

Yousif, S.; Nouman, G.

1995-11-01T23:59:59.000Z

65

The role of the charged residues of the GP2 helical regions in Ebola entry  

Science Journals Connector (OSTI)

The glycoprotein (GP) of Ebola is the sole structural protein that forms ... , the full length of GP gene of Ebola Zaire species, 2028 base pairs in length ... safe approach to dissecting the entry mechanism of Ebola

Haiqing Jiang; Jizhen Wang; Balaji Manicassamy

2009-04-01T23:59:59.000Z

66

Chain-aggregate aerosols in smoke from the Kuwait oil fires  

SciTech Connect (OSTI)

Electrooptical scattering was used to detect aggregated particle chains in the smoke from the Kuwait oil fires. Nonsphericity was detected by the change in light scattering brought about by induced alignment of particles when subjected to a pulsed, bipolar electric field. Measured parameters included the steady state enhancement of light scattering for complete orientation of the particles, and the rotational diffusion constant, calculated from the time required for the particles to relax to a random orientation after the electric field was removed. Chain aggregates of soot formed within seconds of combustion for those fires producing black smoke. These aggregates agglomerated to some extent in the smoke near the fires, but then remained relatively unchanged for several hours of travel downwind. Very little nonsphericity was detected for particles in the plume of white smoke, which consisted primarily of salt brine products emitted along with the oil. 10 refs., 4 figs., 1 tab.

Weiss, R.E. [Radiance Research, Inc., Seattle, WA (United States); Kapustin, V.N. [Institute of Atmospheric Physics, Moscow (Russian Federation); Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)

1992-09-20T23:59:59.000Z

67

An approach to predict tarmat breakdown in Minagish Reservoir in Kuwait  

SciTech Connect (OSTI)

Minagish Oolite reservoir, Minagish Field in Kuwait is characterized by tarmat presence at the oil-water contact. A water flooding project is planned for the reservoir. This paper discusses the possibility of tarmat break-down upon water injection below it. It was found that differential pressure at tarmat would be mainly due to water injection and that differential pressure due to oil production would be negligible. This paper suggests a technique to predict tarmat break-down time, response time at the nearest producer or observation well and the time at which water injection should be switched from below tarmat to above it. Also, the technique could be used to predict the differential pressure at tarmat anywhere in the reservoir.

Osman, M.E.

1983-03-01T23:59:59.000Z

68

Multicriteria decision making in electricity demand management: the case of Kuwait  

Science Journals Connector (OSTI)

Electricity demand in Kuwait has substantially increased over the years and this increase is attributed to population growth, increase in the number of buildings, and the extensive use of air-conditioning system during the very hot weather in the summer. The amount of electrical energy generated reached 48 444 308 megawatt hour (MWH) in 2007. Such growth calls for extensive investment in the continuous expansion of the existing power plants and constructing new ones. To rationalise the consumption of electricity, several conservation policies have to be implemented. In this work, we have attempted to diagnose such problem and solicit expert opinions in order to provide the proper remedies. Because the problem comprises several criteria that are subjective in nature, multicriteria decision-making approaches were suggested. The Analytical Hierarchy Process (AHP) was used as a decision tool to assess the different policies that could be used to bring about electricity conservation.

Mohammed Hajeeh

2010-01-01T23:59:59.000Z

69

Event:LEDS GP Event at Bonn | Open Energy Information  

Open Energy Info (EERE)

Bonn Bonn Jump to: navigation, search Calendar.png LEDS GP Event at Bonn: 17:00 - 19:15pm on 2012/05/23 This event will be co-hosted by the International Partnership on Mitigation and MRV (http://www.mitigationpartnership.net/) and the LEDS Global Partnership (http://openei.org/wiki/LEDSGP). The event titled Catalyzing Cooperative Action for Low Emissions Development will take place on May 23, 2012 from 17:00-19:15 at the BMU Headquarters in Bonn and will be followed by a reception from 19:15-20:30. The purpose of the event is to share information and learning related to current activities, to discuss and receive feedback on these activities, and to explore opportunities for linking with related initiatives. Event Details Name LEDS GP Event at Bonn Date 2012/05/23

70

Contribution of power and desalination plants to the levels of volatile liquid hydrocarbons in the nearby coastal areas of Kuwait  

SciTech Connect (OSTI)

The levels and distribution of volatile liquid hydrocarbons (VLHs) were determined in Kuwait`s coastal areas in the vicinity of outlets of power and desalination plants. About 230 samples were collected from the selected sampling locations over the 4 seasons. The VLHs in the samples were analyzed using Grob`s closed-loop stripping technique and GC with FID and confirmed by GC/MS. The results showed that significant levels of VLHs were present. The levels ranged from 307 to 6,500 ng/L and from 2,880 to 7,811 ng/L in Kuwait Bay and Sulaibekhat Bay, respectively. The annual average for VLHs near Al-Zor power plant ranged from 465 to 4,665 ng/L. Benzenoids formed the bulk (about 80%) of the VLHs present. Comparison with the levels in the outlets indicated that Doha West power plant contributed much higher levels of VLHs to the coastal areas than Al-Zor plant.

Saeed, T.; Khordagui, H.; Al-Hashash, H. [Kuwait Inst. for Scientific Research, Safat (Kuwait). Environmental Sciences Dept.] [Kuwait Inst. for Scientific Research, Safat (Kuwait). Environmental Sciences Dept.

1999-07-01T23:59:59.000Z

71

Composition analyses of size-resolved aerosol samples taken from aircraft downwind of Kuwait, Spring 1991  

SciTech Connect (OSTI)

Analyses are reported for eight aerosol samples taken from the National Center for Atmospheric Research Electra typically 200 to 250 km downwind of Kuwait between May 19 and June 1, 1991. Aerosols were separated into fine (D{sub p} < 2.5 {mu}m) and coarse (2.5 < D{sub p} 10 {mu}m) particles for optical, gravimetric, X ray and nuclear analyses, yielding information on the morphology, mass, and composition of aerosols downwind of Kuwait. The mass of coarse aerosols ranged between 60 and 1971 {mu}g/m{sup 3} and, while dominated by soil derived aerosols, contained considerable content of sulfates and salt (NaCl) and soot in the form of fluffy agglomerates. The mass of fine aerosols varied between 70 and 785 {mu}g/m{sup 3}, of which about 70% was accounted for via compositional analyses performed in vacuum. While most components varied greatly from flight to flight, organic matter and fine soils each accounted for about 1/4 of the fine mass, while salt and sulfates contributed about 10% and 7%, respectively. The Cl/S ratios were remarkably constant, 2.4 {+-} 1.2 for coarse particles and 2.0 {+-} 0.2 for fine particles, with one flight deleted in each case. Vanadium, when observed, ranged from 9 to 27 ng/m{sup 3}, while nickel ranged from 5 to 25 ng/m{sup 3}. In fact, fine sulfates, vanadium, and nickel occurred in levels typical of Los Angeles, California, during summer 1986. The V/Ni ratio, 1.7 {+-} 0.4, was very similar to the ratios measured in fine particles from combusted Kuwaiti oil, 1.4 {+-} 0.9. Bromine, copper, zinc, and arsenic/lead were also observed at levels between 2 and 190 ng/m{sup 3}. The presence of massive amounts of fine, typically alkaline soils in the Kuwaiti smoke plumes significantly modified their behavior and probably mitigated their impacts, locally and globally. 16 refs., 1 fig., 3 tabs.

Cahill, T.A.; Wilkinson, K. [Univ. of California, Davis, CA (United States); Schnell, R. [National Center for Atmospheric Research, Boulder, CO (United States)

1992-09-20T23:59:59.000Z

72

Dynamical and radiative response to the massive injection of aerosol from Kuwait oil burning fires  

SciTech Connect (OSTI)

The effects of the injection of large amount of soot comparable to that produced in the burning of oil wells in Kuwait were studied using a 2-D mesoscale model. During the three day numerical simulation the ground-atmosphere system appears to be strongly perturbed. A surface cooling is produced in the first two days above and downwind of the sources. The cooling, between -10 C over the desert and -0.5 C over the sea is dependent on the surface characteristics. The temperature decrease at the ground results in a stratified troposphere which inhibits convection and perturbs the normal diurnal variability of the boundary layer while the upper levels are driven by the radiative warming of the aerosol layer. In this region after few hours the simulation produces a warming of 0.8 C reaching a maximum of 6 C is after 60 hours. During the last 2 days of simulation the long wave radiation emitted by the low altitude atmospheric layers contribute to mitigate the surface cooling. A detailed discussion of the radiative and the dynamical interactions is given and it is shown that beside the specific interest in the short term effects these results may be useful to parameterize the smoke source for a General Circulation Model (GCM) simulation.

Ferretti, R.; Visconti, G. [Univ. L`Aquila (Italy)

1993-12-01T23:59:59.000Z

73

Daily dispersion model calculations of the Kuwait oil fire smoke plume  

SciTech Connect (OSTI)

The Atmospheric Release Advisory Capability (ARAC) provided daily forecasts of the position and spatial character of the Kuwait oil fire smoke plume to the NSF-coordinated research aircraft missions in the Persian Gulf. ARAC also provided daily plume dispersion products to various nations in the Persian Gulf region under the auspices of the World Meteorological Organization for a period of nearly 5 months. Forecasted three dimensional winds were provided to ARAC from the US Air Force Global Weather Central`s Relocatable Wind Model (RWM). The RWM winds were spaced approximately 90 km in the horizontal and were located at the surface, 1000 ft., 2000 ft, 5000 ft and every 5000 ft up to 30,000 ft elevation. The forecast periods were 0, 6, 24, and 36 hours from both 0000 and 1200 UTC. A wind field model (MATHEW) corrected for terrain influences on the wind. The smoke plume was dispersed using a three dimensional particle-in-cell code (ADPIC) with buoyant plume rise capability. Multiple source locations were used to represent the burning oil fields. Improved estimates of the source term and emission factors for the smoke were incorporated into the ADPIC calculations as the field measurement data were made available.

Ellis, J.S.; Foster, C.S.; Foster, K.T.; Sullivan, T.J. [Lawrence Livermore National Lab., CA (United States); Baskett, R.L.; Nasstrom, J.S.; Schalk, W.W. III [EG and G Energy Measurements, Inc., Pleasanton, CA (United States); Greenly, G.D. [IT Corp., Irvine, CA (United States)

1992-03-26T23:59:59.000Z

74

Daily dispersion model calculations of the Kuwait oil fire smoke plume  

SciTech Connect (OSTI)

The Atmospheric Release Advisory Capability (ARAC) provided daily forecasts of the position and spatial character of the Kuwait oil fire smoke plume to the NSF-coordinated research aircraft missions in the Persian Gulf. ARAC also provided daily plume dispersion products to various nations in the Persian Gulf region under the auspices of the World Meteorological Organization for a period of nearly 5 months. Forecasted three dimensional winds were provided to ARAC from the US Air Force Global Weather Central's Relocatable Wind Model (RWM). The RWM winds were spaced approximately 90 km in the horizontal and were located at the surface, 1000 ft., 2000 ft, 5000 ft and every 5000 ft up to 30,000 ft elevation. The forecast periods were 0, 6, 24, and 36 hours from both 0000 and 1200 UTC. A wind field model (MATHEW) corrected for terrain influences on the wind. The smoke plume was dispersed using a three dimensional particle-in-cell code (ADPIC) with buoyant plume rise capability. Multiple source locations were used to represent the burning oil fields. Improved estimates of the source term and emission factors for the smoke were incorporated into the ADPIC calculations as the field measurement data were made available.

Ellis, J.S.; Foster, C.S.; Foster, K.T.; Sullivan, T.J. (Lawrence Livermore National Lab., CA (United States)); Baskett, R.L.; Nasstrom, J.S.; Schalk, W.W. III (EG and G Energy Measurements, Inc., Pleasanton, CA (United States)); Greenly, G.D. (IT Corp., Irvine, CA (United States))

1992-03-26T23:59:59.000Z

75

E-Print Network 3.0 - assign p-gp inhibitor Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Branch, National Institute of Mental Health Collection: Biology and Medicine 27 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...

76

Assessment of the histopathological lesions and chemical analysis of feral cats to the smoke from the Kuwait oil fires  

SciTech Connect (OSTI)

Twenty-six adult or subadult feral cats were collected from Kuwait approximately 8 months after the ignition of the Kuwait oil wells. These animals were obtained from two sources: 12 animals from Kuwait City, a relatively smoke-free area, and 14 from the city of Ahmadi, an area with heavy smoke. Animals were euthanized and a complete set of tissues consisting of all major organs was taken for histopathology. Samples of lung, liver, kidney, urine, and blood were also taken for toxicology. Histopathological lesions observed in the lung were mild accumulations of anthracotic pigment in the lungs of 17 cats. Hyperplasia of the bronchial and bronchiolar gland in 8 cats, and smooth muscle hyperplasia of bronchioles in 14 cats. Tracheal gland hyperplasia was observed in 7 cats, and minimal squamous metaplasia of the tracheal mucosa in 17 cats, Laryngeal lesions consisted of submucosal gland hyperplasia in 2 cats and squamous metaplasia of the mucosa in 5 cats. Hyperplasia of the nasal submucosal glands was observed in 6 animals. The pharyngeal mucosa as well as other organs and organ systems were normal in all cats. Atomic absorption analysis for 11 metals was performed; vanadium and nickel levels (two metals that were present in the smoke from the oil fires) are not indicative of substantial exposure to the oil fires. Based on the histopathological findings and toxicological analysis, it is felt that inhalation of air contaminated with smoke from the oil fires had little or no long-term effect on the animals examined. 36 refs., 3 figs., 7 tabs.

Moeller, R.B. Jr.; Dick, E.J.; Pletcher, J.M. [Armed Forces Institute of Pathology, Washington, DC (United States)] [and others

1994-12-31T23:59:59.000Z

77

Assessment of the histopathological lesions and chemical analysis of feral cats to the smoke from Kuwait oil fires  

SciTech Connect (OSTI)

Twenty-six adult or subadult feral cats were collected from Kuwait approximately 8 months after the ignition of the Kuwait oil wells. These animals were obtained from two sources: 12 animals from Kuwait City, a relatively Co smoke-free area, and 14 from the city of Alimadi, an area with heavy smoke. Animals were euthanized and a complete set of tissues consisting of all 0 major organs was taken for histopathology. Samples of lung, liver, kidney, urine, and blood were also taken for toxicology. Histopathological lesions observed in the lung were mild accumulations of anthracotic pigment in the lungs of 17 cats. Hyperplasia of the bronchial and bronchiolar gland in 8 cats, and smooth muscle hyperplasia of bronchioles in 14 cats. Iracheal gland hyperplasia was observed in 7 cats, and minimal squamous metaplasia of the tracheal mucosa in 17 cats, Laryngeal lesions consisted of submucosal gland hyperplasia in 2 cats and squamous metaplasia of the mucosa in 5 cats. Hyperplasia of the nasal submucosal glands was observed in 6 animals. The pharyngeal mucosa as well as other organs and organ systems (a) were normal in all cats. Atomic absorption analysis for 11 metals was performed; vanadium and nickel levels (two metals that were present in the smoke from the oil fires) are not indicative of substantial exposure to the oil fires. Based on the histopathological findings and toxicological analysis, it is felt that inhalation of air contaminated with smoke from the oil fires had little or no long-term effect on the animals examined.

Moeller, R.B.; Kalasinsky, V.F.; Razzaque, M.; Centeno, J.A.; Dick, E.J.

1994-12-31T23:59:59.000Z

78

Markov Chain Models for GP and Variable-length GAs with Homologous Crossover  

E-Print Network [OSTI]

Markov Chain Models for GP and Variable-length GAs with Homologous Crossover Riccardo Poli School mcphee@mrs.umn.edu Abstract In this paper we present a Markov chain model for GP and variable-length GAs of the genetic material taken from the parents. We obtain this result by using the core of Vose's model for GAs

Poli, Riccardo

79

An evaluation of acid frac/matrix stimulation of a tight limestone formation in exploratory wells in Kuwait  

SciTech Connect (OSTI)

With the advent of Kuwait's intensive exploratory activities to locate and test deeper geologic structures, tighter and very low porosity limestone formations were progressively encountered. Most of these hydrocarbon bearing formations initially appeared to be very stubborn and hardly indicated any fluid influx into the well-bore. In certain cases the hydrostatic head was nearly completely removed by unloading the well practically down to perforations, thereby creating optimum draw-down but it either resulted in poor inflow or none at all. In the absence of currently available chemicals, equipment, job design engineering and better understanding of tight carbonate formations and their responses to various acid formulations, some of these could have slipped into unattractive categories. With the implementation of specially designed matrix and acid-frac treatments, these formation have, however, been unmasked and turned out to be highly potential finds now. This paper basically outlines the salient features of theoretical and operational aspects of stimulating and testing some of the very low porosity hard limestone formations in Kuwait recently.

Singh, J.R.

1985-03-01T23:59:59.000Z

80

Event:LEDS GP Event at Rio+20 | Open Energy Information  

Open Energy Info (EERE)

Rio+20 Rio+20 Jump to: navigation, search Calendar.png LEDS GP Event at Rio+20: 15:30 - 17:00 on 2012/06/19 The purpose of the event is to share information on current LEDS GP activities and explore opportunities for collaboration with other related activities. We are looking forward to an exciting discussion on how we can work together to foster low emissions development around the world. The "LEDS Global Partnership - Enhancing Global Collaboration on Low Emissions Development" will be held on June 19th, 2012 from 15:30-17:00 at the U.S. Center, located at the Athletes Park in Barra da Tijuca, across from Rio Centro. Event Details Name LEDS GP Event at Rio+20 Date 2012/06/19 Time 15:30 - 17:00 Location Brazil Organizer LEDS GP Tags LEDS, CLEAN, Training

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Effect of Ebola virus proteins GP, NP and VP35 on VP40 VLP morphology  

Science Journals Connector (OSTI)

Recently we described a role for Ebola virus proteins, NP, GP, and VP35 in enhancement of VP40 VLP budding. To explore the possibility that VLP structure was altered by co-expression of EBOV proteins leading t...

Reed F Johnson; Peter Bell; Ronald N Harty

2006-05-01T23:59:59.000Z

82

Increased frequencies of sister chromatid exchanges (SCE) in peripheral blood lymphocytes of U.S. troops deployed in Kuwait  

SciTech Connect (OSTI)

Concern over potential exposure of U.S. troops to genotoxic emissions generated in oil well fires prompted a Biologic Surveillance Initiative to examine levels of genetic damage in a cohort of troops deployed in Kuwait. Blood was drawn from members of the 11th Armored Cavalry Regiment on June 6, 1991 while they were stationed in Germany (PRE, n=61), on August 11, 1991 after being deployed in Kuwait (DURING, n=51) and again on October 10, 1991 after returning to Germany (POST, n=36). Cells were cultured for 68-72 hours in RPMI 1640 medium supplemented with 15% fetal bovine serum, 1% phytohemagglutinin and 10 {mu}g/ml 5-bromo-2`-deoxyuridine. Metaphase cells were prepared by standard techniques and stained with Hoechst 33258 plus Giemsa to visualize SCE. Whenever possible, a total of 25 well-spread and well-stained cells were evaluated for each individual. Only 26 soldiers had values available for all three sampling points. Data on 50 soldiers was available for PRE and DURING sampling while data on 35 samples was available for a PRE vs POST comparison. The average frequency of SCE/cell increased from 4.33 {plus_minus} 0.53 in the PRE samples to 5.12 {plus_minus} 0.64 in the DURING samples to 5.28 {plus_minus} 0.72 in the POST samples. The PRE values were significantly different from both the DURING and POST values (p<0.001) using the paired t-test. While these results suggest that this cohort was potentially exposed to genotoxic materials, the source of the exposure(s) is presently not known.

McDiarmid, M.A. Kolodner, K. [John Hopkins Univ., Baltimore, MD (United States); Scott, B.G. [Army Environmental Hygiene Agency, Aberdeen, MD (United States)] [and others

1995-11-01T23:59:59.000Z

83

LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop | Open  

Open Energy Info (EERE)

GP Second Annual Event: Learning and Leading on LEDS Workshop GP Second Annual Event: Learning and Leading on LEDS Workshop Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us Calendar.png LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop: on 2013/02/27 (February 27 - March 1, 2013) The LEDS Global Partnership is convening its second annual global workshop to bring together leading practitioners from countries and international institutions to share lessons and strengthen cooperation on low emission development around the world. The workshop will convene peer learning and collaboration sessions on common topics of interest defined by the African Climate & Development Society, Asia LEDS

84

CLIMATE CHANGE IMPACTS ON HYDROELECTRIC POWER G.P. Harrison(1),  

E-Print Network [OSTI]

CLIMATE CHANGE IMPACTS ON HYDROELECTRIC POWER G.P. Harrison(1), H.W. Whittington(1) and S.W. Gundry implications for the design, operation and viability of hydroelectric power stations. This describes attempts to predict and quantify these impacts. It details a methodology for computer based modelling of hydroelectric

Harrison, Gareth

85

On the description of the bearing capacity of electro-discharge machined G.P Petropoulosa  

E-Print Network [OSTI]

electro-discharge machining (EDM) is the most widely and successfully applied for the machining of variousOn the description of the bearing capacity of electro-discharge machined surfaces G.P Petropoulosa with the investigation of a set of "non-common" surface topography parameters of EDMed surfaces that describe

Aristomenis, Antoniadis

86

Evolving Recurrent Linear-GP for Document Classification and Word Tracking  

E-Print Network [OSTI]

Evolving Recurrent Linear-GP for Document Classification and Word Tracking Xiao Luo, A. Nur Zincir word sequences. During this process, word sequences of documents are tracked, frequent patterns of temporal sequences within a document. This in return automates the process of word tracking, frequent word

Zincir-Heywood, Nur

87

Publications from Research Conducted at GP-SANS | ORNL Neutron Sciences  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Publications from Research Conducted at GP-SANS Publications from Research Conducted at GP-SANS 2013 Publications Anovitz L. M., Cole D. R., Rother G., Allard L. F., Jackson A. J., Littrell K. C., "Diagenetic changes in macro- to nano-scale porosity in the St. Peter sandstone: an (ultra) small angle neutron scattering and backscattered electron imaging analysis", Geochimica et Cosmochimica Acta 102, 280-305 (2013). Black S. B., Chang Y., Bae C., Hickner M. A., "FTIR characterization of water-polymer interactions in superacid polymers", Journal of Physical Chemistry B 117, 16266-16274 (2013). Boukhalfa S., He L., Melnichenko Y. B., Yushin G., "Small-angle neutron scattering for in situ probing of ion adsorption inside micropores", Angewandte Chemie International Edition 52, 4618-4622 (2013).

88

A GP-Based Hyper-Heuristic Framework for Evolving 3-SAT Heuristics  

E-Print Network [OSTI]

.502 - - 0.560 start FLIP v v RANDOM l | IFV pro, v, v MAX SCR l [, op] | MIN SCR l [, op] MAX AGE l [, op] l ALL | IFL pro, l, l ALL USC | RAND USC | SCR Z l [, op] op TIE RAND | TIE AGE | TIE SCR pro 0 for SAT using GP-HH. MAC SCR l selects a variable from list l that by flipping will maximize the number

Fernandez, Thomas

89

Envelope Deglycosylation Enhances Antigenicity of HIV-1 gp41 Epitopes for Both Broad Neutralizing Antibodies and Their Unmutated Ancestor Antibodies  

E-Print Network [OSTI]

The HIV-1 gp41 envelope (Env) membrane proximal external region (MPER) is an important vaccine target that in rare subjects can elicit neutralizing antibodies. One mechanism proposed for rarity of MPER neutralizing antibody generation is lack...

Ma, Ben-Jiang; Alam, S. Munir; Go, Eden P.; Lu, Xiaozhi; Desaire, Heather; Tomaras, Georgia D.; Bowman, Cindy; Sutherland, Laura L.; Scearce, Richard M.; Santra, Sampa; Letivn, Norman L.; Kepler, Thomas B.; Liao, Hua-Xin; Haynes, Barton F.

2011-09-01T23:59:59.000Z

90

Kuwait and Iraq  

Science Journals Connector (OSTI)

A short sector (58 km) of the northern coast of the Persian Gulf lies within Iraq. The area is dominated by the large...

Eric Bird

2010-01-01T23:59:59.000Z

91

Involvement of viral envelope GP2 in Ebola virus entry into cells expressing the macrophage galactose-type C-type lectin  

SciTech Connect (OSTI)

Highlights: {yields} Ebola virus infection is mediated by binding to and fusion with the target cells. {yields} Structural feature of the viral glycoprotein determines the infectivity. {yields} Surface C-type lectin, MGL, of macrophages and dendritic cells mediate the infection. {yields} GP2, one of glycoprotein subunits, plays an essential role in MGL-mediated infection. {yields} There is a critical amino acid residue involved in high infectivity. -- Abstract: Ebola virus (EBOV) infection is initiated by the interaction of the viral surface envelope glycoprotein (GP) with the binding sites on target cells. Differences in the mortality among different species of the Ebola viruses, i.e., Zaire ebolavirus (ZEBOV) and Reston ebolavirus (REBOV), correspond to the in vitro infectivity of the pseudo-typed virus constructed with the GPs in cells expressing macrophage galactose-type calcium-type lectin (MGL/CD301). Through mutagenesis of GP2, the transmembrane-anchored subunit of GP, we found that residues 502-527 of the GP2 sequence determined the different infectivity between VSV-ZEBOV GP and -REBOV GP in MGL/CD301-expressing cells and a histidine residue at position 516 of ZEBOV GP2 appeared essential in the differential infectivity. These findings may provide a clue to clarify a molecular basis of different pathogenicity among EBOV species.

Usami, Katsuaki [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Matsuno, Keita; Igarashi, Manabu [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Denda-Nagai, Kaori [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Takada, Ayato [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Irimura, Tatsuro, E-mail: irimura@mol.f.u-tokyo.ac.jp [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)

2011-04-01T23:59:59.000Z

92

The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII-hMDR1 Cells  

E-Print Network [OSTI]

The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII ABSTRACT The human multi-drug resistance membrane transporter, P-glycoprotein, or P-gp, has been of which can prove molecular mechanisms. Determination of the elementary kinetic rate constants

Mittal, Aditya

93

Exposure to particle-bound polyaromatic hydrocarbons in the Al-Mansoria residential area during the Kuwait oil fires. A qualitative appraisal of the adsorption role  

SciTech Connect (OSTI)

High ambient levels of inhalable particulate matter (PM[sub 10]) were detected in residential areas during the oil well burning in Kuwait (February-November 1991). Because inhalation exposures to PM[sub 10] were significant (data on PAH quantification are scarce), it became possible to describe the exposure to PM[sub 10]-associated PAHs of alternative courses of events, such as PAH-particle interaction mechanisms. Depending on particle adsorption characteristics (affinity and site availability), it is concluded that, contrary to what is currently believed, low levels of ambient PM[sub 10] levels did not indicate low PAH exposures in Al-Mansoria residential area during May 10-31, 1991. Due to the frequent presence of dust particles in the ambient air caused by the heavy dust fallout in Al-Mansoria (average > 65 tons/km[sup 2]) during May, 1991, the predicted patterns can be explained by two hypothesized mechanisms. The first is a two-step process: loss of PAHs from low affinity sites and reabsorption onto stronger affinity ones leading to low surface coverage at high PM[sub 10] concentrations. The second involves dilution of PAH-containing soot with aeolian particles. Both events can lead to low ambient PAHs at high PM[sub 10] levels or high ambient PAHs at low PM[sub 10] levels. 27 refs., 12 refs., 2 tabs.

Al-Yakoob, S.N.; Abdal, Y. (Kuwait Inst. for Scientific Research (Kuwait)); Nasrallah, H. (College of Health Sciences, Kuwait (Kuwait)); Al-Majed, N. (Ministry of Public Health, Kuwait (Kuwait))

1993-01-01T23:59:59.000Z

94

NIOSH testimony on Kuwait before the subcommittee on hospitals and health care, committee on veterans' affairs by J. S. Andrews, September 16, 1992  

SciTech Connect (OSTI)

The testimony summarizes potential adverse health effects related to service in the Persian Gulf as presented by the Department of Health and Human Services. An estimated 9,000 workers from 43 different countries battled the burning oil wells in Kuwait from February 1991 through early November 1991 when the last was capped. Exposures and health effects in US military personnel, Kuwaiti citizens, and fire fighters were described. The hazards to the soldiers were largely dependent on the concentration of the pollutants in the air near the camps. Fortunately, the plume from the fires rose up to 10,000 and 12,000 feet, mixed with the air and then dispersed for several thousand miles downwind over a period of several weeks. The particles and gases contained in the plume were diluted as the plume travelled. Even so, some minor respiratory problems were present among the soldiers. Some of the hydrocarbons measured at low concentrations have been shown to produce cancer in laboratory animals only when present at higher levels of exposure. Based on the exposure information gathered, the author concludes that there will not likely be a detectable increase in lung cancer in Gulf War Veterans as a result of the oil well fires.

Not Available

1992-09-16T23:59:59.000Z

95

Labor, nationalism, and imperialism in eastern Arabia: Britain, the Shaikhs, and the Gulf oil workers in Bahrain, Kuwait and Qatar, 1932-1956  

SciTech Connect (OSTI)

This study examines the lack of a noticeable indigenous labor movement in the contemporary Gulf Arab countries of Bahrain, Kuwait and Qatar; it focuses on the emergence, after the discovery of oil, of an industrial Gulf labor force, and on the evolution of the British policy towards oil and Gulf oil workers. The period examined begins with the discovery of oil in Bahrain in 1932 (the first such discovery on the Arab side of the Gulf), and ends with the Suez Crisis of 1956. The latter is a watershed event in Gulf history. It is argued that the Suez Crisis was in large part responsible for the long-term defeat of the indigenous labor movement in the Gulf. Attention is given to the parts played by the British Government of India, the Foreign Office, the local Shaikhs, the Gulf nationalists, and by the workers themselves. Policies towards workers passed through two different periods. In the first, 1932-1945, the Government of India had no direct interest in the Gulf labor situation; in the second, 1946-1956, the Foreign Office took increased interest in the welfare of local oil workers, primarily because of the importance of oil to reconstruction of the British economy after the war. However, the Suez Crisis in 1956 convinced the British to withdraw their support for the workers.

Saleh, H.M.A.

1991-01-01T23:59:59.000Z

96

Unliganded HIV-1 gp120 core structures assume the CD4-bound conformation with regulation by quaternary interactions and variable loops  

SciTech Connect (OSTI)

The HIV-1 envelope (Env) spike (gp120{sub 3}/gp41{sub 3}) undergoes considerable structural rearrangements to mediate virus entry into cells and to evade the host immune response. Engagement of CD4, the primary human receptor, fixes a particular conformation and primes Env for entry. The CD4-bound state, however, is prone to spontaneous inactivation and susceptible to antibody neutralization. How does unliganded HIV-1 maintain CD4-binding capacity and regulate transitions to the CD4-bound state? To define this mechanistically, we determined crystal structures of unliganded core gp120 from HIV-1 clades B, C, and E. Notably, all of these unliganded HIV-1 structures resembled the CD4-bound state. Conformational fixation with ligand selection and thermodynamic analysis of full-length and core gp120 interactions revealed that the tendency of HIV-1 gp120 to adopt the CD4-bound conformation was restrained by the V1/V2- and V3-variable loops. In parallel, we determined the structure of core gp120 in complex with the small molecule, NBD-556, which specifically recognizes the CD4-bound conformation of gp120. Neutralization by NBD-556 indicated that Env spikes on primary isolates rarely assume the CD4-bound conformation spontaneously, although they could do so when quaternary restraints were loosened. Together, the results suggest that the CD4-bound conformation represents a 'ground state' for the gp120 core, with variable loop and quaternary interactions restraining unliganded gp120 from 'snapping' into this conformation. A mechanism of control involving deformations in unliganded structure from a functionally critical state (e.g., the CD4-bound state) provides advantages in terms of HIV-1 Env structural diversity and resistance to antibodies and inhibitors, while maintaining elements essential for entry.

Kwon, Young Do; Finzi, Andrs; Wu, Xueling; Dogo-Isonagie, Cajetan; Lee, Lawrence K.; Moore, Lucas R.; Schmidt, Stephen D.; Stuckey, Jonathan; Yang, Yongping; Zhou, Tongqing; Zhu, Jiang; Vicic, David A.; Debnath, Asim K.; Shapiro, Lawrence; Bewley, Carole A.; Mascola, John R.; Sodroski, Joseph G.; Kwong, Peter D. (Harvard-Med); (NIH); (Hawaii); (L.F. Kimball); (Columbia); (VCCRI); (Arkansas); (DFCI)

2013-03-04T23:59:59.000Z

97

The GP Patient Survey for use in primary care in the National Health Service in the UK - development and psychometric characteristics  

E-Print Network [OSTI]

Abstract Background The UK National GP Patient Survey is one of the largest ever survey programmes of patients registered to receive primary health care, inviting five million respondents to report their experience of NHS primary healthcare...

Campbell, John; Smith, Patten; Nissen, Sonja; Bower, Peter; Elliott, Marc; Roland, Martin

2009-08-22T23:59:59.000Z

98

Effects of sequence changes in the HIV-1 gp41 fusion peptide on CCR5 inhibitor resistance  

SciTech Connect (OSTI)

A rare pathway of HIV-1 resistance to small molecule CCR5 inhibitors such as Vicriviroc (VCV) involves changes solely in the gp41 fusion peptide (FP). Here, we show that the G516V change is critical to VCV resistance in PBMC and TZM-bl cells, although it must be accompanied by either M518V or F519I to have a substantial impact. Modeling VCV inhibition data from the two cell types indicated that G516V allows both double mutants to use VCV-CCR5 complexes for entry. The model further identified F519I as an independent determinant of preference for the unoccupied, high-VCV affinity form of CCR5. From inhibitor-free reversion cultures, we also identified a substitution in the inner domain of gp120, T244A, which appears to counter the resistance phenotype created by the FP substitutions. Examining the interplay of these changes will enhance our understanding of Env complex interactions that influence both HIV-1 entry and resistance to CCR5 inhibitors.

Anastassopoulou, Cleo G.; Ketas, Thomas J. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Sanders, Rogier W. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States) [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Laboratory of Experimental Virology, Department of Medical Microbiology, Center for Infection and Immunity Amsterdam (CINIMA), Academic Medical Center of the University of Amsterdam, Amsterdam (Netherlands); Johan Klasse, Per [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Moore, John P., E-mail: jpm2003@med.cornell.edu [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)

2012-07-05T23:59:59.000Z

99

Glycosyl-phosphatidylinositol (GPI)-anchored membrane association of the porcine reproductive and respiratory syndrome virus GP4 glycoprotein and its co-localization with CD163 in lipid rafts  

SciTech Connect (OSTI)

The porcine reproductive and respiratory syndrome virus (PRRSV) glycoprotein 4 (GP4) resembles a typical type I membrane protein in its structure but lacks a hydrophilic tail at the C-terminus, suggesting that GP4 may be a lipid-anchored membrane protein. Using the human decay-accelerating factor (DAF; CD55), a known glycosyl-phosphatidylinositol (GPI) lipid-anchored protein, chimeric constructs were made to substitute the GPI-anchor domain of DAF with the putative lipid-anchor domain of GP4, and their membrane association and lipase cleavage were determined in cells. The DAF-GP4 fusion protein was transported to the plasma membrane and was cleaved by phosphatidylinositol-specific phospholipase C (PI-PLC), indicating that the C-terminal domain of GP4 functions as a GPI anchor. Mutational studies for residues adjacent to the GPI modification site and characterization of respective mutant viruses generated from infectious cDNA clones show that the ability of GP4 for membrane association corresponded to virus viability and growth characteristics. The residues T158 ({omega} - 2, where {omega} is the GPI moiety at E160), P159 ({omega} - 1), and M162 ({omega} + 2) of GP4 were determined to be important for virus replication, with M162 being of particular importance for virus infectivity. The complete removal of the peptide-anchor domain in GP4 resulted in a complete loss of virus infectivity. The depletion of cholesterol from the plasma membrane of cells reduced the virus production, suggesting a role of lipid rafts in PRRSV infection. Remarkably, GP4 was found to co-localize with CD163 in the lipid rafts on the plasma membrane. Since CD163 has been reported as a cellular receptor for PRRSV and GP4 has been shown to interact with this receptor, our data implicates an important role of lipid rafts during entry of the virus.

Du, Yijun [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Shandong Key Laboratory of Animal Disease Control and Breeding, Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Jinan (China); Pattnaik, Asit K. [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States)] [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States); Song, Cheng [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Yoo, Dongwan, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Li, Gang, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Institute of Animal Science and Veterinary Medicine, Chinese Academy of Agricultural Sciences, Beijing (China)

2012-03-01T23:59:59.000Z

100

Detection of Nitrogen and Neon in the X-ray Spectrum of GP Com with XMM/Newton  

E-Print Network [OSTI]

We report on X-ray spectroscopic observations with XMM/Newton of the ultracompact, double white dwarf binary, GP Com. With the Reflection Grating Spectrometers (RGS) we detect the Lyman alpha and beta lines of hydrogen-like nitrogen (N VII) and neon (Ne X), as well as the helium-like triplets (N VI and Ne IX) of these same elements. All the emission lines are unresolved. These are the first detections of X-ray emission lines from a double-degenerate, AM CVn system. We detect the resonance (r) and intercombination (i) lines of the N VI triplet, but not the forbidden (f) line. The implied line ratios for N VI, R = f/i < 0.3, and G = (f + i)/r ~1, combined with the strong resonance line are consistent with formation in a dense, collision-dominated plasma. Both the RGS and EPIC/MOS spectra are well fit by emission from an optically thin thermal plasma (model cevmkl in XSPEC). Helium, nitrogen, oxygen and neon are required to adequately model the spectrum, however, the inclusion of sulphur and iron further improves the fit, suggesting these elements may also be present at low abundance. We confirm in the X-rays the underabundance of both carbon and oxygen relative to nitrogen, first deduced from optical spectroscopy by Marsh et al. The average X-ray luminosity of ~3e30 ergs/s implies a mass accretion rate of ~9e-13 solar masses per year. The implied temperature and density of the emitting plasma, combined with the presence of narrow emission lines are consistent with production of the X-ray emission in an optically thin boundary layer just above the surface of the white dwarf.

Tod E. Strohmayer

2004-04-27T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Possible physical self-asserting of the homogeneous vector potential. A testing puzzle based on a G.P. Thomson-like arrangement  

E-Print Network [OSTI]

It is suggested a testing puzzle able to reveal the self-asserting property of the homogeneous vector potential field. As pieces of the puzzle are taken three reliable entities : (i) influence of a potential vector on the de Broglie wavelength (ii) a G.P. Thomson-like experimental arrangement and (iii) a special coil designed to create a homogeneous vector potential. The alluded property is not connected with magnetic fluxes surrounded by the vector potential field lines, but it depends on the fluxes which are outside of the respective lines. Also the same property shows that in the tested case the vector potential field is uniquely defined physical quantity, free of any adjusting gauge. So the phenomenology of the suggested quantum test differs on that of macroscopic theory where the vector potential is not uniquely defined and allows a gauge adjustment. Of course that the proposed test has to be subjected to adequate experimental validation.

Spiridon Dumitru

2014-04-16T23:59:59.000Z

102

Daylighting systems for the Kuwait National Museum  

E-Print Network [OSTI]

for the degree of MASTER OF SCIENCE Approved as to style and content by: _______________________________ _____________________________ Liliana O. Beltran Paul K.... Woods (Chair of Committee) (Member) _______________________________ _____________________________ Rodney C. Hill...

Ahn, Byoungsoo

2005-08-29T23:59:59.000Z

103

Antibody elicited against the gp41 N-heptad repeat (NHR) coiled-coil can neutralize HIV-1 with modest potency but non-neutralizing antibodies also bind to NHR mimetics  

Science Journals Connector (OSTI)

Following CD4 receptor binding to the HIV-1 envelope spike (Env), the conserved N-heptad repeat (NHR) region of gp41 forms a coiled-coil that is a precursor to the fusion reaction. Although it has been a target of drug and vaccine design, there are few monoclonal antibody (mAb) tools with which to probe the antigenicity and immunogenicity specifically of the NHR coiled-coil. Here, we have rescued HIV-1-neutralizing anti-NHR mAbs from immune phage display libraries that were prepared (i) from b9 rabbits immunized with a previously described mimetic of the NHR coiled-coil, N35CCG-N13, and (ii) from an HIV-1 infected individual. We describe a rabbit single-chain Fv fragment (scFv), 8K8, and a human Fab, DN9, which specifically recognize NHR coiled-coils that are unoccupied by peptide corresponding to the C-heptad repeat or CHR region of gp41 (e.g. C34). The epitopes of 8K8 and DN9 were found to partially overlap with that of a previously described anti-NHR mAb, IgG D5; however, 8K8 and DN9 were much more specific than D5 for unoccupied NHR trimers. The mAbs, including a whole IgG 8K8 molecule, neutralized primary HIV-1 of clades B and C in a pseudotyped virus assay with comparable, albeit relatively modest potency. Finally, a human Fab T3 and a rabbit serum (both non-neutralizing) were able to block binding of D5 and 8K8 to a gp41 NHR mimetic, respectively, but not the neutralizing activity of these mAbs. We conclude from these results that NHR coiled-coil analogs of HIV-1 gp41 elicit many Abs during natural infection and through immunization, but that due to limited accessibility to the corresponding region on fusogenic gp41 few can neutralize. Caution is therefore required in targeting the NHR for vaccine design. Nevertheless, the mAb panel may be useful as tools for elucidating access restrictions to the NHR of gp41 and in designing potential improvements to mimetics of receptor-activated Env.

Josh D. Nelson; Heather Kinkead; Florence M. Brunel; Dan Leaman; Richard Jensen; John M. Louis; Toshiaki Maruyama; Carole A. Bewley; Katherine Bowdish; G. Marius Clore; Philip E. Dawson; Shana Frederickson; Rose G. Mage; Douglas D. Richman; Dennis R. Burton; Michael B. Zwick

2008-01-01T23:59:59.000Z

104

GP-8 LAWS AND REGULATIONS  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

DOP (5-2011) DOP (5-2011) Supersedes (7-2010) issue DECLARATION of OCCUPATIONAL MEDICINE PROVIDER GENERAL INFORMATION PURPOSE All Contractors and their lower-tier subcontractors must comply with the Department of Energy's Worker Safety and Health Program regulation, 10 CFR 851, "Worker Safety and Health Program (WSHP). The WSHP enforces worker safety and health requirements including, but not limited to, standards of the Occupational Safety and Health Administration (OSHA), American National Standards Institute (ANSI) and Workers Compensation Laws as incorporated in the SNL WSHP. APPLICABILITY Contractors at all tiers which meet the applicability criteria must establish and provide comprehensive

105

Conceptual Liquefied Natural Gas (LNG) terminal design for Kuwait  

E-Print Network [OSTI]

containment systems (Pepper and Shah 2004) ..............................................5 6. Single containment tanks (UH IELE 2003b).........................................................................5 7. Double containment tanks (UH IELE 2003b...)........................................................................7 8. Full containment tanks (UH IELE 2003b).............................................................................7 9. Underground LNG storage tank (UH IELE 2003b)...............................................................7 10. Three...

Aljeeran, Fares

2006-08-16T23:59:59.000Z

106

Improving Operational Strategies of an Institutional Building in Kuwait  

E-Print Network [OSTI]

operation strategies. The study focused on the major end user systems of the building main source of energy that is electricity, namely the air-conditioning, and lighting systems. It was estimated that for the base year, which was selected to be year 1999...

Al-Ragom, F.

2002-01-01T23:59:59.000Z

107

Energy Conservation Program in Kuwait: A Local Perspective  

E-Print Network [OSTI]

(petrol, natural gas, and coal), hydropower, and nuclear energy. According to the International Energy Agency (IEA) 1997 annual report, the industrialized countries including North America and Western Europe consumed more than 50% of the energy used... emissions come from developing countries (9,118 million metric tons) and the former Soviet Union and Eastern Europe (3,148 million metric tons) [2]. 1.2 Environmental Energy Impact There are environmental and health impacts associated...

Hajiah, A. E.

2006-01-01T23:59:59.000Z

108

The life cycle assessment of concrete manufacturing in Kuwait  

E-Print Network [OSTI]

Concrete is the second most widely used material in the world after water. Annually 9,120 million tons of concrete are produced, which is an equivalent of 1.3 tons of concrete per individual. As the world's primary ...

El Mostafa, Mayce (Mayce A.)

2013-01-01T23:59:59.000Z

109

*PSD:Position Sensitive Detector GP2D12/GP2D15 Distance Measuring Sensors  

E-Print Network [OSTI]

control circuit is unnecessary. (4) Low cost Tec.U970501 (1) TVs (2) Personal computers (3) Cars (4) · In the absence of device specification sheets, SHARP takes no responsibility for any defects that may occur

Wedeward, Kevin

110

Dynamically polarized target for the gp2 and GpE experiments at Jefferson Lab  

DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

We describe a dynamically polarized target that has been utilized for two electron scattering experiments in Hall A at Jefferson Lab. The primary components of the target are a new, high cooling power 4 He evaporation refrigerator, and a re-purposed, superconducting split-coil magnet. It has been used to polarize protons in irradiated NH3 at a temperature of 1 K and at fields of 2.5 and 5.0 Tesla. The performance of the target material in the electron beam under these conditions will be discussed. Maximum polarizations of 28% and 95% were obtained at those fields, respectively. To satisfy the requirements of both experiments, the magnet had to be routinely rotated between angles of 0, 6, and 90 degrees with respect to the incident electron beam. This was accomplished using a new rotating vacuum seal which permits rotations to be performed in only a few minutes.

Pierce, Joshua J. [JLAB, Newport News, VA (United States); Maxwell, James D. [MIT, Amherst, MA (United States); Badman, Toby E. [Univ. of New Hampshire, Durham, NH (United States); Brock, James D. [JLAB, Newport News, VA (United States); Carlin, Christopher R. [JLAB, Newport News, VA (United States); Crabb, Donald G. [Univ. of Virginia, Charlottesville, VA (United States); Day, Donal B. [Univ. of Virginia, Charlottesville, VA (United States); Keith, Christopher D. [JLAB, Newport News, VA (United States); Kvaltine, Nicholas D. [Univ. of Virginia, Charlottesville, VA (United States); Meekins, David G. [JLAB, Newport News, VA (United States); Mulholland, Jonathan R.L. [Univ. of Tennessee, Knoxville, TN (United States); Shields, Joshua A. [Univ. of Virginia, Charlottesville, VA (United States); Slifer, Karl J. [Univ. of New Hampshire, Durham, NH (United States)

2014-02-01T23:59:59.000Z

111

Crustal structure of Guadeloupe Islands and the Lesser Antilles Arc from a new gravity and magnetic synthesis  

E-Print Network [OSTI]

the compilation and processing of available, on-land, airborne and marine, gravity and magnetic data acquired is associated with formations consistent with the low measured density and the underlying hydrothermal system

Paris-Sud XI, Université de

112

A Functional Interaction between gp41 and gp120 Is Observed for Monomeric but Not Oligomeric, Uncleaved HIV-1 Env gp140  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 40 :s453-s458. 42. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 43. Svergun, DI . 1991. Mathematical...

Miklos Guttman; Kelly K. Lee

2013-08-21T23:59:59.000Z

113

A HYBRID GP-FUZZY APPROACH FOR RESEVOIR CHARACTERIZATION  

E-Print Network [OSTI]

a gentle introduction to the process of oil exploration and production (Section 2). The data integration of future work (Section 8). 2. Oil Exploration and Production Oil exploration and production is the process to Oil Exploration and Production Tina Yu, Dave Wilkinson and Deyi Xie ChevronTexaco Information

Fernandez, Thomas

114

Better GP benchmarks: community survey results and proposals  

Science Journals Connector (OSTI)

We present the results of a community survey regarding genetic programming benchmark practices. Analysis shows broad consensus that improvement is needed in problem selection and experimental rigor. While views expressed in the survey dissuade us from ... Keywords: Benchmarks, Community survey, Genetic programming

David R. White; James Mcdermott; Mauro Castelli; Luca Manzoni; Brian W. Goldman; Gabriel Kronberger; Wojciech Ja?kowski; Una-May O'Reilly; Sean Luke

2013-03-01T23:59:59.000Z

115

L.F. MORASCH G.P. O'CONNOR  

E-Print Network [OSTI]

..................................................................................... 11 Waste Tanks ..................................................................................................................... 11 Immobilization of Waste Contained in Underground Tanks

116

Monitoring gp43 Antigenemia in Paracoccidioidomycosis Patients during Therapy  

Science Journals Connector (OSTI)

...Intergroup comparisons were performed by using the Kruskal-Wallis test. RESULTS Table 1 shows the characteristics of...Microbiol. 29: 1610-1615. 29 Restrepo, A. 1966. La prueba de inmunodifusion en el diagnostico de la paracoccidioidomicosis...

Silvia Helena Marques da Silva; Flvio Queiroz-Telles; Arnaldo Lopes Colombo; Maria Heloisa Souza Lima Blotta; Jos Daniel Lopes; Zoilo Pires de Camargo

2004-06-01T23:59:59.000Z

117

Name: Entry: Gp: 1 Indian Institute of Technology, Delhi  

E-Print Network [OSTI]

relation R #18; A#2;A is an equivalence. R = f (a; b) : f(a) = f(b) g Re exivity: for all a 2 S : (a; a) 2 Marks: 80 Q1 [8 Marks] Equivalences. Suppose f : A ! B is a total function. Prove that the following(c). By transitivity of equality, f(a) = f(c), whence (a; c) 2 R. Q2 [8+8 Marks] Partial Orders. In a partial order h

Prasad, Sanjiva

118

Molecular mechanisms of HIV gp120-induced neurotoxicity  

E-Print Network [OSTI]

the NMDA receptor antagonist memantine. Brain Research. 706:antagonists such as memantine (on the market) or MK801,

Medders, Kathryn Elizabeth

2010-01-01T23:59:59.000Z

119

ORIGINAL PAPER GP challenge: evolving energy function for protein  

E-Print Network [OSTI]

different amino acids encoded in the genetic material (DNA or RNA sequence). Each amino acid includes an a-carbon carbon, oxygen and nitrogen atoms form a protein backbone. This backbone forms several repeating local structures such as alpha helices, beta sheets or loops, known as secondary structure elements (see Fig. 1

Aickelin, Uwe

120

Page 1 of 4 Policy GP 38 January 24, 2008  

E-Print Network [OSTI]

sustainability and environmental literacy in teaching, research, operations and outreach at colleges the ecological integrity of our grounds and employ sustainable building design and construction principles and Procedures Revision Date Revision No. Subject: Sustainability 1.0 Purpose: In adopting this policy, Simon

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Merrimac Supercomputing with Stream Extended Abstract for GP2  

E-Print Network [OSTI]

units, and utilize a deep register hierarchy with high local band- width to match the bandwidth demands us to place hun- dreds of functional units on a single chip but provides limited global on for operating a small number of functional units. Graphics processors utilize the inherent parallelism

Dally, William J.

122

Re-examination of the current architectural curriculum at Kuwait University  

E-Print Network [OSTI]

and society in general. Architectural education is in desperate need of change and improvement, primarily through reforming the heart of the architectural education--its curriculum. This study reviews the existing program of the Department of Architecture...

Abdullah, Mohammad

2003-01-01T23:59:59.000Z

123

Numerical analysis of the laterally loaded piles in the Kuwait offshore environment  

SciTech Connect (OSTI)

An attempt is made to present an automated analysis of laterally loaded piles using subgrade reaction theory and the P-delta curves governing the soil properties. The finite difference method is applied in establishing the governing equations. The pile response is obtained using the boundary conditions improved by Newtonian method. Results obtained are forces, moments, deflections and soil reactions for various depths of strata in which such piles exist. Based on these results future recommendations are made.

Al-Obaid, Y.F.

1986-01-01T23:59:59.000Z

124

Department of Defense Kuwait oil fire health risk assessment. (The 'Persian Gulf Veterans' registry'). Background paper  

SciTech Connect (OSTI)

Second report prepared in response to P.L. 102-585--the Persian Gulf War Veterans' Health Status Act. (First report focused on the VA 'Persian Gulf War Veterans' Health Registry.') Assesses whether DoD's response 'meets the provisions of the law under which it was mandated,' assesses its 'potential utility ... for scientific study and assessment of the intermediate and long-term health consequences of military service in the Persian Gulf theater of operations during the Persian Gulf War,' and addresses some other related questions.

Not Available

1994-09-01T23:59:59.000Z

125

"Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data"  

Broader source: Energy.gov (indexed) [DOE]

Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" "No","Identified","Advanced Metering Systems","Biomass","Excluded","Electric On-Grid","On Federal or Indian Land, On User Site",0,"Scope 1","Long-Term (> 10)","Electric Renewable Energy","Agricultural byproducts","NA","Line Item","Acquire More Fuel-Efficient Vehicles","Compressed Natural Gas (CNG)","Buses","B100","Direct","Guiding Principles","Met",2.2,"LEED® Certified","D&D in Progress","Actual"

126

Amrique latine et Carabes  

E-Print Network [OSTI]

P?ROU ?QUATEUR COLOMBIE VENEZUELA GUYANA SURINAME GUYANE FRAN?AISE MEXIQUE MARTINIQUE GUADELOUPE SAINT

127

POPULATION DENSITY, 2000 Population density measures the number  

E-Print Network [OSTI]

´ GUADELOUPE 0 25 50 km NETHERLAND ANTILLES NETHERLAND ANTILLES ST. KITTS NEVIS Copyright 2009. The Trustees

Columbia University

128

Implementation of Smart Operation Strategies for Air-Conditioning and Lighting Systems for Ministries Complex in the State of Kuwait  

E-Print Network [OSTI]

of the smart operation strategies. These savings led to a reduction of $1,500 per typical summer day of the MEW fuel bill and 8,918 kg/day of CO2 emissions. To make MC building more energy efficient, it is recommended to retrofit AHUs and secondary chilled...

Al-Mulla, A.; Maheshwari, G. P.; Al-Nakib, D.; Ishaqali, H.

129

Number and Size Distribution of Airborne Nanoparticles during Summertime in Kuwait: First Observations from the Middle East  

Science Journals Connector (OSTI)

(12-14) Nevertheless, the NPF barrier imposed by high pre-existing particles in polluted environment can be overshadowed by the extremely high precursor gases. ... Roadside vegetation barriers are used in many urban areas to restrict air and noise pollution from reaching roadside pedestrians, but their effectiveness in limiting the movement of nanoparticles is not yet known. ...

Abdullah N. Al-Dabbous; Prashant Kumar

2014-11-03T23:59:59.000Z

130

Promoting social change in the Arab Gulf: two case studies of communication programmes in Kuwait and Bahrain.  

E-Print Network [OSTI]

??The thesis presents rich empirical analysis of the role of public relations in facilitating participation in social change in the Arab Gulf. The focus is (more)

Al Saqer, Layla Hassan

2006-01-01T23:59:59.000Z

131

Hydrogeophysical methods for analyzing aquifer storage and recovery systems  

E-Print Network [OSTI]

1995. Hydrogeology of the Dammam formation in Umm GudairGeology and hydrogeology of the Dammam formation in Kuwait.freshwater storage in the Dammam formation, Kuwait. Arabian

Minsley, B.J.

2010-01-01T23:59:59.000Z

132

Another Viewpoint (AVP)  

E-Print Network [OSTI]

the oil wells and installations in Saudi Arabia, Kuwait andKuwait, or simply assure relatively cheap supplies of oil? Some of these objectives, if well

Tuma, Elias H

2011-01-01T23:59:59.000Z

133

SOVEREIGN WEALTH FUNDS AND NATIONAL SECURITY: THE GREAT TRADEOFF  

E-Print Network [OSTI]

Kuwaits pioneering Investment Authority was deliberately designed to provide for the day when the Emirates oil wells

COHEN, BENJAMIN J

2009-01-01T23:59:59.000Z

134

Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network [OSTI]

Iraq, Jordan, Kuwait, Persian Gulf, Saudi Arabia, Yemen.Iraq, Jordan, Kuwait, Persian Gulf, Saudi Arabia, Yemen.Gordon. Gazetteer of the Persian Gulf, 'Oman, and Central

Alissa, Reem IR

2012-01-01T23:59:59.000Z

135

Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network [OSTI]

Oil and Politics in the Gulf: Rulers and Merchants in Kuwait and Qatar, (Oil and Politics in the Gulf: Rulers and Merchants in Kuwait and Qatar,

Alissa, Reem IR

2012-01-01T23:59:59.000Z

136

Total All Countries Exports of Crude Oil and Petroleum Products by  

U.S. Energy Information Administration (EIA) Indexed Site

Destination: Total All Countries Afghanistan Albania Algeria Andora Angola Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahama Islands Bahrain Barbados Belarus Belgium Belize Benin Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Bermuda Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Fiji Finland France French Guiana French Pacific Islands Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Ivory Coast Jamaica Japan Jordon Kazakhstan Kenya Korea, South Korea, North Kyrgyzstan Kutubu Kuwait Latvia Lebanon Liberia Libya Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands/Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Qatar Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Saudi Arabia Senegal Serbia and Montenegro Seychelles Sierra Leone Singapore Slovakia Slovenia Soloman Islands South Africa Spain Spratly Islands Sri Lanka Sudan Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Tonga Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Arab Emirates United Kingdom Uruguay Uzbekistan Vanuatu Venezuela Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Zambia Period-Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day

137

Total Net Imports of Crude Oil and Petroleum Products into the U.S.  

U.S. Energy Information Administration (EIA) Indexed Site

Country: Total All Countries Persian Gulf OPEC Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Afghanistan Albania Andora Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Egypt El Salvador Equatorial Guinea Ethiopia Eritrea Estonia Fiji Finland France French Pacific Islands French Guiana Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Korea, South Kutubu Kyrgyzstan Latvia Lebanon Liberia Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Senegal Serbia and Montenegro Sierra Leone Singapore Slovakia Slovenia South Africa Spain Spratly Islands Sri Lanka Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Togo Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Kingdom Uruguay Uzbekistan Vanuatu Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Other Non OPEC Period-Unit: Monthly-Thousand Barrels per Day Annual-Thousand Barrels per Day

138

Therapeutic Tumor Immunity Induced by Polyimmunization with Melanoma Antigens gp100 and TRP-2  

Science Journals Connector (OSTI)

...Lond.), 372: 100-103, 1994. 4 Overwijk W. W., Tsung A., Irvine K. R...Rodriguez F., Whitton J. L., Overwijk W. W., Restifo N. P., Reisfeld...Apolloni E., Ronca R., Zamboni P., Overwijk W. W., Surman D. R., Restifo N...

Sanjeev Kumar Mendiratta; Gerald Thai; Nima K. Eslahi; Nikolyn M. Thull; Majed Matar; Vincenzo Bronte; Federica Pericle

2001-02-02T23:59:59.000Z

139

Structure and complete nucleotide sequence of the Marek's disease herpesvirus gp57-65 gene.  

Science Journals Connector (OSTI)

...His Arg Asn 1260 1270 1280 1290 1300 1310 * * * * * * CTC CTC AOC CGC ATT CCA OTA TOG OAC MT TOG ACG AA ACA AM TAT ACO TGC AOA...Ph. Ie His Sor Thr Arg Lys Ile Ph. 1500 1510 1520 1530 1540 1550 * * * * * * OAT TAT MT CTC ATT GTT ATO TAG TTG TGA TmT ATT MA...

P M Coussens; L F Velicer

1988-07-01T23:59:59.000Z

140

GP commissioning: implications for the third Helen Dickinson1 and Robin Miller  

E-Print Network [OSTI]

(Secretary of State for Health, 2010) heralded reforms described as the `biggest upheaval of the NHS outcome focus, extended choice etc),recent reform processes have shown that during implementation be for the third sector. NHS reform and policy drivers To some extent, the recently proposed reforms

Birmingham, University of

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Isolate-Specific Differences in the Conformational Dynamics and Antigenicity of HIV-1 gp120  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 36 :1277-1282. 72. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomacromolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 73. Svergun, DI . 1991. Mathematical...

Thaddeus M. Davenport; Miklos Guttman; Wenjin Guo; Brad Cleveland; Maria Kahn; Shiu-Lok Hu; Kelly K. Lee

2013-07-31T23:59:59.000Z

142

How to Draw a Straight Line Using a GP: Benchmarking Evolutionary Design Against 19th  

E-Print Network [OSTI]

Kinematic Synthesis Hod Lipson Computational Synthesis Laboratory, Mechanical & Aerospace Engineering, and Computing & Information Science, Cornell University, Ithaca NY 14850, USA hod.lipson@cornell.edu Abstract, and a number of human-competitive inventions are shown. 1 Introduction Kinematics � the science of pure motion

Fernandez, Thomas

143

P:\\dtp\\GasPrice\\current\\gp122298new.vp  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

. . . . . . . . . . . . . . . . . . . . 45 Appendix D. Derivation of Pattern Asymmetry Test Equation . . . . . . . . . . . . . . . . . 55 Tables 3.1 Gasoline Price Levels Move...

144

E-Print Network 3.0 - alveolar epithelial gp60 Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of the underlying mammary mesenchyme by the presumptive mammary epithelium to establish a bulb of ... Source: Scott, Matthew - Departments of Developmental Biology, Genetics, &...

145

Bounding the Gaussian Process Information Gain: Applications to PAC-Bayes and GP Bandit  

E-Print Network [OSTI]

Process Information Gain 23/3/10 1 / 23 #12;PAC-Bayesian Theorems PAC-Bayesian Recipe (x, y) Datapoint does not depend on data S! Lift result to smart classifier Q(f) = Q(f; S). What's the cost? n-1 D[Q P] How does it work? Variational (Fenchel) inequality

Seeger, Matthias

146

E-Print Network 3.0 - african clade-a gp160 Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

in most of sub-Saharan Africa, clade E (A... conservation of the novel epitopes in HIV-1 sequences classified as having been African in origin is notable... to the gag, nef,...

147

Climate Change in Scotland: Impact on Mini-Hydro G.P. Harrison  

E-Print Network [OSTI]

be generated from wind, wave, biomass or small- or mini-hydro plant. Production from these resources some 300 MW is small hydro potential capable of producing energy at less than 7p/kWh (Garrad Hassan, 2001). Although many of the better sites for small and mini-hydro have already been developed

Harrison, Gareth

148

Author's personal copy Kaly UL and Jones GP (1998) Mangrove restoration: A potential tool for  

E-Print Network [OSTI]

, Texas, USA. Marine Ecology ­ Progress Series 151: 165­179. Mitsch WJ and Gosselink JG (2000) Wetlands-year monitoring study. Restoration Ecology 12: 29­35. Thayer GW (ed.) (1992) Restoring the Nation and Kreeger DA (eds.) (2000) Concepts and Controversies in Tidal Marsh Ecology. Dordrecht: Kluwer Academic

Langerhans, Brian

149

Special Publication No. 3, Ticks and Tickborne Diseases, II. Hosts, Part 2. G-P  

E-Print Network [OSTI]

.. (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella..... (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella...

Doss, Mildred A.; Farr, Marion M.; Roach, Katharine F.; Anastos, George

150

World geothermal power generation in the period 2001-2005 | Open...  

Open Energy Info (EERE)

Costa Rica, France (Guadeloupe), Iceland,Indonesia, Italy1,Kenya, Mexico, Nicaragua, Russia, and the USA have increased the capacity of their powerplant installations by more...

151

World Geothermal Power Generation in the Period 2001-2005 | Open...  

Open Energy Info (EERE)

Costa Rica, France (Guadeloupe), Iceland, Indonesia, Italy1, Kenya, Mexico, Nicaragua, Russia, and the USA have increased the capacity of their power plant installations by more...

152

L'Amrique latine ou les Amriques latines Georges Couffignal  

E-Print Network [OSTI]

, le Suriname, la Guyane, la Jamaïque, la Guadeloupe, la Martinique et les mini ?tats de la Caraïbe. Au

Paris-Sud XI, Université de

153

14010651-6226-5013-257-124-6 OTHER ALLOCATIONS  

E-Print Network [OSTI]

FRENCH POLYNESIA BOLIVIABOLIVIA Gabon Zimbawe Sri LankaSri Lanka ArgentinaArgentina ColombieColombia Togo IndiaIndia Gabon Togo Guadeloupe Zimbawe EGYPTEGYPT TUNISIATUNISIAMOROCCOMOROCCO SENEGALSENEGAL

154

Proceedings World Geothermal Congress 2005 Antalya, Turkey, 24-29 April 2005  

E-Print Network [OSTI]

Proceedings World Geothermal Congress 2005 Antalya, Turkey, 24-29 April 2005 1 Geophysical Methods Applied to the Assessment of the Bouillante Geothermal Field (Guadeloupe, French West Indies) Hubert, 45064 Orléans Cedex 2, France h.fabriol@brgm.fr Keywords: geothermal exploration, Guadeloupe Island

Boyer, Edmond

155

Viruses: incredible nanomachines. New advances with filamentous phages  

E-Print Network [OSTI]

) resonance energy transfer gp8 Gene 8 product; the protein coded by viral gene number 8 (gp3, gp5, gp6, gp7. The technique of phage display has provided powerful methodology for identification and optimisation of ligands

Hemminga, Marcus A.

156

Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network [OSTI]

from Arabia, 1930-1960: Iraq, Jordan, Kuwait, Persian Gulf,from Arabia, 1930-1960: Iraq, Jordan, Kuwait, Persian Gulf,King Faisals Palace in Bagdad, Iraq, 1928. (Source: Wilson

Alissa, Reem IR

2012-01-01T23:59:59.000Z

157

Prof. Cauligi (Raghu) Raghavendra Vice Dean for Global Academic Initiatives  

E-Print Network [OSTI]

and Turkey ­ DEN Opportunities: Kuwait Oil Company, Aviation Safety in IFEZ, Korea, PEMEX and UNAM in Mexico

Zhou, Chongwu

158

China Energy Primer  

E-Print Network [OSTI]

Oil Reserves (2008) Saudi Arabia Iran Iraq Venezuela Kuwait United Arab Emirates Russian Federation Libya Kazakhstan Nigeria Canada US Qatar

Ni, Chun Chun

2010-01-01T23:59:59.000Z

159

Wald L., Baleynaud J.-M., 1999. Observing air quality over the city of Nantes by means of Landsat thermal infrared data. International Journal of Remote Sensing, 20, 5, 947-959.  

E-Print Network [OSTI]

oil wells in Kuwait were set on fire. As a result smoke plumes have obscured the sky south of Kuwait. As an example, the relative monthly solar radiation in Bahrain, 600 km south-east of Kuwait, was reduced by upto

Paris-Sud XI, Université de

160

Selected Abstracts & Bibliography of International Oil Spill Research, through 1998  

E-Print Network [OSTI]

Kuwait, Middle East, oil and gas fields, oil refinery, oil waste, oil well,Equipment Kuwait Oil Co. 1991. Mideast well fire, oil spillKuwait, Persian Gulf, Saudia Arabia, Oil spill, cleanup, oil spills, crude, oil spill incidents, oil spills-pipeline, warfare, oil skimmers, oil wells,

Louisiana Applied Oil Spill Research & Development Program Electronic Bibliography

1998-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Newsletter Signup Form  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

EETD NEWSLETTER - MANAGE SUBSCRIPTIONS EETD NEWSLETTER - MANAGE SUBSCRIPTIONS (red fields are required) Manage subscriptions: Subscribe Unsubscribe Name E-Mail Affiliation Address Address (line 2) City State/Province Zip/Postal Code Country (please select a country) none Afghanistan Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegowina Botswana Bouvet Island Brazil British Indian Ocean Territory Brunei Darussalam Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Congo, the Democratic Republic of the Cook Islands Costa Rica Cote d'Ivoire Croatia (Hrvatska) Cuba Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France France, Metropolitan French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guinea Guinea-Bissau Guyana Haiti Heard and Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic of) Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, Democratic People's Republic of Korea, Republic of Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia, The Former Yugoslav Republic of Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia, Federated States of Moldova, Republic of Monaco Mongolia Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island Northern Mariana Islands Norway Oman Pakistan Palau Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russian Federation Rwanda Saint Kitts and Nevis Saint LUCIA Saint Vincent and the Grenadines Samoa San Marino Sao Tome and Principe Saudi Arabia Senegal Seychelles Sierra Leone Singapore Slovakia (Slovak Republic) Slovenia Solomon Islands Somalia South Africa South Georgia and the South Sandwich Islands Spain Sri Lanka St. Helena St. Pierre and Miquelon Sudan Suriname Svalbard and Jan Mayen Islands Swaziland Sweden Switzerland Syrian Arab Republic Taiwan, Province of China Tajikistan Tanzania, United Republic of Thailand Togo Tokelau Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Tuvalu Uganda Ukraine United Arab Emirates United Kingdom United States United States Minor Outlying Islands Uruguay Uzbekistan Vanuatu Venezuela Viet Nam Virgin Islands (British) Virgin Islands (U.S.) Wallis and Futuna Islands Western Sahara Yemen Yugoslavia Zambia Zimbabwe

162

Targeted Immunotherapy Using Reconstituted Chaperone Complexes of Heat Shock Protein 110 and Melanoma-associated Antigen gp100  

Science Journals Connector (OSTI)

...Spiess P., Nichimura M. I., Overwijk W. W., Roberts B., Restifo N. P...Immunother., 20: 15-25, 1997. 28 Overwijk W. W., Tsung A., Irvine K. R...Methods, 53: 31-40, 1992. 34 Overwijk W. W., Lee D. S., Surman D. R...

Xiang-Yang Wang; Xing Chen; Masoud H. Manjili; Elizabeth Repasky; Robert Henderson; John R. Subjeck

2003-05-15T23:59:59.000Z

163

Binding Characteristics and Antitumor Properties of 1A10 Bispecific Antibody Recognizing gp40 and Human Transferrin Receptor  

Science Journals Connector (OSTI)

...Litwin Sylvia Hsieh-Ma Tim Shi R. Katherine Alpaugh Gregory P. Adams Ellen J. Wolf...Litwin, Sylvia Hsieh-Ma, Tim Shi, R. Katherine Alpaugh, Gregory P. Adams, Ellen J...603, 1989. 2. LoBuglio, A. F., Wheeler, R. H., Trang, J., Haynes, A...

Anne R. Amoroso; Joseph I. Clark; Samuel Litwin; Sylvia Hsieh-Ma; Tim Shi; R. Katherine Alpaugh; Gregory P. Adams; Ellen J. Wolf; David B. Ring; and Louis M. Weiner

1996-01-01T23:59:59.000Z

164

Molecular dissection of Rauscher virus gp70 by using monoclonal antibodies: localization of acquired sequences of related envelope gene recombinants  

Science Journals Connector (OSTI)

...and reagents provided by Drs. Norman Klinman, Judy Teale, Jeffery Hubert, David Katz, Thomas Shinnick, and Gregor Sutcliffe...767-774. 22. Schaffhausen, B. S., Silver, J. E. & Benjamin, T. L. (1978) Proc. Natl. Acad. Sci. USA 75,79-83...

H L Niman; J H Elder

1980-01-01T23:59:59.000Z

165

PAPER CATEGORY: Genetic Programming 1 Effects of Tree Size and State Number on GP-Automata Bidding Strategies  

E-Print Network [OSTI]

deregulation of the electrical transmission network, the Federal Energy Regulatory Commission (FERC) hopes a genetic algorithm (GA) to evolve bidding strategies for the electric energy market. These strategies strategies to develop. The results have been written up specifically for the electric energy market

Fernandez, Thomas

166

Ten years of health workforce planning in the Netherlands: a tentative evaluation of GP planning as an example  

Science Journals Connector (OSTI)

In many countries, health-care labour markets are constantly being challenged by an alternation of shortage and oversupply. Avoiding these cyclic variations is a major challenge. In the Netherlands, a workforc...

Malou Van Greuningen; Ronald S Batenburg

2012-08-01T23:59:59.000Z

167

Do shocks always accelerate ions? W.K.M. Rice, G.P. Zank Bartol Research Institute  

E-Print Network [OSTI]

the solar wind density (top panel), flow speed (middle panel), and energetic particle pressure (lower panel by observations of energetic particle enhancements coincident with shock waves (e.g. at 5 AU ­ left panel particle peak arrival time ­ right panel of figure. 5 AU 47 AU 0.52 ­ 1.45 MeV energetic particle

Christian, Eric

168

Molecular cloning of Schistosoma mansoni egg cDNA clones of importance to host immune response  

E-Print Network [OSTI]

tropical and subtropical Africa, South America, especially in Egypt, Nalagasy, Arabia, Brazil, Venezunelaf Surinam, and Guayanaf and in several Caribbean islands, including Puerto Rico, the Dominican Republic, St. Lucia, Martinique, and Guadeloupe...

Chao, Hsu

2012-06-07T23:59:59.000Z

169

IRD/T. Jaffr IRD/M.Dukhan  

E-Print Network [OSTI]

PERUPERU FRENCH POLYNESIA FRENCH POLYNESIA BOLIVIABOLIVIA Gabon Zimbawe Sri LankaSri Lanka ArgentinaArgentina ColombieColombia Togo IndiaIndia Gabon Togo Guadeloupe Zimbawe EGYPTEGYPT TUNISIATUNISIAMOROCCOMOROCCO

170

National Aeronautics and Space Administration  

E-Print Network [OSTI]

as well as conducting mission operations and data analysis. The GP-B Telescope Photo Credit: GP-B Photo

171

E-Print Network Topics: J  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

kuwait malaysia jordan lebanon libyan jordan mexico poland jordan middle east jordan oil shale jordan prevalence pattern jordan river israel jordan syria tunisia jordan valley...

172

SAFETY SERIES No.75-INSAG-4 INTERNATIONAL ATOMIC ENERGY AGENCY...  

Broader source: Energy.gov (indexed) [DOE]

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KENYA KOREA, REPUBLIC OF KUWAIT LEBANON LIBERIA LIBYAN ARAB JAMAHIRIYA LIECHTENSTEIN...

173

Liquid Fuels and Natural Gas in the Americas  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

Spain Sweden Switzerland Turkey United Kingdom Middle East Bahrain Iran Iraq Israel Jordan Kuwait Lebanon Oman Palestinian Territories Qatar Saudi Arabia Syria United Arab...

174

--No Title--  

Gasoline and Diesel Fuel Update (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

175

Middle East & North Africa  

U.S. Energy Information Administration (EIA) Indexed Site

Eastern Mediterranean brief Iran brief | data Iraq brief | data Israel notes & data Jordan notes & data Kuwait brief | data Lebanon notes & data Oman brief | data Qatar brief |...

176

Increasing the Competitiveness of Small and Medium-sized Enterprises...  

Open Energy Info (EERE)

informationpublicationsedituploadsdpd-09-5.pdf Country: Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Sudan, Syria, United Arab Emirates, Yemen...

177

Geothermal Technologies Office: Download GETEM, August 2012 Beta  

Broader source: Energy.gov (indexed) [DOE]

Indonesia Irak Iran Ireland Ireland, Northern Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Latvia Lebanon Liberia Liechtenstein Lithuania...

178

E-Print Network 3.0 - algeria bangladesh egypt Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya Source: Capecchi, Mario R. - Department of Biology, University...

179

Eia.gov BETA - Data - U.S. Energy Information Administration...  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

180

IEC documents | Department of Energy  

Energy Savers [EERE]

Hungary IADB Iceland IEA IFC India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Latvia Lebanon Lithuania Malaysia Mexico Moldova Mongolia...

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

DEVELOPING SAFETY CULTURE IN NUCLEAR ACTIVITIES Practical Suggestions  

Broader source: Energy.gov (indexed) [DOE]

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

182

E-Print Network 3.0 - algeria libya morocco Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya... , Morocco, North Korea, Oman, Pakistan, Qatar, Saudi...

183

Status of U.S. Nuclear Outages - U.S. Energy Information Administratio...  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...

184

Best Practices and Tools for Large-scale Deployment of Renewable...  

Open Energy Info (EERE)

informationpublicationsedituploadsdpd-09-TP3.pdf Country: Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Sudan, Syria, United Arab Emirates, Yemen...

185

INSAG-15 Key Practical Issues  

Broader source: Energy.gov (indexed) [DOE]

INDIA INDONESIA IRAN, ISLAMIC REPUBLIC OF IRAQ IRELAND ISRAEL ITALY JAMAICA JAPAN JORDAN KAZAKHSTAN KENYA KOREA, REPUBLIC OF KUWAIT LATVIA LEBANON LIBERIA LIBYAN ARAB...

186

The role of aquifer storage and recovery (ASR) in sustainbility.  

E-Print Network [OSTI]

??Kuwait is an arid country situated at the head of the Arabian Gulf and its water resources can be classified into three significant types: (1) (more)

AlRukaibi, Duaij

2011-01-01T23:59:59.000Z

187

Volunteer Day Countries Represented  

E-Print Network [OSTI]

Haiti Iran Korea Kuwait Russia Saudi Arabia Spain Taiwan Turkey Venezuela Vietnam Manners and Culture Q's warm-weather fashion, and we have a lot of warm w

Pilyugin, Sergei S.

188

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. c Includes Algeria, Angola...

189

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. b Includes Algeria, Angola...

190

International Law and the War in Iraq  

E-Print Network [OSTI]

and sanctions regime against Iraq and Kuwait); SC Res. 662 (Resolution 678, which gave Iraq until January 15, 1991, toto bring charges against Iraq for its violations of

Yoo, John C.

2003-01-01T23:59:59.000Z

191

--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

No data reported. W Withheld to avoid disclosure of individual company data. 1 Includes Bahrain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates....

192

--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

to avoid disclosure of individual company data. 3 Free on Board. See Glossary. 1 Includes Bahrain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates....

193

X:\\L6046\\Data_Publication\\Pma\\current\\ventura\\pma.vp  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...

194

Costs of Imported Crude Oil by Selected Country  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...

195

Table 25. Landed Costs of Imported Crude Oil by Selected Country  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...

196

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. b Includes Algeria,...

197

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...

198

--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. 1 Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. 2 Includes Algeria,...

199

X:\\L6046\\Data_Publication\\Pma\\current\\ventura\\pma.vp  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...

200

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. c Includes Algeria,...

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

X:\\Data_Publication\\Pma\\current\\ventura\\pma00.vp  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...

202

X:\\Data_Publication\\Pma\\current\\ventura\\pma00.vp  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...

203

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...

204

--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. (1) Free on Board. See Glossary. (2) Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. (3) Includes Algeria,...

205

E-Print Network 3.0 - agroforest sulawesi indonesia Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

- Aceh, Papua, Central Sulawesi, Maluku Kenya Kuwait Liberia Myanmar (former Burma) Nepal Nigeria... Former USSR - Azerbaijan Kyrgystan Tajikistan Turkmenistan Guatemala Guyana...

206

Strengthening the Nigerian Sovereign Investment Authority: A Policy Analysis of the Nigerian Excess Crude Account and the Nigerian Sovereign Investment Authority Act  

E-Print Network [OSTI]

Gas Russia National Welfare Pension Fund Reserve Oil QatarQatar Investment Savings Authority Oil Investmentoil prices of that time period, Norway, Qatar and Kuwait had

Ugwuibe, Cynthia

2012-01-01T23:59:59.000Z

207

The basis for cooperation in the Gulf Region: an assessment of the Gulf Cooperation Council.  

E-Print Network [OSTI]

??The Gulf Cooperation Council (GCC), a regional alliance grouping the six oil- and gas-rich Arabian states of Saudi Arabia, Kuwait, the United Arab Emirates, Qatar, (more)

Al-Zamat, Khalid Hamed S.

1998-01-01T23:59:59.000Z

208

Oil revenue of the Arabian gulf Emirates: patterns of allocation and impact on economic development.  

E-Print Network [OSTI]

??The study aims to analyse the oil revenue, its allocational pattern and impact on economic development in Kuwait, Bahrain, Qatar and the UAE from the (more)

Al-Kuwari, Ali Khalifa

1974-01-01T23:59:59.000Z

209

Role of the Ectodomain of the gp41 Transmembrane Envelope Protein of Human Immunodeficiency Virus Type 1 in Late Steps of the Membrane Fusion Process  

Science Journals Connector (OSTI)

...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...human immunodeficiency virus type 1 to fusion inhibitors targeted to the...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...

Sverine Br; Marc Alizon

2004-01-01T23:59:59.000Z

210

A Plant Homolog of the Neutrophil NADPH Oxidase gp91phox Subunit Gene Encodes a Plasma Membrane Protein with Ca2+ Binding Motifs  

Science Journals Connector (OSTI)

...16-hr-light/8-hr-dark cycle or in continuous...reaction (PCR) cycles, respectively...mCi/L Amersham Life Science, Arlington...the protein blot analysis of this fraction...R.W. Rain-, wind-, and touch-induced...M. Segal A.W. Analysis of glycosylation...

Thomas Keller; Howard G. Damude; Dietrich Werner; Peter Doerner; Richard A. Dixon; Chris Lamb

211

Topological Analysis of HIV-1 Glycoproteins Expressed In Situ on Virus Surfaces Reveals Tighter Packing but Greater Conformational Flexibility than for Soluble gp120  

Science Journals Connector (OSTI)

...Li, Y , S O'Dell, R Wilson, X Wu, SD Schmidt...Roederer, M Connors, JR Mascola, and RT Wyatt...Zhang, SA Migueles, R Wyatt, BF Haynes, PD Kwong, JR Mascola, and M Connors...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...

Tommy Tong; Keiko Osawa; James E. Robinson; Ema T. Crooks; James M. Binley

2013-06-05T23:59:59.000Z

212

HIV gp120 H375 Is Unique to HIV-1 Subtype CRF01_AE and Confers Strong Resistance to the Entry Inhibitor BMS-599793, a Candidate Microbicide Drug  

Science Journals Connector (OSTI)

...in silico docking simulations and assisted in...benchmarks for molecular simulation. Comp. Phys...et al. 1995. Rapid turnover of plasma...high accuracy in automated protein docking...silico drug docking simulations identified a drug...serve as a means for rapid identification of...

Susan M. Schader; Susan P. Colby-Germinario; Peter K. Quashie; Maureen Oliveira; Ruxandra-Ilinca Ibanescu; Daniela Moisi; Thibault Mesplde; Mark A. Wainberg

2012-05-21T23:59:59.000Z

213

Detection of growth sites in and protomer pools for the sheath of Methanospirillum hungatei GP1 by use of constituent organosulfur and immunogold labeling.  

Science Journals Connector (OSTI)

...the Hg-hoops was evident (data not shown). In negative stains...alterations of the hoops (data not shown). The concentration...Research Council of Canada infrastructure grant. Advice from G. D...Immunoglobulin produc- ing hybrid cell lines, p. 351-371...

G Southam; T J Beveridge

1992-10-01T23:59:59.000Z

214

miR200c Attenuates P-gpMediated MDR and Metastasis by Targeting JNK2/c-Jun Signaling Pathway in Colorectal Cancer  

Science Journals Connector (OSTI)

...encoded by the ABCB1 gene and the most characterized member of energy-dependent drug efflux pumps involved in MDR, recently has...Table S7. Quantitative RT-PCR was carried out using SYBR Green PCR Master Mix (Life Technologies). The PCR conditions were...

Hua Sui; Guo-Xiang Cai; Shu-Fang Pan; Wan-Li Deng; Yu-Wei Wang; Zhe-Sheng Chen; San-Jun Cai; Hui-Rong Zhu; and Qi Li

2014-12-01T23:59:59.000Z

215

Clinical Evaluation of a GP5+/6+-Based Luminex Assay Having Full High-Risk Human Papillomavirus Genotyping Capability and an Internal Control  

Science Journals Connector (OSTI)

...LMNX using a sample panel and infrastructure provided by the international...HPV66 (class 2B) (1). The Hybrid Capture 2 (HC2; Qiagen...comparison of an automated hybrid capture 2 assay and the consensus...against the performance of hybrid capture 2 for the purpose of...

D. T. Geraets; K. Cuschieri; M. N. C. de Koning; L. J. van Doorn; P. J. F. Snijders; C. J. L. M. Meijer; W. G. V. Quint; M. Arbyn

2014-09-10T23:59:59.000Z

216

Cross-Sectional Comparison of an Automated Hybrid Capture 2 Assay and the Consensus GP5+/6+ PCR Method in a Population-Based Cervical Screening Program  

Science Journals Connector (OSTI)

...requires special skills and a more stringent infrastructure to reduce PCR-related contamination...2002. Restricted cross-reactivity of hybrid capture 2 with nononcogenic human papillomavirus...Schiffman, and C. M. Wheeler. 2004. Hybrid capture 2 viral load and the 2-year...

A. T. Hesselink; N. W. J. Bulkmans; J. Berkhof; A. T. Lorincz; C. J. L. M. Meijer; P. J. F. Snijders

2006-10-01T23:59:59.000Z

217

Mascle, J., Lohmann, G.P., and Moullade, M. (Eds.), 1998 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 159  

E-Print Network [OSTI]

basins. Warm surface water flows to the west in the South Equatorial Current system, which piles warm water against Brazil and removes it from the West Afri- can Bight, allowing cold subsurface waters over the western basins (Hay and Brock, 1992; Hisard and Merle, 1980; Peterson and Stramma, 1991

218

' '& ('0)1"2$3 46587@9BACACDFEHGPIRQS7UTWVYX`AaSbdcefEHGhgpiRGPD!qhrhrhq'st70GPTuA`58A`GP9BA  

E-Print Network [OSTI]

This volume contains the research papers presented at the XML Finland 2002 conference in Helsinki, Finland, October 21-22, 2002 ­ the seventh annual conference organized by the XML Finland Association. The themes before. After the previous XML Finland conference in 2001, the feedback from the XML Finland Association

Hyvönen, Eero

219

Cholesterol-Dependent Membrane Fusion Induced by the gp41 Membrane-Proximal External RegionTransmembrane Domain Connection Suggests a Mechanism for Broad HIV-1 Neutralization  

Science Journals Connector (OSTI)

...monitored using the resonance energy transfer assay described...pCMV8.91, encoding a green fluorescent protein and...2 (blue), 5 (green), or 10 (orange...the associated elastic energy would relax in the course...1981. Use of resonance energy transfer to monitor membrane...

Beatriz Apellniz; Edurne Rujas; Pablo Carravilla; Jos Requejo-Isidro; Nerea Huarte; Carmen Domene; Jos L. Nieva

2014-09-10T23:59:59.000Z

220

Access of Antibody Molecules to the Conserved Coreceptor Binding Site on Glycoprotein gp120 Is Sterically Restricted on Primary Human Immunodeficiency Virus Type 1  

Science Journals Connector (OSTI)

...determined by enzyme-linked immunosorbent assay (ELISA) with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, N.Y.) and purified by affinity chromatography with protein A (Pharmacia, Uppsala...

Aran F. Labrijn; Pascal Poignard; Aarti Raja; Michael B. Zwick; Karla Delgado; Michael Franti; James Binley; Veronique Vivona; Christoph Grundner; Chih-Chin Huang; Miro Venturi; Christos J. Petropoulos; Terri Wrin; Dimiter S. Dimitrov; James Robinson; Peter D. Kwong; Richard T. Wyatt; Joseph Sodroski; Dennis R. Burton

2003-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Predicting PVT data for CO2brine mixtures for black-oil simulation of CO2 geological storage  

E-Print Network [OSTI]

trapping mechanism. In the petroleum industry, compositional reservoir simu- lators use EOS thermodynamic Leonenko a a Department of Chemical and Petroleum Engineering, University of Calgary, Canada b Department of Petroleum Engineering, Kuwait University, Kuwait 1. Introduction The sequestration of anthropogenic CO2

Santos, Juan

222

Research Article Evaluation of changes in the Kuwaiti prawn fishery  

E-Print Network [OSTI]

. Introduction Iraq invaded Kuwait in 1990. The Iraqis released 6­8 million barrels of crude oil into the Arabian and 500 km of coastline were covered by oil (Al-Yamani et al., 1993). The Iraqis also set 604 of Kuwait's oil wells on fire (Al-Awadi, 1992). The oil well fires lasted for eight months, and the conse- quent

Chen, Yong

223

Record Alewife Harvest Hikes U.S. Great Lakes Commercial Fish Catch 16 Percent  

E-Print Network [OSTI]

School Set for Persian Gulf Kuwait, Saudi Arabia, Qatar, the United Arab Emirates, and Iran signed a draft agreement on 17 June 1975 in Kuwait to establish a Persian Gulf Regional Center to train captains, and mechanics. Training courses will be in English and Arabic. The Persian Gulf Regional

224

SPECTRUM OF SIGNALS VU KIM TUAN  

E-Print Network [OSTI]

a finite-energy signal, and ^f is the signal frequency content. If the signal frequency content ^f vanishes, Kuwait University P.O. Box 5969, Safat 13060, Kuwait. Abstract. Finite-energy high frequency signals the bandwidth of the signal. Conversely, if the signal frequency content ^f vanishes a.e. on a band

Tuan, Vu

225

Effects of pacing site on global and regional left ventricular function in the setting of dyssynchronous heart failure  

E-Print Network [OSTI]

Tachampa K, Ait Mou Y, Farman GP, and Irving TC. MyofilamentTachampa K, Ait Mou Y, Farman GP, and Irving TC. Myofilament

Howard, Elliot Jacob

2011-01-01T23:59:59.000Z

226

Kuwaiti oil sector shows more signs of recovery  

SciTech Connect (OSTI)

This paper reports that Kuwait's oil sector continues to show signs of recovery from the Persian Gulf war. On Mar. 23 Kuwait Petroleum Co. (KPC) loaded the country's first shipment of liquefied petroleum gas for export since the Iraqi invasion in August 1990. In addition, the first shipment of Kuwaiti crude recovered from giant oil lakes formed by hundreds of wild wells sabotaged in the war was to arrive by tanker in Naples, Italy, late last month. The tanker is carrying 210,000 bbl of crude. However, the project to clean up the lakes and recover more oil, undertaken by Bechtel Corp. with Kuwait Oil Co. (KOC), has reached a stand still.

Not Available

1992-04-06T23:59:59.000Z

227

Oil/gas separator for installation at burning wells  

SciTech Connect (OSTI)

An oil/gas separator is disclosed that can be utilized to return the burning wells in Kuwait to production. Advantageously, a crane is used to install the separator at a safe distance from the well. The gas from the well is burned off at the site, and the oil is immediately pumped into Kuwait`s oil gathering system. Diverters inside the separator prevent the oil jet coming out of the well from reaching the top vents where the gas is burned. The oil falls back down, and is pumped from an annular oil catcher at the bottom of the separator, or from the concrete cellar surrounding the well.

Alonso, C.T.; Bender, D.A.; Bowman, B.R. [and others

1991-12-31T23:59:59.000Z

228

Abstract : 148 words Text : 1654 words Tables : 3 References : 29 Pages: 12  

E-Print Network [OSTI]

of the +874 T/A IFN gamma polymorphism with infections in sickle cell disease Joannes MO1 , Loko G2 roger.chout@chu-guadeloupe.fr Keywords: sickle cell, infection, polymorphism, genetic association, cytokine Abbreviated title: IFN gamma polymorphism and sickle cell disease hal-00387081,version1-23May2009

Boyer, Edmond

229

Severe proliferative retinopathy is associated with blood hyperviscosity in sickle cell hemoglobin-C disease but not in sickle cell anemia  

E-Print Network [OSTI]

Severe proliferative retinopathy is associated with blood hyperviscosity in sickle cell hemoglobin-C disease but not in sickle cell anemia Clément Lemaire1 , Yann Lamarre2 , Nathalie Lemonne3 , Xavier Waltz2, Pointe à Pitre, Guadeloupe, France. Running title: Sickle cell disease and retinopathy Corresponding

Paris-Sud XI, Université de

230

Does increased red blood cell deformability raise the risk for osteonecrosis in sickle cell Nathalie Lemonne1  

E-Print Network [OSTI]

1 Does increased red blood cell deformability raise the risk for osteonecrosis in sickle cell Pointe-à-Pitre, 97157 Pointe-à-Pitre, Guadeloupe Running head: Avascular necrosis and sickle cell anemia in sickle cell anemia (SCA) remains unknown. Blood hyper-viscosity has been suggested as a factor involved

Paris-Sud XI, Université de

231

Decreased Hematocrit-To-Viscosity Ratio and Increased Lactate Dehydrogenase Level in Patients with Sickle Cell  

E-Print Network [OSTI]

with Sickle Cell Anemia and Recurrent Leg Ulcers Philippe Connes1,2,3* , Yann Lamarre1,2 , Marie-à-Pitre, Guadeloupe Abstract Leg ulcer is a disabling complication in patients with sickle cell anemia (SCA Dehydrogenase Level in Patients with Sickle Cell Anemia and Recurrent Leg Ulcers. PLoS ONE 8(11): e79680. doi:10

Paris-Sud XI, Université de

232

Hemorheological risk factors of acute chest syndrome and painful vaso-occlusive crisis in children with sickle cell disease  

E-Print Network [OSTI]

in children with sickle cell disease Yann Lamarre1 , Marc Romana1 , Xavier Waltz1 , Marie-Laure Lalanne Guadeloupe Running title: Blood rheology in sickle cell disease Corresponding author: Philippe Connes, Ph and painful vaso-occlusive crises in children with sickle cell anemia and hemoglobin SC disease. Design

Boyer, Edmond

233

IRD/T. Jaffr IRD/M.Dukhan  

E-Print Network [OSTI]

GUYANE ArgentineArgentine Gabon Zimbawe Sri LankaSri Lanka BR?SIL ColombieColombie Togo Inde SyrieSyrie Gabon Togo ?thiopie Guadeloupe Zimbawe L'IRD DANS LE MONDE #12;RAPPORT D'ACTIVIT? ?DITORIAL 2004, date

234

Robustness of the detection probability for the sign detector  

E-Print Network [OSTI]

). . . theta(151)]; a~1, 1); gp 1 o vera=gammaprime(1/a); gp3 overs=gammaprime(3/a); [dfda, dsdaterm, dadthta(1, 1)] ~t(a, k, fo, gp 1 overs, gp3overa); dfdahtt~umint(a, k, dfda); dpda(1, 1)=dsdaterm+dfdaint; dbdp(1, 1)~dp(a, k, fo); a~(1, 2); gp 1 overs...=gammaprime(1/a); gp3overa=gammaprinx;(3/a); [dfda, dsdaterm, dadthta(1, 2)]=faint(a, k, fo, gp 1 o vera, gp3o vera); dfdaint~umint(a, k, dfda); dpda(1, 2)=dsdaterrn+dfdaint; dbdp(1, 2)=findp(age, fo); a~(1, 31); gp 1 overs=gammaprime(1/a); gp3o vera...

Huse, Elizabeth Ann

2012-06-07T23:59:59.000Z

235

105(scaled land 215%)7-22-05  

National Nuclear Security Administration (NNSA)

Guatemala Honduras Hungary India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Laos Latvia Lebanon C A N A D A U N I T E D S T A T...

236

E-Print Network 3.0 - arabia syrian arab Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Saudi-Arabia 162 Japan 69 Taiwan 59 Hong-Kong 31 Kuwait 29 Malaysia 28... Thailand 12 Jordan 11 Colombia 10 Iraq 10 Mexico 10 Nigeria 10 Sri-Lanka 10 Libyan-Arab-Jamahiriya 9...

237

E-Print Network 3.0 - arab jamahirya malaysia Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Saudi-Arabia 162 Japan 69 Taiwan 59 Hong-Kong 31 Kuwait 29 Malaysia 28... Thailand 12 Jordan 11 Colombia 10 Iraq 10 Mexico 10 Nigeria 10 Sri-Lanka 10 Libyan-Arab-Jamahiriya 9......

238

Improving the Water Efficiency of Cooling Production System  

E-Print Network [OSTI]

For most of the time, cooling towers (CTs) of cooling systems operate under partial load conditions and by regulating the air circulation with a variable frequency drive (VFD), significant reduction in the fan power can be achieved. In Kuwait...

Maheshwari, G.; Al-Hadban, Y.; Al-Taqi, H. H.; Alasseri, R.

2010-01-01T23:59:59.000Z

239

Cooling Tower Operation in the Hot and Humid Climates of Arid Zones  

E-Print Network [OSTI]

the performance of the A/C system, increases the fan power and water consumption. The latter is of special concern to Kuwait and other countries in the region where the soft water is produced through seawater desalination....

Al-Bassam, E.; Maheshwari, G. P.; Sebzali, M.

2000-01-01T23:59:59.000Z

240

Fact #664: February 28, 2011 2010 U.S. Petroleum Imports by Country...  

Broader source: Energy.gov (indexed) [DOE]

366 Iraq 429 Mexico 1,263 Kuwait 207 Netherlands 117 Libya 76 Norway 97 Nigeria 1,037 Russia 626 Saudi Arabia 1,090 U.S. Virgin Islands 263 Venezuela 998 United Kingdom 265 Other...

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Applications of COSMIC to Meteorology and Climate Richard A. Anthes  

E-Print Network [OSTI]

the response of the global atmosphere to regional events such as volcanic eruptions, the Kuwait oil fires and physical adjustment mechanisms, the wind fields as well. These improved analyses and forecasts will provide

242

THE HUMAN ANIMAL Unlearning what nature  

E-Print Network [OSTI]

on the Iraqi border in 1991 precisely because Kuwait had oil that Iraq coveted. But knowing that war common triggers are the desires or needs for territory, resources, or mates. Ants are a well

Starks, Philip

243

9 0 A S T R O N O M Y N O W / J U N 2 0 0 2 he current debate over missile defence  

E-Print Network [OSTI]

Saddam Hussein, who set fire to the oil wells in Kuwait and caused an environmental disaster hazardous for peaceful as well as military purposes. Every bit of debris in orbit higher than about 800 km

California at Santa Cruz, University of

244

Glenda Romn Geographic Mapping Technologies, Corp.  

E-Print Network [OSTI]

California Solar Energy Potential Washington Tropical Cyclones National Hurricane Center Weather Monitoring U Conservation Social Conflicts Energy Education Agriculture Economic Recovery Pollution Water Resources & Pipelines Mexico Oil & Gas Leases Gulf of Mexico Well Production Canada Petroleum Resources Kuwait Forest

Gilbes, Fernando

245

Uranium extremophily is an adaptive, rather than intrinsic, feature for extremely thermoacidophilic Metallosphaera species  

Science Journals Connector (OSTI)

...2005 ) Oxidation states of uranium in depleted uranium particles from Kuwait . J Environ...HDTR-09-0300 and National Institutes of Health Grant R01 GM090209-01. The...Supporting Information (PDF) Uranium extremophily is an adaptive...

Arpan Mukherjee; Garrett H. Wheaton; Paul H. Blum; Robert M. Kelly

2012-01-01T23:59:59.000Z

246

An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...geochemical studies of Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of...Middle East models of Jurassic/Cretaceous carbonate systems. SEPM...Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau

247

An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of Petroleum...Mauddud Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...examples from Abu Dhabi and the Amu Darya Basin. Marine and Petroleum Geology...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau

248

Importance of Design Conditions for Sizing Air-Conditioning Plant  

E-Print Network [OSTI]

Design conditions based on the meteorological data collected at two weather stations located less than 10 km away from each other within Kuwait City are presented for dry-bulb temperature (DBT) and web-bulb temperature (WBT) prioritization...

Shaban, N.; Maheshwari, G. P.; Suri, R. K.

2000-01-01T23:59:59.000Z

249

NONLINEARITY AND MARKET EFFICIENCY IN GCC STOCK MARKETS  

E-Print Network [OSTI]

): Bahrain, Kuwait, Oman, Qatar, Saudi Arabia, and the United Arab Emirates (UAE), using three robust and highly regarded nonlinearity tests. In addition, the Efficient Market Hypothesis (EMH) was tested in this dissertation for the GCC stock markets using...

Alharbi, Abdullah M. H.

2009-07-31T23:59:59.000Z

250

Positive pressure induced channeled suction cups  

E-Print Network [OSTI]

Leaking in water pipe is a critical issue in Middle Eastern countries such as Kuwait where water is scarce. In-pipe robots can be dispatched to discover the network and inspect the inner surface of the pipe. This thesis ...

Yang, Shannon X. (Shannon Xuan)

2013-01-01T23:59:59.000Z

251

TABLE23.CHP:Corel VENTURA  

Gasoline and Diesel Fuel Update (EIA)

II-Imports of Crude Oil and Petroleum Products by Country of Origin, a January 1998 Arab OPEC ... 6,219 0 0 0 0 0 0 0 0 0 Kuwait...

252

Oil and gas developments in Middle East in 1983  

SciTech Connect (OSTI)

Petroleum production in Middle East countries during 1983 totaled 4,275,054,000 bbl (an average rate of 11,712,476 BOPD), down 3.7% from the revised total of 4,440,841,000 bbl produced in 1982. Iran, Kuwait, the Kuwait-Saudi Arabia Divided Neutral Zone, and Oman had significant increases. Saudi Arabia, Qatar, and Abu Dhabi had significant decreases. 8 figures, 9 tables.

Hemer, D.O.; Pickford, P.J.

1984-10-01T23:59:59.000Z

253

Middle Cretaceous (Cenomanian Ostracoda from the Wasia Formation of Saudi Arabia  

E-Print Network [OSTI]

producers of oil in of wells from which ostracodes were recovered. Fig. 1. Location 38 39 2 The University of Kansas Paleontological ContributionsPaper 108 Bahrain, Kuwait, and Iraq. (For more strat- igraphic details see Powers and other, 1966; Powers... producers of oil in of wells from which ostracodes were recovered. Fig. 1. Location 38 39 2 The University of Kansas Paleontological ContributionsPaper 108 Bahrain, Kuwait, and Iraq. (For more strat- igraphic details see Powers and other, 1966; Powers...

Al-Furiah, A. A. F.

1983-09-21T23:59:59.000Z

254

Technical and Energy Assessment of Building Integrated Photovoltaic Systems applied to the UAE Office Buildings  

E-Print Network [OSTI]

-33586 Page 936. Available at: http://www.nrel.gov/docs/fy03osti/35645.pdf . ESL-IC-10-10-40 Proceedings of the Tenth International Conference for Enhanced Building Operations, Kuwait, October 26-28, 2010 ... of the Tenth International Conference for Enhanced Building Operations, Kuwait, October 26-28, 2010 References [1] Abu Dhabi Water & Electricity Company (ADWEC). 2009. See: http://www.adwec.ae/maps_graphs/ [2] Kumar K, Sharma SD, Jain L, 2007. Stand...

Radhi, H.

2010-01-01T23:59:59.000Z

255

First mideast capacity planned  

SciTech Connect (OSTI)

Kuwait catalyst Co.`s (KCC) plans to build a hydrodesulfurization (HDS) catalysts plant in Kuwait will mark the startup of the first refining catalysts production in the Persian Gulf region. KCC, owned by a conglomerate of Kuwait companies and governmental agencies, has licensed catalyst manufacturing technology from Japan Energy in a deal estimated at more than 7 billion ($62 million). Plant design will be based on technology from Orient Catalyst, Japan Energy`s catalysts division. Construction is expected to begin in January 1997 for production startup by January 1998. A source close to the deal says the new plant will eventually reach a capacity of 5,000 m.t./year of HDS catalysts to supply most of Kuwait`s estimated 3,500-m.t./year demand, driven primarily by Kuwait National Petroleum refineries. KCC also expects to supply demand from other catalyst consumers in the region. Alumina supply will be acquired on the open market. KCC will take all production from the plant and will be responsible for marketing.

Fattah, H.

1996-11-06T23:59:59.000Z

256

N-Substituted Pyrrole Derivatives as Novel Human Immunodeficiency Virus Type 1 Entry Inhibitors That Interfere with the gp41 Six-Helix Bundle Formation and Block Virus Fusion  

Science Journals Connector (OSTI)

...approved peptidic human immunodeficiency virus type 1 (HIV-1) fusion inhibitor, T-20 (Fuzeon; Trimeris Inc...NB-2 and NB-64 on HIV-1-mediated cell-cell fusion Fusion type Mean inhibitory activity SD a of: NB-2 NB-64...

Shibo Jiang; Hong Lu; Shuwen Liu; Qian Zhao; Yuxian He; Asim K. Debnath

2004-11-01T23:59:59.000Z

257

A Novel Human Cytomegalovirus Glycoprotein, gpUS9, Which Promotes Cell-to-Cell Spread in Polarized Epithelial Cells, Colocalizes with the Cytoskeletal Proteins E-Cadherin and F-Actin  

Science Journals Connector (OSTI)

...solubility. Immunofluorescence laser scanning confocal microscopy...of human fibroblasts (HF) in culture (reviewed...ARPE-19) cells by fusion of the virion envelope...Immunofluorescence laser scanning confocal microscopy...cultures of nonpolarized HF (, , ). Since a substantial...

Ekaterina Maidji; Sharof Tugizov; Gerardo Abenes; Thomas Jones; Lenore Pereira

1998-07-01T23:59:59.000Z

258

Antibodies with High Avidity to the gp120 Envelope Protein in Protection from Simian Immunodeficiency Virus SIVmac251 Acquisition in an Immunization Regimen That Mimics the RV-144 Thai Trial  

Science Journals Connector (OSTI)

...Winkelstein, W, Jr , DM Lyman, N Padian, R Grant, M Samuel...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...Li, M , F Gao, JR Mascola, L Stamatatos...E Martinelli, JP McNally, DJ Goode, R Gopaul, J Hiatt...

Poonam Pegu; Monica Vaccari; Shari Gordon; Brandon F. Keele; Melvin Doster; Yongjun Guan; Guido Ferrari; Ranajit Pal; Maria Grazia Ferrari; Stephen Whitney; Lauren Hudacik; Erik Billings; Mangala Rao; David Montefiori; Georgia Tomaras; S. Munir Alam; Claudio Fenizia; Jeffrey D. Lifson; Donald Stablein; Jim Tartaglia; Nelson Michael; Jerome Kim; David Venzon; Genoveffa Franchini

259

The Cytotoxic T-Lymphocyte Response against a Poorly Immunogenic Mammary Adenocarcinoma Is Focused on a Single Immunodominant Class I Epitope Derived from the gp70 Env Product of an Endogenous Retrovirus  

Science Journals Connector (OSTI)

...Kikutani H., Dranoff G., Noelle R. J., Barth R. J., Jr. Protective immunity induced by...H., Pasternack G., Cotter R., Hunt D., Pardoll D. M...Balmain A., Hickman J. A., McNally N. J., Rohas A. M., Mitchison...

Antonio Rosato; Silvia Dalla Santa; Alessia Zoso; Sofia Giacomelli; Gabriella Milan; Beatrice Macino; Valeria Tosello; Paolo Dellabona; Pier-Luigi Lollini; Carla De Giovanni; and Paola Zanovello

2003-05-01T23:59:59.000Z

260

The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...leads to a higher viral susceptibility to plasma antibodies (11). Griffithsin (Grft...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang

2013-06-10T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...as a microbicide. Published ahead of print 10 June 2013 Supplemental material for...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang

2013-06-10T23:59:59.000Z

262

An Affinity-Enhanced Neutralizing Antibody against the Membrane-Proximal External Region of Human Immunodeficiency Virus Type 1 gp41 Recognizes an Epitope between Those of 2F5 and 4E10  

Science Journals Connector (OSTI)

...highest production of IgG1 Z13e1, as determined using ELISA with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, NY) and purified by affinity chromatography with protein A (Pharmacia, Uppsala, Sweden...

Josh D. Nelson; Florence M. Brunel; Richard Jensen; Emma T. Crooks; Rosa M. F. Cardoso; Meng Wang; Ann Hessell; Ian A. Wilson; James M. Binley; Philip E. Dawson; Dennis R. Burton; Michael B. Zwick

2007-02-07T23:59:59.000Z

263

Computationally efficient Gaussian Process changepoint detection and regression  

E-Print Network [OSTI]

Most existing GP regression algorithms assume a single generative model, leading to poor performance when data are nonstationary, i.e. generated from multiple switching processes. Existing methods for GP regression over ...

Grande, Robert Conlin

2014-01-01T23:59:59.000Z

264

I-66 I-67 I-66. Identifying the neural initiation of a movement  

E-Print Network [OSTI]

of the BG. Recordings from acute brain slices demonstrate that GP neurons expressing the calcium binding loops between the GP and striatum "closed" or "open"? COSYNE 2012 83 #12;

Shenoy, Krishna V.

265

Lean transformation and relocation of jet engine assembly operations  

E-Print Network [OSTI]

As part of continuing lean transformation efforts at Pratt & Whitney, the Middletown Engine Center has turned its focus on the GP7000 turbofan engine as a target for lean implementation. Projected increases in GP7000 ...

Hale, Stephen Andrew

2011-01-01T23:59:59.000Z

266

Caribbean-NREL Cooperation | Open Energy Information  

Open Energy Info (EERE)

Anguilla, Antigua and Barbuda, Aruba, Bahamas, Barbados, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Saint Kitts and Nevis, Saint Lucia, Saint Vincent and the Grenadines, Trinidad and Tobago, Turks and Caicos Islands Anguilla, Antigua and Barbuda, Aruba, Bahamas, Barbados, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Saint Kitts and Nevis, Saint Lucia, Saint Vincent and the Grenadines, Trinidad and Tobago, Turks and Caicos Islands UN Region Latin America and the Caribbean References NREL International Program [1] Abstract The National Renewable Energy Laboratory is partnering with Caribbean nations to build Low Carbon Communities in the Caribbean as part of the broader Low Carbon Communities of the Americas program.... The National Renewable Energy Laboratory is partnering with Caribbean nations to build Low Carbon Communities in the Caribbean as part of the broader Low Carbon Communities of the Americas program. References

267

$1,000-$9,999 --Individuals David A. Agger '87  

E-Print Network [OSTI]

'11GP Eleanor Grosz and Lawrence J. Zweifach '69 '11P M. Loraine and Ronald P. Guritzky '85 Michael M

Napier, Terrence

268

Animal Studies 4.1 Introduction  

E-Print Network [OSTI]

evoked potential optimization using a GP-BUCB- like algorithm is thus a necessary condition for success

Winfree, Erik

269

Genomic Analysis of Burkholderia And Rhodococcus equi Bacteriophages  

E-Print Network [OSTI]

Bcep1 and the other Bcep781 phages, we can conclude that BcepNY3 is part of the Bcep781 family. 27 TABLE 8. Coding regions of BcepNY3 Gene F/R Function Homology Amino Acid BcepNY3 gp01 R Hyp. conserved Similar... to Bcep1 gp2 MPLIEGKSDKSRSENIRTEVEAGKSPKQAEAI GYAVQRRAQHGADFARDCDMNLRHVMDV AKDYKR BcepNY3 gp02 R Hyp. conserved Similar to Bcep1 gp3 MAGTLTTANSTMYCTTEALFPTAQRIQGYA ADDAFDPDAVENGEYSMGIDGTLSAGFVFN EVPLTITLQADSPSLAQFEQIWMYEFQNRTKL...

Orchard II, Robert C.

2011-08-04T23:59:59.000Z

270

Flipping of cloned d(pCpG)n.d(pCpG)n DNA sequences from right- to left-handed helical structure by salt, Co(III), or negative supercoiling  

Science Journals Connector (OSTI)

...MATERIALS AND METHODS Plasmid Construction. The octamer d(CpGpCpGpCpGpCpG...after inactivation of ligase by heating at 650C, digested with BamHI...Spinco AnG rotor) in double-sector cells. Absorption scans at...the National Aeronautics and Space Administration. A.N. was...

L J Peck; A Nordheim; A Rich; J C Wang

1982-01-01T23:59:59.000Z

271

Improving the Anti-HIV Potency of Different Compounds through Synergy and Covalent Linkage: Dimerization Studies of CXCL8  

E-Print Network [OSTI]

In the first part of my dissertation we focused on the development of covalently linking compounds that bind gp120 with those that bind gp41 in order to block HIV fusion. We used griffithsin or CD4M33, that both bind to gp120, covalently linked...

Kagiampakis, Ioannis

2011-10-21T23:59:59.000Z

272

Vaccine 29 (2011) 56115622 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

antiviral immunity, the RM were immunized with multimeric HIV clade C (HIV-C) gp160 and HIV Tat. SIV Gag.elsevier.com/locate/vaccine Prime­boost vaccination with heterologous live vectors encoding SIV gag and multimeric HIV-1 gp160 Replication-competent adenovirus Live oral vaccine HIV/AIDS vaccine Multimeric HIV clade C gp160 Prime

Lieberman, Judy

273

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

31 - 18040 of 31,917 results. 31 - 18040 of 31,917 results. Article Secretary of Energy Samuel W. Bodman Meets with U.S. Troops in Kuwait ARIFJAN, KUWAIT - U.S. Secretary of Energy Samuel Bodman and his wife Diane Bodman had dinner and conversed with Pfc. James Clark, Logistics Task Force 28, Capt. Zachary Lange, Headquarters and... http://energy.gov/articles/secretary-energy-samuel-w-bodman-meets-us-troops-kuwait Article Statement from DOE's Chief Spokesperson Andrew Beck Regarding Strategic Petroleum Reserve Oil Deliveries WASHINGTON - Today, September 11, 2008, the U.S. Department of Energy will deliver 130,000 barrels of oil from the Strategic Petroleum Reserve to Placid Oil's Port Allen refinery along a Shell... http://energy.gov/articles/statement-does-chief-spokesperson-andrew-beck-regarding-strategic-petroleum-reserve-oil

274

Oil and Gas Company Oil and Gas Company Address Place Zip Website  

Open Energy Info (EERE)

Company Oil and Gas Company Address Place Zip Website Company Oil and Gas Company Address Place Zip Website Abu Dhabi National Oil Company Abu Dhabi National Oil Company Abu http www adnoc ae default aspx Al Furat Petroleum Company Al Furat Petroleum Company Damascus Syria http www afpc sy com new history htm Dolphin Energy Dolphin Energy Abu Dhabi Trade Center Building Abu Dhabi United Arab Emirates http www dolphinenergy com Public default index htm ExxonMobil ExxonMobil Las Colinas Boulevard Irving Texas http www exxonmobil com Corporate Gazprom Gazprom Nametkina St Moscow Russia http www gazprom com Gulfsands Petroleum Gulfsands Petroleum Cork Street London United Kingdom W1S LG http www gulfsands com s Home asp Kuwait Petroleum Corporation Kuwait Petroleum Corporation Safat Kuwait http www kpc com kw default aspx

275

Oil/gas separator for installation at burning wells  

DOE Patents [OSTI]

An oil/gas separator is disclosed that can be utilized to return the burning wells in Kuwait to production. Advantageously, a crane is used to install the separator at a safe distance from the well. The gas from the well is burned off at the site, and the oil is immediately pumped into Kuwait's oil gathering system. Diverters inside the separator prevent the oil jet coming out of the well from reaching the top vents where the gas is burned. The oil falls back down, and is pumped from an annular oil catcher at the bottom of the separator, or from the concrete cellar surrounding the well.

Alonso, C.T.; Bender, D.A.; Bowman, B.R.; Burnham, A.K.; Chesnut, D.A.; Comfort, W.J. III; Guymon, L.G.; Henning, C.D.; Pedersen, K.B.; Sefcik, J.A.; Smith, J.A.; Strauch, M.S.

1993-03-09T23:59:59.000Z

276

Essays on Forecasting and Hedging Models in the Oil Market and Causality Analysis in the Korean Stock Market  

E-Print Network [OSTI]

(Angola), Oriente (Ecuador), Iran Heavy (Islamic Republic of Iran), Basra Light (Iraq), Kuwait Export (Kuwait), Es Sider (Libya), Bonny Light (Nigeria), Qatar Marine (Qatar), Arab Light (Saudi Arabia), Murban (UAE) and Merey (Venezuela). OPEC collects...-1 and 5-3-2, may also be utilized for crack spread margins. Especially, the 2-1-1 crack spread, signifying that two barrels of crude yield a barrel each of gasoline and heating oil, is a better description of the case of heavy crude oils like OPEC basket...

Choi, Hankyeung

2012-10-19T23:59:59.000Z

277

Oil flow resumes in war torn onshore Neutral Zone  

SciTech Connect (OSTI)

Oil production has resumed in the war ravaged onshore fields of the Neutral Zone between Saudi Arabia and Kuwait 1 year after the end of Persian Gulf War. Initial production of about 40,000 b/d is expected to rise to 60,000 b/d by year end. This paper reports that prior to the January-February 1991 war to oust occupying Iraqi military forces from Kuwait, the Neutral Zone's Wafra, South Umm Gudair, and South Fuwaris onshore fields produced about 135,000 b/d.

Not Available

1992-03-09T23:59:59.000Z

278

Oil and gas developments in Middle East in 1985  

SciTech Connect (OSTI)

Petroleum production in Middle East countries during 1985 totaled 3,837,580,000 bbl (an average rate of 10,513,917 BOPD), down 2.2% from the revised 1984 total of 3,924,034,000 bbl. Iran, Iraq, Dubai, Oman, and Syria had significant increases; Kuwait, Kuwait-Saudi Arabia Divided Neutral Zone, Saudi Arabia, and Qatar had significant decreases. New fields went on production in Iraq, Abu Dhabi, Oman, and Syria. In North Yemen, the first ever oil production in that country was nearing the start-up stage at year end. 9 figures, 9 tables.

Hemer, D.O.; Gohrbandt, K.H.A.

1986-10-01T23:59:59.000Z

279

EIA-800  

U.S. Energy Information Administration (EIA) Indexed Site

GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP118","=Part3!$D$23","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP125","=Part3!$D$16","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP127","=Part3!$D$17","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP130","=Part3!$D$21","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP138","=Part3!$D$26","Whole number: 0 - 100,000","Value must be between 0 and 100,000."

280

Topics In Primitive Roots  

E-Print Network [OSTI]

This monograph considers a few topics in the theory of primitive roots g(p) modulo a prime p>=2. A few estimates of the least primitive roots g(p) and the least prime primitive roots g^*(p) modulo p, a large prime, are determined. One of the estimate here seems to sharpen the Burgess estimate g(p) 0, to the smaller estimate g(p) 2. The expected order of magnitude is g(p) 1 constant. The corresponding estimates for least prime primitive roots g^*(p) are slightly higher. Anotrher topic deals with an effective lower bound #{p > x/log x for the number of primes p 1. The current results in the literature claim the lower bound #{p > x/(log x)^2, and have restrictions on the minimal number of fixed integers to three or more.

N. A. Carella

2015-01-23T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Structure of the Ebola Virus Glycoprotein Bound to An Antibody From a Human Survivor  

SciTech Connect (OSTI)

Ebola virus (EBOV) entry requires the surface glycoprotein (GP) to initiate attachment and fusion of viral and host membranes. Here we report the crystal structure of EBOV GP in its trimeric, pre-fusion conformation (GP1+GP2) bound to a neutralizing antibody, KZ52, derived from a human survivor of the 1995 Kikwit outbreak. Three GP1 viral attachment subunits assemble to form a chalice, cradled by the GP2 fusion subunits, while a novel glycan cap and projected mucin-like domain restrict access to the conserved receptor-binding site sequestered in the chalice bowl. The glycocalyx surrounding GP is likely central to immune evasion and may explain why survivors have insignificant neutralizing antibody titres. KZ52 recognizes a protein epitope at the chalice base where it clamps several regions of the pre-fusion GP2 to the amino terminus of GP1. This structure provides a template for unraveling the mechanism of EBOV GP-mediated fusion and for future immunotherapeutic development.

Lee, J.E.; Fusco, M.L.; Hessell, A.J.; Oswald, W.B.; Burton, D.R.; Saphire, E.O.

2009-05-20T23:59:59.000Z

282

Technical matters The practice and politics of geo-referencing  

E-Print Network [OSTI]

, Energy & Resources Group 2010 Association of American Geographers Annual Meeting #12;Laos? China Google, China, South Korea, Japan, Saudi Arabia Kuwait and other nations have been buying and leasing huge version of the 19th-century scramble for Africa."1 "A new geopolitics of hunger" 2 1. The Guardian UK, 22

Wright, Dawn Jeannine

283

Conceptual Framework for the Use of Fish Parasites as Bioindicators of Acute and Chronic  

E-Print Network [OSTI]

Environmental Perturbation After the 2010 Deepwater Horizon Oil Spill in the Gulf of Mexico 1Auburn University: Yucatan, Gulf of Mexico- exploratory oil well Ixtoc explodes, sinks (10.8, 5%) March 24th, 1989: Prince: Gulf of Mexico- oil tanker Megaborg fire (378, 189%) January 21st, 1991: Kuwait- Gulf War I, Iraqi

Kane, Andrew S.

284

Word Pro - S11  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

2.825 2.650 0.360 2.420 1.553 10.140 2.820 2.300 Canada China Egypt Mexico Norway Russia United Kingdom United States Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria...

285

INAMO #47 GolfStaaten-Gulf countries (Artikel * 2006) Beaugrand, Claire Nationalitt und Migration in den Golfstaaten  

E-Print Network [OSTI]

started to flock first to Bahrain where oil export began as early as in 1934, then Saudi Arabia, Kuwait, published in "INAMO 47 (2006) 10-14" #12;2 issue of oil revenues' distribution, affected the forms of movement control that were opted for, as well as the types of nationality issues that derived from it

Paris-Sud XI, Université de

286

A Concept from a Concern: THE ARCTIC EMERGENCY  

E-Print Network [OSTI]

oil well fires in Kuwait) WHAT IS THE ISSUE? #12;0000 - 4 MANY RELEVANT AND RECENT NEWS STORIES (particularly if oil is involved) What happens in (or near) one country could well generate a response from well fill that role in several countries, not just his own (recall `Red' Adair, the Texan, who put out

Kuligowski, Bob

287

Transcript of Wilkerson interview Col Lawrence Wilkerson, the chief of staff to former US Secretary of State Colin  

E-Print Network [OSTI]

to sit in Kuwait until the military forces had moved into Baghdad, and then going to Baghdad and other with some oil-field fires, put Ahmed Chalabi or some other similar Iraqi in charge and leave correct in assuming that? Well in the two decision-making processes into which I had the most insight

Colquhoun, David

288

Drilling continues upward momentum  

SciTech Connect (OSTI)

This paper discusses how the drilling recovery that began during the second half of 1989 is continuing into 1990. On top of this, the Iraqi invasion of Kuwait has caused disarray in oil markets, driving up oil prices, and disrupting access to oil supplies. Potentially, this upheaval could lead to an upward spike in worldwide drilling activity.

Moritis, G.

1990-09-24T23:59:59.000Z

289

APPLIED AND ENVIRONMENTAL MICROBIOLOGY, 0099-2240/00/$04.00 0  

E-Print Network [OSTI]

California shrub rhizospheres, as well as two tree-colonizing Rhizobium strains (ATCC 10320 and ATCC 35645 aromatic hydrocarbons (4) and 2,5-dichloro- benzoate (5). In Kuwait, many crop species have been shown to grow in soil containing up to 10% crude oil by weight and to cleanse the rhizosphere of the crude oil

Wood, Thomas K.

290

Smart Operations of Air-Conditioning and Lighting Systems in Government Buildings for Peak Power Reduction  

E-Print Network [OSTI]

During the summer 2007 smart operation strategies for air-conditioning (A/C) and lighting systems were developed and tested in a number of governmental buildings in Kuwait as one of the solutions to reduce the national peak demand for electrical...

Al-Hadban, Y.; Maheshwari, G. P.; Al-Nakib, D.; Al-Mulla, A.; Alasseri, R.

291

A study on the temporal and spatial variability of absorbing aerosols using Total Ozone Mapping Spectrometer and  

E-Print Network [OSTI]

, individual events, such as the Kuwait oil fire and Australian smoke plum, are isolated in individual higher cycle in the two data sets shows that the cycles agree very well both globally and regionally dust and biomass burning source regions, as well as dust transport. Finally, we find that large

292

Preliminary report on: The coastal ecosystems 10 years after the 1991 Gulf War  

E-Print Network [OSTI]

from southern Kuwait to Abu Ali Island were smothered with oil and tar, erasing most of the local plant with solutes, where well degraded oil residues are also extracted and might indicate a high degree of oilPreliminary report on: The coastal ecosystems 10 years after the 1991 Gulf War oil spill by Dr

Damm, Bodo

293

National Center for Atmospheric Research annual report, fiscal year 1991. Report for 1 October 1990-30 September 1991  

SciTech Connect (OSTI)

The National Center for Atmospheric Research (NCAR) annual report for fiscal year 1991 is presented. NCAR's projects for the period included investigations of air pollution from the oil well fires in Kuwait, a solar eclipse, thunderstorms in central Florida, the El Nino current, greenhouse processes, and upper atmosphere phenomena.

Warner, L.

1992-06-01T23:59:59.000Z

294

Second International Conference on Sustainable Construction Materials and Technologies  

E-Print Network [OSTI]

, 2010 Ancona, Italy Sustainable Use of Resources ­ Recycling of Sewage Treatment Plant Water in Concrete trend; leading to water recycling and conservation #12;INTRODUCTION · Freshwater accounts for only 2 · The suitability of using treated wastewater for mixing concrete was evaluated in Kuwait (Al-Ghusain and Terro

Saldin, Dilano

295

Paintball Summer Weather  

E-Print Network [OSTI]

Highlights · Paintball · Summer Weather · Birthdays · Manners TheELIWeekly Paintball! Come out France Iraq Japan Korea Kuwait Libya Netherlands Niger Peru Qatar Saudi Arabia Spain Taiwan Thailand Turkey United States Venezuela Summer Weather Safety We've come to realize in the past that not all

Pilyugin, Sergei S.

296

2011 Korean Government Scholarship Program Guideline for International Students  

E-Print Network [OSTI]

, Egypt, Ethiopia, Fiji, France, Gabon, Georgia, Ghana, Greece, Guatemala, Guinea, Honduras, Hungary, Iran, Bangladesh, Democratic Republic of the Congo, Egypt, Fiji, Gabon, Greece, Guatemala, Kenya, Kuwait, Malaysia-Leste, Ecuador, El Salvador, Egypt, Ethiopia, Fiji, France, Gabon, Germany, Greece, Hungary, Iran, Jamaica

Auckland, University of

297

The unstable Gulf, Threats from within  

SciTech Connect (OSTI)

Martin offers an analysis of disputes along the borders of countries in the Persian Gulf region and a description of the religious, ethnic, and ideological tensions among the peoples. The pros and cons of various options for protecting American interests are outlined. The discussion covers Iran, Iraq, Kuwait, North and South Yemen, Oman, Soudi Arabia, U.A.E., Bahrain, and Qatar.

Martin, L.G.

1984-01-01T23:59:59.000Z

298

York research doubles  

SciTech Connect (OSTI)

This article addresses the performance of independent energy company stocks for the first quarter of 1991. Some factors discussed include the successful campaign in the Persian Gulf region, anticipation of contracts for rebuilding of Kuwait, successful bidding by companies for future work and product sales, and analysts recommendation of companies as good investments.

Gadomski, C.

1991-04-01T23:59:59.000Z

299

The Oil Market Caught between Economics and Politics: The Persian Gulf Crisis  

Science Journals Connector (OSTI)

The Gulf crisis began on the night of Wednesday 1st1990 with the invasion of Kuwait by Iraqi military forces. It ended at dawn on February 28th 1991 with U.S. President George Bushs announcement of the order f...

Alberto Cl

2000-01-01T23:59:59.000Z

300

OPEC's Dr. Subroto examines the market after Gulf war  

SciTech Connect (OSTI)

This paper reports on a relatively strong oil market emerging from the Persian Gulf war according to an Opec spokesperson. Opec is expected to remain a viable force, perhaps more cohesive than before, no matter what happens to Kuwait and Iraq.

Not Available

1991-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Iraq cracks a few heads in the Gulf  

SciTech Connect (OSTI)

Last month Saddam Hussein charged that oil overproduction by his neighbors was costing Iraq dearly. When an OPEC meeting collapsed last week, he sent 100,000 troops to seize Kuwait, which he had accused of stealing oil. The US is scrambling to organize a Western boycott, but some analysts question just how effective such a more would be.

Bernstein, J.

1990-08-20T23:59:59.000Z

302

Gravity of world crude barrel to rise by 1995  

SciTech Connect (OSTI)

This paper reports on the loss of crude exports from Iraq and Kuwait in 1990-91 and their gradual reentry into oil markets which will have a profound effect on world crude quality. Accordingly, the proportion of heavy crude in world markets will decline the next 5 years.

Not Available

1991-12-16T23:59:59.000Z

303

Dar al-Handasah Article for the in progress Dictionnary of Transnational History, A. Iriye& P.Y  

E-Print Network [OSTI]

in oil price led to weakening in the oil states' economy. The recent trend towards liberalizationDar al-Handasah Article for the in progress Dictionnary of Transnational History, A. Iriye& P familial businesses. It grew on commissions in Kuwait and later, Saudi Arabia. There, oil was providing

Paris-Sud XI, Université de

304

The Genetic Structure of the Kuwaiti Population: Mitochondrial DNA Markers  

E-Print Network [OSTI]

Families Migration: .......................................................................................... 20 Oil Discovery & its Impact:....................................................................................... 22 Genetic Structure... populations of the Arabian Peninsula (Abu-Amero et al. 2008; Alshamali et al. 2009; Beyin 2006; Carter 2006; Rose 2007). The Arabian Peninsula consists of seven countries: Yemen, Saudi Arabia, United Arab Emirates, Qatar, Bahrain, Kuwait, and Jordan (Rose...

Theyab, Jasem

2010-06-14T23:59:59.000Z

305

Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution in Mega Cities Sundar A. Christopher 1; J.Wang1; P. Gupta 1; M.A. Box2; and G.P. Box2  

E-Print Network [OSTI]

Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution, consistent, and cost-effective way for monitoring air pollution. Using Terra/Aqua data, we demonstrate matter, or aerosols, reduce visibility, affect human health, and also cause several ecological effects

Wang, Jun

306

4/25/11 12:32 PMThe Canadian Press: Scientists searching for 'soot-print' in the Arctic; black carbon coating seen as causing melt Page 1 of 2http://www.google.com/hostednews/canadianpress/article/ALeqM5gpZC2HL9mLKe_nwaOPhaSQPdnuUg?docId=6621785  

E-Print Network [OSTI]

the atmosphere by absorbing heat from the sun, explained Quinn, who works in NOAA's Pacific Marine Environmental with Quinn, likened the process to wearing a black shirt on a sunny day. "If you want to be cooler, you would wear a light-colored shirt that would reflect t

Rigor, Ignatius G.

307

Induction of Antimicrobial Pathways during Early-Phase Immune Response to Salmonella spp. in Murine Macrophages: Gamma Interferon (IFN-?) and Upregulation of IFN-? Receptor Alpha Expression Are Required for NADPH Phagocytic Oxidase gp91-Stimulated Oxidative Burst and Control of Virulent Salmonella spp.  

Science Journals Connector (OSTI)

...in our J774.2 model system agrees with previous...with IFN- (E) high-power image of 14028 phoP mutant-infected...with IFN- (H) high-power image of wild-type...the reticuloendothelial system. Infect. Immun. 62...Newburger. 1990. Restoration of phagocyte function...

N. Foster; S. D. Hulme; P. A. Barrow

2003-08-01T23:59:59.000Z

308

Rate-decline Relations for Unconventional Reservoirs and Development of Parametric Correlations for Estimation of Reservoir Properties  

E-Print Network [OSTI]

? flow rate (qg) and cumulative production (Gp) versus production time (East Tx tight gas well numerical simulation model). ...................................................................................................... 4 1.2 (Log-log Plot): q/Gp... versus production time. Duong model and Modified Duong Model (MDNG ? 2) matches for numerical simulation case (East Tx tight gas well). ........................... 6 1.3 (Log-log Plot): K/Gp ? 1 versus production time. Modified Logistic Growth Model...

Askabe, Yohanes 1985-

2012-10-24T23:59:59.000Z

309

On the well-posedness and scattering for the Gross-Pitaevskii hierarchy via quantum de Finetti  

E-Print Network [OSTI]

We prove the existence of scattering states for the defocusing cubic Gross-Pitaevskii (GP) hierarchy in ${\\mathbb R}^3$. Moreover, we show that an energy growth condition commonly used in the well-posedness theory of the GP hierarchy is, in a specific sense, necessary. In fact, we prove that without the latter, there exist initial data for the focusing cubic GP hierarchy for which instantaneous blowup occurs.

Thomas Chen; Christian Hainzl; Natasa Pavlovic; Robert Seiringer

2014-03-27T23:59:59.000Z

310

QER Public Meeting in Denver, CO: Gas-Electricity Interdependencies...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force - Written Statement Joe M. Holmes,...

311

Quadrennial Energy Review  

Energy Savers [EERE]

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force * Joe M. Holmes, Lead Energy Trader,...

312

Interaction of lopinavir with MDR1, MRP1 and MRP2 efflux proteins  

E-Print Network [OSTI]

either by decreasing the total intracellular retention of drugs or redistributing intracellular accumulation of drugs away from target organelles. INHIBITORS USED ? MRP family transporters were selectively inhibited with MK-571, a specific... leukotriene D4 (LTD4) receptor antagonist. MK-571 specifically inhibits at least MRP1 and MRP2, but not P-gp. ? P-gp transporter was selectively inhibited with P-gp 4008, a specific inhibitor of MDR1/P-gp mediated efflux. ? Fumitremorgin-C (FC) is a...

Agarwal, Shankar; Pal, D.; Mitra, A. K.

2006-10-27T23:59:59.000Z

313

unknown title  

E-Print Network [OSTI]

Transcription of the gene encoding melanomaassociated antigen gp100 in tissues and cell lines other than those of the melanocytic lineage

unknown authors

314

HIV Infection and the Central Nervous System: A Primer  

E-Print Network [OSTI]

NMDA receptor inhibition by memantine. Cell Death andopen-channel blocker memantine are ef- fective withoutand gp120: protection by memantine. Annals of Neurology, 47(

Ellis, Ronald J.; Calero, Patricia; Stockin, Michael D.

2009-01-01T23:59:59.000Z

315

Protein, grain and sources of methionine in the nutrition of the laying hen and broiler chick  

E-Print Network [OSTI]

) supplementation (Gp. 7) produced the largest body weight gain while the diet containing only milo (Gp. 1) showed the smallest body weight gain. Hen-da Production: Birds receiving the diet with milo only (Gp, 1) laid significantly less eggs than any other.... When both FM and MHA were added to the milo and corn diets (Gps. 4 & 8) there was a significant improvement only in the group fed the milo diet (Gp. 4) when com- pared to the diets containing only corn and milo (Gps. 1 6 5). ~EW ' ht: MHA and FM...

Ernst, Herbert Lloyd

2012-06-07T23:59:59.000Z

316

Autonomous robotic wheelchair with collision-avoidance navigation  

E-Print Network [OSTI]

range of the two GP2D12 infrared sensors as 70 cm. In Figure 5.1, we can see that the circle is the turning trajectory of the wheelchair turning at an original point. The detecting range of two GP2D12 and three GP2D15 infrared 28 sensors... signal. From some experiments and testing, we set the reaction of the robotic wheelchair in Table 5.1. There are five infrared sensors assembled on the sensor bracket. Two Sharp GP2D12 infrared sensors assembled on the right and left sides as Figure...

Hsieh, Pin-Chun

2008-10-10T23:59:59.000Z

317

Quantitative evaluation of the effect of p-glycoprotein on oral drug absorption  

E-Print Network [OSTI]

Concentration P-gp Expression Level Affinity to P-gp Passive Membrane Permeability Cellular Accumulation Transport Experiments by using P-gp Expressing Cell Monolayers Apical Basal Caco-2 cell? MDR1-MDCK cell ? Permeability ratio Transport Rate = f ( Km, Vmax..., Ppassive ) ?Impact of P-gp on in vivo Oral Drug Absorption? Development of kinetic model that can predict the in vivo absorption of P-glycoprotein substrate drugs from in vitro data. PURPOSE 0 1.0 2.0 3.0 P e r m e a b i l i t y r a t i o ( B L t o A P...

Shirasaka, Yoshiyuki

2006-10-27T23:59:59.000Z

318

E-Print Network 3.0 - african aids vaccine Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

with recombinant gp120 from the MN strain of HIV-1. NIAID AIDS ... Source: Gilbert, Peter - Fred Hutchinson Cancer Research Center & Department of Biostatistics,...

319

E-Print Network 3.0 - anti-myelin-associated glycoprotein peripheral...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Medicine 7 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...

320

E-Print Network 3.0 - arenavirus envelope glycoprotein Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Medicine 22 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

E-Print Network 3.0 - axonal membrane glycoprotein Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Medicine 15 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...

322

A label-free differential quantitative mass spectrometry method for the characterization and identification of protein changes during citrus fruit development.  

E-Print Network [OSTI]

Like RANBP1 RANBP1b RAN3 Rho GDI GP3/ROP4 GDI1 GDI2-likeshowed that two RAB GDI (GDP-RAB dissociation inhibitors),

2010-01-01T23:59:59.000Z

323

E-Print Network 3.0 - abc multidrug efflux Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Oak Ridge National Laboratory Fossil Energy Program Collection: Fossil Fuels 76 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...

324

Children and adolescents deaths from trauma-related causes in a Brazilian City  

E-Print Network [OSTI]

S, Fraga GP: Fatal motorcycle crashes: a serious publicassociated with severity of motorcycle injuries among youngor train, bicycles, or motorcycles), asphyxia/ suffocation,

2013-01-01T23:59:59.000Z

325

Caribbean-GTZ Renewable Energy Program | Open Energy Information  

Open Energy Info (EERE)

Caribbean-GTZ Renewable Energy Program Caribbean-GTZ Renewable Energy Program Jump to: navigation, search Logo: Caribbean-GTZ Renewable Energy Program Name Caribbean-GTZ Renewable Energy Program Agency/Company /Organization Deutsche Gesellschaft für Internationale Zusammenarbeit (GIZ) GmbH Partner German Federal Ministry for Economic Cooperation and Development (BMZ) Sector Energy Topics Background analysis, Policies/deployment programs Website http://www.gtz.de/en/praxis/95 Country Antigua & Barbuda, Aruba, Bahamas, Barbados, Cayman Islands, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Puerto Rico, Saint Barthelemy, St. Kitts & Nevis, St. Lucia, St. Vincent and the Grenadines, Trinidad & Tobago, Turks & Caicos Islands, United States

326

Monitoring-based HVAC Commissioning of an Existing Office Building for Energy Efficiciency  

E-Print Network [OSTI]

GP-21, and GP-23) and three boilers (BR3, BR4 and BR5); thefan BL1 during unoccupied hours 4.2 Boiler performance Thereare three main boilers, labeled as BR3, BR4, and BR5, in the

Wang, Liping

2014-01-01T23:59:59.000Z

327

Antibody-mediated neutralization of Ebola virus can occur by two distinct mechanisms  

SciTech Connect (OSTI)

Human Ebola virus causes severe hemorrhagic fever disease with high mortality and there is no vaccine or treatment. Antibodies in survivors occur early, are sustained, and can delay infection when transferred into nonhuman primates. Monoclonal antibodies (mAbs) from survivors exhibit potent neutralizing activity in vitro and are protective in rodents. To better understand targets and mechanisms of neutralization, we investigated a panel of mAbs shown previously to react with the envelope glycoprotein (GP). While one non-neutralizing mAb recognized a GP epitope in the nonessential mucin-like domain, the rest were specific for GP1, were neutralizing, and could be further distinguished by reactivity with secreted GP. We show that survivor antibodies, human KZ52 and monkey JP3K11, were specific for conformation-dependent epitopes comprising residues in GP1 and GP2 and that neutralization occurred by two distinct mechanisms; KZ52 inhibited cathepsin cleavage of GP whereas JP3K11 recognized the cleaved, fusion-active form of GP.

Shedlock, Devon J., E-mail: shedlock@mail.med.upenn.ed [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Bailey, Michael A., E-mail: mike.bailey@taurigroup.co [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Popernack, Paul M. [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Cunningham, James M. [Department of Medicine, Brigham and Women's Hospital and Harvard Medical School, Boston, MA 02115 (United States); Burton, Dennis R. [Department of Immunology, Scripps Research Institute, La Jolla, CA 92037 (United States); Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037 (United States); Sullivan, Nancy J., E-mail: nsullivan@nih.go [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States)

2010-06-05T23:59:59.000Z

328

Ebola virus-like particles produced in insect cells exhibit dendritic cell stimulating activity and induce neutralizing antibodies  

SciTech Connect (OSTI)

Recombinant baculoviruses (rBV) expressing Ebola virus VP40 (rBV-VP40) or GP (rBV-GP) proteins were generated. Infection of Sf9 insect cells by rBV-VP40 led to assembly and budding of filamentous particles from the cell surface as shown by electron microscopy. Ebola virus-like particles (VLPs) were produced by coinfection of Sf9 cells with rBV-VP40 and rBV-GP, and incorporation of Ebola GP into VLPs was demonstrated by SDS-PAGE and Western blot analysis. Recombinant baculovirus infection of insect cells yielded high levels of VLPs, which were shown to stimulate cytokine secretion from human dendritic cells similar to VLPs produced in mammalian cells. The immunogenicity of Ebola VLPs produced in insect cells was evaluated by immunization of mice. Analysis of antibody responses showed that most of the GP-specific antibodies were of the IgG2a subtype, while no significant level of IgG1 subtype antibodies specific for GP was induced, indicating the induction of a Th1-biased immune response. Furthermore, sera from Ebola VLP immunized mice were able to block infection by Ebola GP pseudotyped HIV virus in a single round infection assay, indicating that a neutralizing antibody against the Ebola GP protein was induced. These results show that production of Ebola VLPs in insect cells using recombinant baculoviruses represents a promising approach for vaccine development against Ebola virus infection.

Ye Ling [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lin Jianguo [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Sun Yuliang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bennouna, Soumaya [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lo, Michael [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Wu Qingyang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bu Zhigao [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Pulendran, Bali [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Compans, Richard W. [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: compans@microbio.emory.edu; Yang Chinglai [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: chyang@emory.edu

2006-08-01T23:59:59.000Z

329

A replication-deficient rabies virus vaccine expressing Ebola virus glycoprotein is highly attenuated for neurovirulence  

SciTech Connect (OSTI)

We are developing inactivated and live-attenuated rabies virus (RABV) vaccines expressing Ebola virus (EBOV) glycoprotein for use in humans and endangered wildlife, respectively. Here, we further characterize the pathogenesis of the live-attenuated RABV/EBOV vaccine candidates in mice in an effort to define their growth properties and potential for safety. RABV vaccines expressing GP (RV-GP) or a replication-deficient derivative with a deletion of the RABV G gene (RV{Delta}G-GP) are both avirulent after intracerebral inoculation of adult mice. Furthermore, RV{Delta}G-GP is completely avirulent upon intracerebral inoculation of suckling mice unlike parental RABV vaccine or RV-GP. Analysis of RV{Delta}G-GP in the brain by quantitative PCR, determination of virus titer, and immunohistochemistry indicated greatly restricted virus replication. In summary, our findings indicate that RV-GP retains the attenuation phenotype of the live-attenuated RABV vaccine, and RV{Delta}G-GP would appear to be an even safer alternative for use in wildlife or consideration for human use.

Papaneri, Amy B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)] [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Wirblich, Christoph [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States)] [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Cann, Jennifer A.; Cooper, Kurt [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States)] [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Jahrling, Peter B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States) [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Schnell, Matthias J., E-mail: matthias.schnell@jefferson.edu [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Jefferson Vaccine Center, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Blaney, Joseph E., E-mail: jblaney@niaid.nih.gov [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)

2012-12-05T23:59:59.000Z

330

Ebola Virus Glycoproteins Induce Global Surface Protein Down-Modulation and Loss of Cell Adherence  

Science Journals Connector (OSTI)

ARTICLE PATHOGENESIS AND IMMUNITY Ebola Virus Glycoproteins Induce Global Surface...Philadelphia, Pennsylvania 19104-6076 The Ebola virus envelope glycoprotein (GP) derived...rounding and detachment in 293T cells, Ebola virus GP did not cause an increase in cell...

Graham Simmons; Rouven J. Wool-Lewis; Frdric Baribaud; Robert C. Netter; Paul Bates

2002-03-01T23:59:59.000Z

331

A simple approach to lifetime learning in genetic programming-based symbolic regression  

Science Journals Connector (OSTI)

Genetic programming GP coarsely models natural evolution to evolve computer programs. Unlike in nature, where individuals can often improve their fitness through lifetime experience, the fitness of GP individuals generally does not change during their ... Keywords: Genetic programming, hybrid genetic algorithms, lifetime learning, local search, memetic algorithms, symbolic regression

Raja Muhammad Atif Azad; Conor Ryan

2014-06-01T23:59:59.000Z

332

Characterization and Optimization of the Glucan Particle-Based Vaccine Platform  

Science Journals Connector (OSTI)

...GPs, suggesting that the GP platform acts as both an adjuvant and...make an effective vaccine platform that combines adjuvanticity...particle (GP)-based vaccine platform (2). GPs are derived from...Administration. MATERIALS AND METHODS Chemicals and cell culture media. Chemical...

Haibin Huang; Gary R. Ostroff; Chrono K. Lee; Charles A. Specht; Stuart M. Levitz

2013-08-14T23:59:59.000Z

333

Copyright by David J. Hill, 2007 DATA MINING APPROACHES TO COMPLEX ENVIRONMENTAL PROBLEMS  

E-Print Network [OSTI]

small-scale heterogeneity. This research develops an upscaling method based on genetic programming (GP), which facilitates both the GP search and the implementation of the resulting models, and demonstrates and control (QA/QC), focused data collection, and event detection. The second portion of this dissertation

Fernandez, Thomas

334

Phenethyl Isothiocyanate (PEITC) Decreases Specficity Protein (SP) Tanscription Factors through an ROS-dependent Mechanism  

E-Print Network [OSTI]

.................................................................. 8 Gp|{ocvke"ogejcpkuou0............................................................... 8 Pqp/gp|{ocvke"ogejcpkuou....................................................... 10 Positive roles of ROS... rise to ROS involves the addition of two more electrons following the decay of peroxycytochrome P450 resulting in the release of the second oxygen atom in the form of water [20]. A schematic representation of ROS production by CYPs is illustrated...

Guthrie, Aaron S 1987-

2012-12-05T23:59:59.000Z

335

Responding to symptoms suggestive of lung cancer: a qualitative interview study  

E-Print Network [OSTI]

the GP two or more times before referral, during this period they reinterpreted initial symptoms and appraised new symptoms. The meaning given to symptoms changed over time and many became increasingly concerned they may have lung cancer. The GP played a...

Birt, Linda; Hall, Nicky; Emery, Jon; Banks, Jon; Mills, Katie; Johnson, Margaret; Hamilton, Willie; Walter, Fiona M.

2014-01-01T23:59:59.000Z

336

Radiative corrections to lepton-lepton scattering Physik-Department T39, Technische Universitat Munchen, D-85747 Garching, Germany  

E-Print Network [OSTI]

the tree diagrams and the one-loop diagrams. Infrared finiteness of these virtual radiative corrections is achieved (in the standard way) by including soft photon radiation below an energy cut-off . We evaluate discrepancies for the ratio of the proton electric and magnetic form factors Gp E/Gp M as determined

Weise, Wolfram

337

Direct estimation of gas reserves using production data  

E-Print Network [OSTI]

Virginia Well A (Fetkovich, et al.8): qg versus t ............................................................ 36 4.2 West Virginia Well A (Fetkovich, et al.8): qg versus t and pwf versus t ? Production History Plot... ................................................................................... 36 4.3 West Virginia Well A (Fetkovich, et al.8): Gp versus t ........................................................... 37 4.4 West Virginia Well A (Fetkovich, et al.8): qg versus Gp ......................................................... 38...

Buba, Ibrahim Muhammad

2004-09-30T23:59:59.000Z

338

Experimental infection with Treponema hyodysenteriae in guinea pigs.  

Science Journals Connector (OSTI)

...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...odysenteriae, except in GP inoculated with iso- late B282 and in 16-week-old GP inoculated...

L A Joens; J G Songer; D L Harris; R D Glock

1978-10-01T23:59:59.000Z

339

Regional Drinking Water Security Action research, policy and analysis  

E-Print Network [OSTI]

/ 21 #12;Mograj/Tembhre GP level study and data analysis The Question : Why do stressed villages GP level study and data analysis () December 18, 2012 13 / 21 #12;North Karjat rural regional scheme for Technology Alternatives for Rural Areas, GISE (CSE) IIT-Bombay www.ctara.iitb.ac.in () December 18, 2012 1

Sohoni, Milind

340

Turing Completeness in the Language of Genetic Programming with Indexed Memory  

E-Print Network [OSTI]

Turing Completeness in the Language of Genetic Programming with Indexed Memory Astro Teller GP is combined with the technique of indexed memory, the resulting system is Turing complete little familiarity with either GP or indexed memory. A complete introduction to the topic of traditional

Fernandez, Thomas

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

EIA-816  

U.S. Energy Information Administration (EIA) Indexed Site

BS220","='Parts1-3'!$P$40" BS220","='Parts1-3'!$P$40" "_BS243","='Parts1-3'!$P$36" "_BS247","='Parts1-3'!$P$39" "_BS248","='Parts1-3'!$P$37" "_BS249","='Parts1-3'!$P$38" "_ES220","='Parts1-3'!$X$40" "_ES243","='Parts1-3'!$X$36" "_ES247","='Parts1-3'!$X$39" "_ES248","='Parts1-3'!$X$37" "_ES249","='Parts1-3'!$X$38" "_GP220","='Parts1-3'!$U$40" "_GP243","='Parts1-3'!$U$36" "_GP247","='Parts1-3'!$U$39" "_GP248","='Parts1-3'!$U$37" "_GP249","='Parts1-3'!$U$38" "_GR220","='Parts1-3'!$S$40"

342

Phenylalanines at positions 88 and 159 of Ebolavirus envelope glycoprotein differentially impact envelope function  

SciTech Connect (OSTI)

The envelope glycoprotein (GP) of Ebolavirus (EBOV) mediates viral entry into host cells. Through mutagenesis, we and other groups reported that two phenylalanines at positions 88 and 159 of GP are critical for viral entry. However, it remains elusive which steps of viral entry are impaired by F88 or F159 mutations and how. In this study, we further characterized these two phenylalanines through mutagenesis and examined the impact on GP expression, function, and structure. Our data suggest that F159 plays an indirect role in viral entry by maintaining EBOV GP's overall structure. In contrast, we did not detect any evidence for conformational differences in GP with F88 mutations. The data suggest that F88 influences viral entry during a step after cathepsin processing, presumably impacting viral fusion.

Ou Wu; King, Harlan; Delisle, Josie [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States); Shi Dashuang [Research Center for Genetic Medicine, Children's National Medical Center, George Washington University, Washington, D. C. 20010 (United States); Wilson, Carolyn A., E-mail: carolyn.wilson@fda.hhs.go [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States)

2010-01-05T23:59:59.000Z

343

Neutral zone: World Oil Report 1991  

SciTech Connect (OSTI)

This paper reports on the Neutral Zone between Kuwait and Saudi Arabia, much in the news during the Gulf war, that returned to production in June when offshore output resumed at a rate of 100,000 bpd. By this month, offshore production should have attained near its pre-war level of 250,000 bpd. Because of war damage onshore, production will not be restarted onshore for some time. Neutral Zone oil is jointly owned by Kuwait and Saudi Arabia. Texaco's Getty unit operates some 900 mostly pumping wells in South Umm Gudair, Wafra and South Fawaris onshore fields. However, only about 50 were producing 130,000 bpd last August when Iraqis invaded. Japan's Arabian Oil Co. operates 165 wells-all flowing-in offshore Khafji, Hout and Lulu fields that have a maximum productive capacity of about 300,000 bpd.

Not Available

1991-08-01T23:59:59.000Z

344

Inflatable kill packers used in working over Kuwaiti wells  

SciTech Connect (OSTI)

This paper reports on inflatable packers which are being used with great success in post-well capping workover operations in Kuwait oil fields. In mid-January, about one kill packer was being run per day. Use is expected to increase in March when a second post-capping crew arrives. Of several thousand unconventional ideas submitted to Kuwait Oil Co. (KOC) for controlling the well fires left in the aftermath of lst year's Gulf War, only about a dozen were actually used. Inflatable kill packers, designed and manufactured by Baker Service Tools and marketed by Baker Oil Tools, were one of the ideas that proved effective. The kill packers are modifications of Baker's inflatable packers that have successfully been used in capping producers on many blowouts throughout the world, including the Piper Alpha disaster in the North Sea and the Saga blowout offshore Norway.

Miller, D. (Baker Oil Tools, Houston, TX (US)); Conover, G. (Baker Service Tools, Houston, TX (US))

1992-03-09T23:59:59.000Z

345

The Gulf War and the environment  

SciTech Connect (OSTI)

The Gulf War inflicted dramatic environmental damage upon the fragile desert and shore environments of Kuwait and northeastern Saudi Arabia. Coastal and marine environments experienced oil spills of more than 8 million barrels, which killed wildlife and damaged the fishing industry. In inland Kuwait, hundreds of oil lakes are scattered across the desert surface: these lakes emit noxious gases, drown insects and birds, and may seep to pollute groundwater. Exploding and burning oil wells released soot particles, oil droplets, and noxious chemicals into the atmosphere, spreading air pollution, acid rain, and respiratory problems. Military diggings, constructions, and vehicles have destroyed much of the desert pavement, resulting in increased dust storms and large, moving dunes.

El-Baz, F. (ed.) (Boston Univ., MA (United States). Center for Remote Sensing); Makharita, R.M. (ed.) (World Bank, Washington, DC (United States))

1994-01-01T23:59:59.000Z

346

Nuclear winter from gulf war discounted  

SciTech Connect (OSTI)

Would a major conflagration in Kuwait's oil fields trigger a climate catastrophe akin to the 'nuclear winter' that got so much attention in the 1980s This question prompted a variety of opinions. The British Meteorological Office and researchers at Lawrence Livermore National Laboratory concluded that the effect of smoke from major oil fires in Kuwait on global temperatures is likely to be small; however, the obscuration of sunlight might significantly reduce surface temperatures locally. Michael MacCracken, leader of the researchers at Livermore, predicts that the worst plausible oil fires in the Gulf would produce a cloud of pollution about as severe as that found on a bad day at the Los Angeles airport. The results of some mathematical modeling by the Livermore research group are reported.

Marshall, E.

1991-01-01T23:59:59.000Z

347

Oil spills - increasing US dependence on oil imports heightens risks to environment  

SciTech Connect (OSTI)

Calamitous oil spills in recent years have focused attention on the devastation the world`s leading energy source can wreak on the environment. In Alaska, the 1989 grounding of the supertanker Exxon Valdez in Prince William Sound caused the worst U.S. oil spill ever and promoted Congress to pass stringent oil-pollution legislation. In the Persian Gulf, {open_quotes}eco-terroism{close_quotes} committed by Iraqi forces during the gulf war left hundreds of wells burning and oil free-flowing out of Kuwait`s refineries and oil-shipping terminals. With the United States and much of the global community increasingly dependent on petroleum moved by supertankers, oil spills will continue to threaten the environment for the foreseeable future.

NONE

1992-01-17T23:59:59.000Z

348

Global arms proliferation  

SciTech Connect (OSTI)

This paper reports that the United States delivered some US $11 billion of military hardware to Iran between 1969 and 1979, in the hopes of helping stabilize a volatile situation in the Middle East. That did not work. When Iran used the weapons against Iraq, the USSR, France, and a number of developing countries helped arm Iraq. It was this vast arsenal that Iraq deployed in its Kuwait-Persian Gulf War venture. Granted, those weapons were augmented by some U.S.-made equipment like TOW antitank missiles and Hawk antiaircraft missiles that were captured in the Iraqi attack on Kuwait. A report issued by the U.S. Office of Technology Assessment (OTA) in June cited that chain of events to demonstrate that the U.S. and other major exporters are gradually losing control of the weapons transferred (to other countries) as well as the technology and industry necessary to produce and support them.

Christiansen, D.

1991-09-01T23:59:59.000Z

349

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

2 2 September 2013 Table 42. PAD District 2 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 1,083 - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - - - - - - - - - Nigeria ................................

350

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

8 8 September 2013 Table 46. PAD District 2 - Year-to-Date Imports of Crude Oil and Petroleum Products by Country of Origin, January-September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 11,451 - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. 949 - - - - - - - - - Libya ...................................

351

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

58 58 September 2013 Table 41. PAD District 1 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 12,102 - - - - - - - 2,112 2,112 Algeria ................................ - - - - - - - - - - Angola ................................ 3,271 - - - - - - - - - Ecuador .............................. - - - - - - - - 160 160 Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... 1,046

352

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

0 0 September 2013 Table 44. PAD District 4 and 5 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total PAD District 4 OPEC ..................................... - - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - -

353

Validating the unified theory of acceptance and use of technology in Kuwaiti ministries: a structural equation modelling approach  

Science Journals Connector (OSTI)

The purpose of this article is to describe a test of the validity of the unified theory of acceptance and use of technology (UTAUT) model by applying it to Kuwaiti ministries. Structural equation modelling methods were used to test the relationships ... Keywords: ISU acceptance, Kuwait, UTAUT, developing countries, information systems usage, structural equation modelling, technology acceptance, technology use, unified theory of acceptance and use of technology

Helaiel Almutairi

2009-03-01T23:59:59.000Z

354

Middle East  

SciTech Connect (OSTI)

Petroleum production in Middle East countries during 1980 totaled 6,747,719,000 bbl or an average rate of 18,436,390,000 bbl/d, down 13.9% from 1979. Increases were in Saudi Arabia and Syria. Significant decreases occurred in Iraq, Iran, Kuwait, and Turkey. New discoveries were made in Abu Dhabi, Iran, Saudi Arabia, Sharjah, and Oman. New areas were explored in Bahrain, Oman, Syria, and Yemen. 9 figures, 16 tables.

Hemer, D.O. (Mobil Oil Corp., New York, NY); Mason, J.F.; Hatch, G.C.

1981-10-01T23:59:59.000Z

355

NASA technology applications team. Applications of aerospace technology. Annual Report, Oct. 1990 - Sep. 1991  

SciTech Connect (OSTI)

Discussed here are the activities of the Research Triangle Institute (RTI) Technology Applications Team for the period 1 October 1990 through 30 September 1991. Topics researched include automated data acquisition and analysis of highway pavement cracking, thermal insulation for refrigerators, the containment of paint removed from steel structures, improved technologies for Kuwait oil well control, sprayed zinc coatings for corrosion control of reinforcing steel in bridges, and the monitoring and life support of medically fragile children in the educational setting.

Not Available

1991-01-01T23:59:59.000Z

356

Oil production triggered by crisis stays on stream throughout '91  

SciTech Connect (OSTI)

This paper reports on worldwide production of crude oil and lease condensate that declined slightly in 1991 due to sagging demand. With Kuwait and Iraq still producing negligible volumes, there was little spare production capacity. But the replacement capacity pressed into use during the Persian Gulf crisis proved its durability by remaining on stream throughout the year. Reserves declined marginally. Most reserves changes reflected estimates by governments of some producing countries.

Not Available

1991-12-30T23:59:59.000Z

357

Methods of monitoring the Persian Gulf oil spill using digital and hardcopy multiband data. Technical report, January-July 1991  

SciTech Connect (OSTI)

A quick response demonstration was performed during the Persian Gulf War that showed a capability to monitor the path of oil dumped into the bay near Kuwait City using commercial satellite imagery. Both manual and semi-automated methods of image analysis were performed on AVHRR and Landsat TM imagery. Estimates of the oil area coverage were obtained using conventional classification methods. A hardcopy generation and reproduction capability was also demonstrated.

Rand, R.S.; Satterwhite, M.B.; Davis, D.A.; Anderson, J.E.

1992-08-01T23:59:59.000Z

358

Iraq and the utilities  

SciTech Connect (OSTI)

This article discusses the possible impact on the public utilities of the invasion of Kuwait by Iraq. The author feels the industry is in better shape to weather this than the energy crisis of 1973 and 1974. However regulatory policies that prohibit some utilities from recovering fuel costs through rate adjustments may cause distress for some. The author feels that a revision of regulatory policies is needed.

Studness, C.M.

1990-09-13T23:59:59.000Z

359

Essays in Empirical Macroeconomics: Applications to the GCC Monetary Union  

E-Print Network [OSTI]

.............................................................................................................50 Figure 3.1: Impulse Response Functions to an Oil Price Shock........................................84 Figure 3.2: Impulse Response Functions to an Oil Production Shock..............................85 Figure 3.3: Impulse Response Functions to a... of the GCC area. I then outline the essential motivations and research objectives of this dissertation. 1 Characteristics of the GCC Area 1.1 Historical Background In May 1981, the six Head of States of Bahrain, Kuwait, Oman, Qatar, Saudi Arabia...

Al-Hassan, Abdullah Mohammed

2008-01-01T23:59:59.000Z

360

US Government Outsourcing, the Private Military Industry, and Operation Iraqi Freedom: A Case Study in Conflict Contracting  

E-Print Network [OSTI]

prosperous decade for Iraq. Living standards rose for most Iraqis, in large part due to rapidly increasing oil revenues. Saddam Hussein officially assumed the presidency of Iraq in 1979 under the Baath Party, and in 1980 Iraq invaded Iran, waging a war... Iran would cost Iraq more than its oil revenues totaled during those eight years of conflict.55 Hussein then led the country into another unsuccessful war, this time against Kuwait, in 1990. The invasion was considered an attempt to augment state...

Halpin, Allison Ann

2011-12-31T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Economy key to 1992 U. S. oil, gas demand  

SciTech Connect (OSTI)

This paper provides a forecast US oil and gas markets and industry in 1992. An end to economic recession in the U.S. will boost petroleum demand modestly in 1992 after 2 years of decline. U.S. production will resume its slide after a fractional increase in 1991. Drilling in the U.S. will set a record low. Worldwide, the key questions are economic growth and export volumes from Iraq, Kuwait, and former Soviet republics.

Beck, R.J.

1992-01-27T23:59:59.000Z

362

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

PAD District 2 - Imports of Crude Oil and Petroleum Products by Country of Origin, 2012 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 15,713 - - - - - - - - - Algeria ................................ 4,074 - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - - - - - - - - - Nigeria ................................

363

Petroleum Supply Annual  

U.S. Energy Information Administration (EIA) Indexed Site

8.PDF 8.PDF Table 28. PAD District 2 - Imports of Crude Oil and Petroleum Products by Country of Origin, January 2012 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 1,764 - - - - - - - - - Algeria ................................ 1,043 - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - - - - - - - - - Nigeria ................................

364

A metaheuristic approach for location of gas stations in a metropolitan area  

Science Journals Connector (OSTI)

The paper presents a metaheuristic model, which is developed to determine the location of gas stations in the state of Kuwait. The variables of this study cover requirements to high demand areas such as commercial areas, businesses as well as safety and environmental factors translated into minimum distances to sensitive entities and receptors. The developed methodology combines GIS with analytic hierarchy process (AHP) to weigh and overlay layers of interest on the base map of urban and suburban areas in Kuwait. The output on this process is a suitability map that contains feasible locations for future gas stations sites. Feasible locations are then fed into an optimisation routine to obtain the optimal sites. The methodology includes international and national standards and regulation including minimum allowable distance to existing gas stations, natural gas distributors, fire stations, educational institutions, governmental agencies and ministries, airport, residential areas, commercial areas, industrial areas, road network and others. 199 feasible locations were obtained in the State of Kuwait that abide with all regulation while satisfying demand of businesses and residents. The optimum was obtained from these feasible solutions by using an optimisation routine.

Esra Aleisa; Mehmet Savsar; Mohammed M. Al-Mashaan; Abrar Al-Jadi; Sarah A. Al-Sabah

2014-01-01T23:59:59.000Z

365

Turnabout. Final report  

SciTech Connect (OSTI)

The proliferation of ideas and strategies is equally as important as the proliferation of weapons. This paper challenges the reader to search for counters to historically successful strategies which could be turned against the US. Specifically, consider the following scenario: In 1994 Iraq, Syria, Kazakhstan, and Azerbaijan form an alliance called the Southwest Asia Consortium (SAC). In 1996 Iraq invades Kuwait to reclaim its title to the province, and a limited US-led coalition immediately begins to build up a conventional force in the Persian Gulf region. SAC members recognize Iraq's claim to Kuwait and remind the world in a joint statement that an attack on any of its members would be considered an attack on the entire alliance. Furthermore, SAC reserves the right to respond to any attack at an appropriate level, including conventional weapons, battlefield nuclear weapons, intermediate range nuclear missiles or ICBMs. As Iraq prepares a defense of Kuwait with its national forces and token SAC troop deployments, the Consortium's strategy and capability of responding to a potential attack with a full spectrum of weapons confounds America's response to the crisis.

Roggero, F.F.

1993-04-19T23:59:59.000Z

366

LEDSGP/join | Open Energy Information  

Open Energy Info (EERE)

LEDSGP/join LEDSGP/join < LEDSGP Jump to: navigation, search redirect [1] LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us Join Us: Participate in the Partnership There are many ways for you to participate in the LEDS Global Partnership. Become a Member - Instantly build your network In order to become a member and join more than 100 organizations already contributing to the Partnership, please review the LEDS GP operating principles and contact us to us to let us know if you accept these principles. After you contact us noting your acceptance of these principles, we will add you to the LEDS GP distribution list to receive information on LEDS GP activities. We encourage you to join the LEDS GP

367

PlaNet: Combined Sequence and Expression Comparisons across Plant Networks Derived from Seven Species  

Science Journals Connector (OSTI)

...M. , Usadel, B., Schutte, M., Loraine, A., Ebenhoh, O., and Persson...Mehta, T., Coulibaly, I., and Loraine, A.E. (2008). CressExpress: A...Page, G.P., Somerville, C., and Loraine, A. (2006). Transcriptional coordination...

Marek Mutwil; Sebastian Klie; Takayuki Tohge; Federico M. Giorgi; Olivia Wilkins; Malcolm M. Campbell; Alisdair R. Fernie; Björn Usadel; Zoran Nikoloski; Staffan Persson

2011-03-25T23:59:59.000Z

368

Ebola virus RNA editing:Characterization of the mechanism and gene products.  

E-Print Network [OSTI]

??Ebola virus (EBOV) is an enveloped, negative-sense single-stranded RNA virus that causes severe hemorrhagic fever in humans and nonhuman primates. The EBOV glycoprotein (GP) gene (more)

Mehedi, Masfique

2012-01-01T23:59:59.000Z

369

Full-length Ebola glycoprotein accumulates in the endoplasmic reticulum  

Science Journals Connector (OSTI)

The Filoviridae family comprises of Ebola and Marburg viruses, which are known to ... pathogens. The envelope glycoprotein (GP) of Ebola virus, which mediates entry into target cells ... with full-length and muci...

Suchita Bhattacharyya; Thomas J Hope

2011-01-01T23:59:59.000Z

370

DEPARTMENTS:  

Science Journals Connector (OSTI)

......GENERAL PURPOSE HYDROGEN GENERATOR Model 250 GP general purpose hydro- gen generator for laboratory use is...dew point of 0 C at atmospheric pressure for chromato...prevent damage to the generator from low water or excess hydrogen demand......

New Products

1974-08-01T23:59:59.000Z

371

The role of ATP release and autocrine/paracrine P1/P2 receptor signaling in the modulation of neutrophil chemotaxis  

E-Print Network [OSTI]

DA, Beitz LO, Li Z, Lin S, Gout I, Cantley LC, Rawlings DJ,S, Dahl GP. PROBENECID, A GOUT REMEDY, INHIBITS PANNEXIN 1for the treatment of gout, can block pannexin channels (4).

Corriden, Ross

2008-01-01T23:59:59.000Z

372

Sustainable Energy Research Team publications Whittaker, C., Adams, P., McManus, M.C Securing a Bioenergy Supply: UK and US in  

E-Print Network [OSTI]

.C Securing a Bioenergy Supply: UK and US in Perspectives on Biofuels: Potential Benefits and Possible, G.P. McManus, M.C. and Mezzullo, W. G, 2011. Barriers to and drivers for UK bioenergy development

Martin, Ralph R.

373

Structure and stability of Co(II)-complexes formed by wild-type and metal-ligand substitution mutants of T4 gene 32 protein  

E-Print Network [OSTI]

Phage T4 gene 32 protein (gp32) is a zinc metalloprotein that binds cooperatively and preferentially to single-stranded nucleic acids and functions as a replication and recombination accessory protein. We have previously shown that the ZN...

Guo, Juqian

1996-01-01T23:59:59.000Z

374

Functional expression of P-glycoprotein in primary cultures of human cytotrophoblasts and BeWo cells  

E-Print Network [OSTI]

The objective of this study was to investigate the functional expression of the efflux transporter, P-glycoprotein (P-gp), in primary cultures of human cytotrophoblasts and BeWo cell monolayers. Uptake studies with primary ...

Utoguchi, Naoki; Chandorkar, Gurudatt A.; Avery, Michael; Audus, Kenneth L.

2000-01-01T23:59:59.000Z

375

e-journal: Information Technology for Economics & Management  

E-Print Network [OSTI]

as inputs into the 2SLS system of equations. GP is a computerized search algorithm that identifies equations and fuel oil. Lien and Root (1999) estimate a persistence profile of impulse response in natural gas

Fernandez, Thomas

376

The waiting room: vector for health education? the general practitioners point of view  

Science Journals Connector (OSTI)

In the present study, we examined use of the GPs waiting room as a vector for the dissemination of health information. Most waiting rooms have a number of posters on display. Posters are widely used for health p...

Maxine Gignon; Hadjila Idris; Cecile Manaouil; Oliver Ganry

2012-09-01T23:59:59.000Z

377

Environmental Performance Report 2011: Annual Site Environmental...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Announcement FTLB-Field Test Laboratory Building FY-Fiscal Year GHG-Greenhouse Gas GP-Guiding Principles GWP-Global Warming Potential HAP-Hazardous Air Pollutant...

378

Structural Basis for Broad and Potent Neutralization of HIV-1 by Antibody VRC01  

SciTech Connect (OSTI)

During HIV-1 infection, antibodies are generated against the region of the viral gp120 envelope glycoprotein that binds CD4, the primary receptor for HIV-1. Among these antibodies, VRC01 achieves broad neutralization of diverse viral strains. We determined the crystal structure of VRC01 in complex with a human immunodeficiency virus HIV-1 gp120 core. VRC01 partially mimics CD4 interaction with gp120. A shift from the CD4-defined orientation, however, focuses VRC01 onto the vulnerable site of initial CD4 attachment, allowing it to overcome the glycan and conformational masking that diminishes the neutralization potency of most CD4-binding-site antibodies. To achieve this recognition, VRC01 contacts gp120 mainly through immunoglobulin V-gene regions substantially altered from their genomic precursors. Partial receptor mimicry and extensive affinity maturation thus facilitate neutralization of HIV-1 by natural human antibodies.

Zhou, Tongqing; Georgiev, Ivelin; Wu, Xueling; Yang, Zhi-Yong; Dai, Kaifan; Finzi, Andrs; Kwon, Young Do; Scheid, Johannes F.; Shi, Wei; Xu, Ling; Yang, Yongping; Zhu, Jiang; Nussenzweig, Michel C.; Sodroski, Joseph; Shapiro, Lawrence; Nabel, Gary J.; Mascola, John R.; Kwong, Peter D. (NIH); (Rockefeller); (DFCI)

2010-08-26T23:59:59.000Z

379

H-Bridge H-Bridge Relay Differentiator  

E-Print Network [OSTI]

H-Bridge H-Bridge Relay Altera PLD LP Filter LP Filter Differentiator w/LP Filter Differentiator w Supply Voltage Motor H-Bridge Connection Motor Relay Connection FREQ_OUT External Power Supply GP2D12

Wedeward, Kevin

380

Ympristystvllisen katteen suunnittelu shkautoon.  

E-Print Network [OSTI]

??Tss opinnytetyss suunnittelin ympristystvlliset shkauton katteet Saimaan ammattikorkeakoululle. Autoa suunnitteli yhteistyss kanssani kaksi muuta opiskelijaa. Shkauton oli tarkoitus kisata Lappeenranta GPtapahtumassa jrjestetyss Joulella pisimmllekisassa. Tyss (more)

Friman, Chris

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

September 2013 Most Viewed Documents for Renewable Energy Sources...  

Office of Scientific and Technical Information (OSTI)

Corey, G.P. (1996) 76 > PROPERTIES AND PERFORMANCE OF CEMENT-BASED GROUTS FOR GEOTHERMAL HEAT PUMP APPLICATIONS. ALLAN,M.L. (1999) 70 > Solar radiation data manual for flat-plate...

382

Hamilton Paths in Generalized Petersen Graphs.  

E-Print Network [OSTI]

??This thesis puts forward the conjecture that for n > 3k with k > 2, the generalized Petersen graph, GP(n,k) is Hamilton-laceable if n is (more)

Pensaert, William

2006-01-01T23:59:59.000Z

383

E-Print Network 3.0 - androgen-repressed human prostate Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rosenthal, H., Chu, T.M., Mirand, E.A., Murphy, G.P., 1983. LNCaP model of ... Source: Brand, Paul H. - Department of Physiology and Pharmacology, University of Toledo...

384

E-Print Network 3.0 - ani edenes indian Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

parameters to be statically tuned... be written both in the explicitly parallel Eden 2, and in the implicitly parallel GpH 3, developed new... could be parallelized using...

385

Environment  

Science Journals Connector (OSTI)

...CLIMATE C 24 ( 1979 ). BOLIN, B.B., GLOBAL CARBON CYCLE 3 ( 1979...CHEM ENV NEWS 0406 ( 1976 ). FISCHHOFF, B, HANDLING HAZARDS, ENVIRONMENT...1978 ). LOWRANCE, W.W., ACCEPTABLE RISK ( 1976 ). MARSH, G.P., EARTH...

Gilbert F. White

1980-07-04T23:59:59.000Z

386

Consumption-based accounting of CO2 emissions  

E-Print Network [OSTI]

intensity of GDP (energy per unit GDP) and the carbonand per- capita GDP, but also by unanticipated global increases in the energyg = G/P is per-capita GDP, e = E/G is energy intensity of

Davis, S. J; Caldeira, K.

2010-01-01T23:59:59.000Z

387

Improving WRF-ARW Wind Speed Predictions using Genetic Programming  

Science Journals Connector (OSTI)

Numerical weather prediction models can produce wind speed forecasts at a very high space resolution. ... that GP is able to successfully downscale the wind speed predictions, reducing significantly the inherent ...

Giovanna Martinez-Arellano; Lars Nolle

2012-01-01T23:59:59.000Z

388

A comparison of selection and breeding strategies for incorporating wood properties into a loblolly pine (Pinus taeda L.) elite population breeding program  

E-Print Network [OSTI]

at 23 Table 2. Range of full-sib family means (with standard deviations) for wood quality and growth traits in loblolly pine. GP065 GP258 Earlywood 4 MFAa 38.8 3.2 to 43.7 3.3 37.0 3.9 to 41.8 4.7 Latewood 4 MFA 39... at 23 Table 2. Range of full-sib family means (with standard deviations) for wood quality and growth traits in loblolly pine. GP065 GP258 Earlywood 4 MFAa 38.8 3.2 to 43.7 3.3 37.0 3.9 to 41.8 4.7 Latewood 4 MFA 39...

Myszewski, Jennifer Helen

2004-09-30T23:59:59.000Z

389

Valediction Immunocontraception From Romance to Reality  

Science Journals Connector (OSTI)

One of Dr. G.P. Talwars Dramatis Personnae is a male baboon by the name of Hanuman, who successfully inseminated a female baboon by the name of Radha soon after successful termination of a previous pregnancy ind...

V. Ramalingaswami

1986-01-01T23:59:59.000Z

390

) &%102435768!9@ 0A BDCFE!GIHQPSRUTFVWHQE!X`Ybadcfehgdiqpa7CFE4r GIs7Vtc7i!ubaGwvSHQaEWHQadci@CFEWxy8GIsQTFabVWHQE!CFadc  

E-Print Network [OSTI]

!GIHQPSRUTFVWHQE!X`Ybadcfehgdiqp¤a7CFE4r GIs7Vtc7i!uba§GwvSHQa§EWHQadci@CFEWxy8GIsQTFabVWHQE!CFadc cGP7CFE4©1HQ p

Cohen-Or, Daniel

391

Monitoring and Verification Procedures Used in the Texas LoanSTAR and Rebuild America Programs  

E-Print Network [OSTI]

Department of Energy's (USDOE's) 1996 NEMVP, 1997 IPMVP, 2001 IPMVP, ASHRAE's GP 14P, and the 1999 Texas Performance Contracting Guidelines. This paper reviews the basic procedures that are used for monitoring and verifying energy savings in commercial...

Farouz, S.; Baltazar-Cervantes, J. C.; Haberl, J. S.; Claridge, D. E.

2001-01-01T23:59:59.000Z

392

Green Solar | Open Energy Information  

Open Energy Info (EERE)

Solar Solar Place Paris, France Zip 45003 Product Develops and builds PV systems in Guadeloupe and Mauritius. Coordinates 48.85693°, 2.3412° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.85693,"lon":2.3412,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

393

The Risk Assessment Information System  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

RAIS User's Group RAIS User's Group The connection is no longer here Fill out the following section for addition to the RAIS User's List: CONTACT DETAILS First name: * Required Last name: * Required Company: Street: City: State: Country: Anguilla Antigua and Barbuda Aruba Bahamas Barbados Belize Bermuda Virgin Islands, British Canada Cayman Islands Costa Rica Cuba Dominica Dominican Republic El Salvador Falkland Islands (Malvinas) Greenland Grenada Guadeloupe Guatemala Haiti Honduras Jamaica Martinique Mexico Montserrat Netherlands Antilles Nicaragua Panama Puerto Rico Saint Kitts and Nevis Saint Lucia Saint Pierre and Miquelon Saint Vincent and The Grenadines Trinidad and Tobago Turks and Caicos Islands United States United States Minor Outlying Islands Virgin Islands, U.S. Argentina Bolivia

394

Bringing simulation to implementation: Presentation of a global approach in the design of passive solar buildings under humid tropical climates  

E-Print Network [OSTI]

In early 1995, a DSM pilot initiative has been launched in the French islands of Guadeloupe and Reunion through a partnership between several public and private partners (the French Public Utility EDF, the University of Reunion Island, low cost housing companies, architects, energy consultants, etc...) to set up standards to improve thermal design of new residential buildings in tropical climates. This partnership led to defining optimized bio-climatic urban planning and architectural designs featuring the use of passive cooling architectural principles (solar shading, natural ventilation) and components, as well as energy efficient systems and technologies. The design and sizing of each architectural component on internal thermal comfort in building has been assessed with a validated thermal and airflow building simulation software (CODYRUN). These technical specifications have been edited in a reference document which has been used to build over 300 new pilot dwellings through the years 1996-1998 in Reunion...

Garde, Franois; Celaire, Robert

2012-01-01T23:59:59.000Z

395

Atmos. Chem. Phys. www.atmos-chem-phys.net  

E-Print Network [OSTI]

of stratospheric air from MIPAS SF6 measurements Supplement G. P. Stiller1, T. von Clarmann1, M. H¨opfner1, N representative for one month and a 5 latitude bin) are presented. Correspondence to: G.P. Stiller (gabriele.stiller@imk.fzk.de) Published by Copernicus Publications on behalf of the European Geosciences Union. #12;2 G.P. Stiller at al

Meskhidze, Nicholas

396

Pathways to neuronal injury and apoptosis in HIV-associated dementia  

Science Journals Connector (OSTI)

... and apoptosis which is blocked by inhibition of the p38 MAP kinase. The NMDAR antagonist memantine prevents neuronal damage in response to HIV/gp120 in cultured neurons as well as in ... to either HIV-infected macrophages or HIV/gp120, both in vitro and in vivo. Memantine, an open-channel blocker, prevents excessive NMDAR activity while sparing physiological function. Also, ...

Marcus Kaul; Gwenn A. Garden; Stuart A. Lipton

2001-04-19T23:59:59.000Z

397

Society Associate Percival L. Hallowell '18* ++  

E-Print Network [OSTI]

and F. George Shenton '40 Peggy F. and Edgar F. Whitmore, Jr. '40 1941 Society Associates Richard B. Seebald '42 '49G ++ Emmet T. White '42 '78P ++ Barbara and George G. Zipf '42 '78H ++ 1943 Founder. and John H. Gross '44 '48G '55G Elizabeth and William C. Hittinger '44 '73H '71P '75P '78P '97GP '02GP

Napier, Terrence

398

Photogrammetry as a tool for estimating size and condition in the Hawaiian monk seal (Monachus schauinslandi), the harbor seal (Phoca vitulina), and the northern elephant seal (Mirounga anguistirosis)  

E-Print Network [OSTI]

) for captive, subadult, Hawaiian monk seals M= 58. 18 + 9. 07 (GA) + 1. 20 (LA) - 0. 46 (L) -0. 64 (GP). . . . . . . . . . . . . . . . . . . 65 FIGURE Page The two best models reflecting the relationship of mass with photogrammetric and morphometric... The relationship of mass with photogrammetric measures for captive, adult harbor seals: M= -204. 597 - 6. 834 (GA) + 1. 538 (GP) + 0. 554(LP) + 0. 217 (L) . . . . 71 The relationship between body mass and photogrammetric measures of lateral perimeter (LP...

McFadden, Katherine Walton

2012-06-07T23:59:59.000Z

399

Biochemical and Genetic Characterization of Bacteriophage Holins  

E-Print Network [OSTI]

TMDs of Mu gp19. ........................... 155 xii LIST OF TABLES Page Table 1. Strains, phages, plasmids and primers used in this work. .................................. 45 Table 2. Mutant alleles of Y... on the muralytic activity for holin function. The gp13 holin of P22 has 90% identity compared to lambda S, but has a glycosidase endolysin. The Rz/Rz1 spanin genes The Rz and Rz1 genes encode a third class of lysis proteins, the spanins, responsible...

To, Kam Ho

2013-11-06T23:59:59.000Z

400

Genetic programming approach to predict torque and brake specific fuel consumption of a gasoline engine  

Science Journals Connector (OSTI)

This study presents genetic programming (GP) based model to predict the torque and brake specific fuel consumption a gasoline engine in terms of spark advance, throttle position and engine speed. The objective of this study is to develop an alternative robust formulations based on experimental data and to verify the use of GP for generating the formulations for gasoline engine torque and brake specific fuel consumption. Experimental studies were completed to obtain training and testing data. Of all 81 data sets, the training and testing sets consisted of randomly selected 63 and 18 sets, respectively. Considerable good performance was achieved in predicting gasoline engine torque and brake specific fuel consumption by using GP. The performance of accuracies of proposed GP models are quite satisfactory (R2=0.9878 for gasoline engine torque and R2=0.9744 for gasoline engine brake specific fuel consumption). The prediction of proposed GP models were compared to those of the neural network modeling, and strictly good agreement was observed between the two predictions. The proposed GP formulation is quite accurate, fast and practical.

Necla Togun; Sedat Baysec

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

4 4 September 2013 Table 40. Year-to-Date Imports of Crude Oil and Petroleum Products into the United States by Country of Origin, January-September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 969,414 375 - 26,834 - - - 69 16,922 16,991 Algeria ................................ 8,776 302 - 19,131 - - - 69 275 344 Angola ................................ 60,776 - - 2,435 - - - - - - Ecuador .............................. 63,927 - - 181 - - - - 845 845 Iran ..................................... - - - - - - - - - - Iraq ..................................... 101,662 - - - - - - - - - Kuwait .................................

402

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

6 6 September 2013 Table 43. PAD District 3 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 72,560 - - 2,597 - - - - - - Algeria ................................ - - - 2,099 - - - - - - Angola ................................ 1,423 - - - - - - - - - Ecuador .............................. 2,190 - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... 4,104 - - - - - - - - - Kuwait ................................. 7,946 - - - - - - - - - Libya ...................................

403

Crude Oil  

Gasoline and Diesel Fuel Update (EIA)

Algeria .......................................... 1.20 1.20 1.20 1.17 - - - - - - - - 1.19 - - Angola .......................................... 1.73 1.75 1.70 1.71 - - - - - - - - 1.72 - - Ecudaor ........................................ 0.51 0.52 0.53 0.54 - - - - - - - - 0.52 - - Iran ............................................... 2.80 2.80 2.80 2.80 - - - - - - - - 2.80 - - Iraq ............................................... 3.05 3.09 3.04 2.93 - - - - - - - - 3.03 - - Kuwait .......................................... 2.60 2.60 2.60 2.60 - - - - - - - - 2.60 - - Libya ............................................ 1.37 1.33 0.65 0.33 - - - - - - - - 0.92 - - Nigeria .........................................

404

Petroleum Supply Annual  

U.S. Energy Information Administration (EIA) Indexed Site

3.PDF 3.PDF Table 33. Net Imports of Crude Oil and Petroleum Products into the United States by Country, January 2012 (Thousand Barrels per Day) Country of Origin Crude Oil 1 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 3,814 16 -28 94 - -34 -34 - 77 77 Algeria ................................ 113 - - 71 - - - - - - Angola ................................ 364 - 3 12 - - - - - - Ecuador .............................. 100 - -20 - - -9 -9 - 0 0 Iran ..................................... - - - - - - - - - - Iraq ..................................... 374 0 - - - - - - - - Kuwait ................................. 319 0 - - - - - - 0 0 Libya ................................... - - -

405

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

2 2 September 2013 Table 47. PAD District 3 - Year-to-Date Imports of Crude Oil and Petroleum Products by Country of Origin, January-September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 639,194 302 - 19,745 - - - - 890 890 Algeria ................................ 2,113 302 - 14,873 - - - - - - Angola ................................ 17,325 - - 1,766 - - - - - - Ecuador .............................. 14,996 - - 181 - - - - 157 157 Iran ..................................... - - - - - - - - - - Iraq ..................................... 57,792 - - - - - - - - - Kuwait .................................

406

Petroleum Supply Annual  

U.S. Energy Information Administration (EIA) Indexed Site

7.PDF 7.PDF Table 27. PAD District 1 - Imports of Crude Oil and Petroleum Products by Country of Origin, January 2012 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 13,474 - - 375 - - - - 2,130 2,130 Algeria ................................ 1,393 - - 375 - - - - - - Angola ................................ 2,644 - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... 1,307 - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - - - - -

407

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

0 0 September 2013 Table 53. Net Imports of Crude Oil and Petroleum Products into the United States by Country, September 2013 (Thousand Barrels per Day) Country of Origin Crude Oil 1 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 3,690 0 -28 112 - -37 -37 - 70 70 Algeria ................................ 27 - - 95 - - - - - - Angola ................................ 226 - - - - - - - - - Ecuador .............................. 250 - -28 - - -9 -9 - 5 5 Iran ..................................... - - - - - - - - - - Iraq ..................................... 287 - - - - - - - - - Kuwait ................................. 299 0 - - - - - - - - Libya ...................................

408

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

4 4 September 2013 Table 54. Year-to-Date Net Imports of Crude Oil and Petroleum Products into the United States by Country, January-September 2013 (Thousand Barrels per Day) Country of Origin Crude Oil 1 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 3,551 1 -23 98 - -55 -55 0 60 60 Algeria ................................ 32 1 - 70 - -2 -2 0 1 1 Angola ................................ 223 - - 9 - - - - - - Ecuador .............................. 234 0 -12 1 - -15 -15 - 3 3 Iran ..................................... - - - - - - - - - - Iraq ..................................... 372 - - - - - - - 0 0 Kuwait ................................. 316 0 - - - - - - 0 0 Libya ...................................

409

Modeling of air currents in the Gulf Region  

SciTech Connect (OSTI)

The Atmospheric Release Advisory Capability modeled the wind flow in the Gulf Region in order to make projections of the Kuwait oil fires pollution dispersion. Extensive meteorological models incorporating explicit terrain influences to the flow fields were routinely employed through a six month international assessment support effort organized by the World Meteorological Organization and US scientific research agencies. Results show generally close agreement with visible imagery of the smoke plumes as detected by meteorological satellites. However, there are some examples of significant disagreement or failure of the meteorological models. These failures are most likely directly linked to missing or unavailable weather observations.

Sullivan, T.J.; Ellis, J.S.; Foster, C.S.; Foster, K.T.; Baskett, R.L.; Nasstrom, J.S.; Schalk, W.W.

1992-04-14T23:59:59.000Z

410

Tarmat behavior calculated for reservoir with sealing fault  

SciTech Connect (OSTI)

The Minagish Oolite oil reservoir in Kuwait is one of many Middle East reservoirs characterized by the presence of a tarmat (heavy to tar-like crude) at the oil-water contact. Since a waterflood project is planned for the Minagish Oolite, which contains a radial pattern of faults, a study was made to consider tarmat behavior upon water injection below it when the injection well is located near a sealing fault. The study resulted in a technique to predict the time of tarmat breakdown, response time at the nearest observation well, and differential pressure at the tarmat anywhere in the reservoir.

Osman, M.E.S.

1986-08-01T23:59:59.000Z

411

Solar electric systems  

SciTech Connect (OSTI)

Electricity from solar sources is the subject. The state-of-the-art of photovoltaics, wind energy and solar thermal electric systems is presented and also a broad range of solar energy activities throughout the Arab world is covered. Contents, abridged: Solar radiation fundamentals. Basic theory solar cells. Solar thermal power plants. Solar energy activities at the scientific research council in Iraq. Solar energy program at Kuwait Institute for Scientific Research. Prospects of solar energy for Egypt. Non-conventional energy in Syria. Wind and solar energies in Sudan. Index.

Warfield, G.

1984-01-01T23:59:59.000Z

412

Four state companies are markedly different  

SciTech Connect (OSTI)

The Journal continues its profiles of state owned oil companies with a return to the Persian Gulf, South America, and a first time look at the state oil company of Romania, one of Eastern Europe`s most active and oldest producers. The government of Kazakhstan`s activities are also covered in this report. These profiles detail the organization of the companies, with emphasis on upstream and downstream operations. Support functions, though essential to a company, are not covered in detail. Company projects and capabilities are only described in this report when necessary to put the company in perspective. Following are the profiles of state companies for Bahrain, Kuwait, Romania, and Venezuela.

Aalund, L.R.

1995-08-21T23:59:59.000Z

413

The unstable Gulf  

SciTech Connect (OSTI)

This book is an analysis of the international political environment for business in the Gulf region. To secure the flow of oil supplies to the West, the U.S. relies on stable relations with the key Gulf states: Saudi Arabia, Kuwait, Oman, the United Arab Emirates, Bahrain, and Qatar. The region's dynamic balance of power, however, is inherently destabilizing, which threatens the investment climate and the billions of dollars of international commerce with the Gulf states expected in the next decade. Dr. Martin analyzes the effects of the religious, ethnic, and ideological differences in the Persian Gulf on superpower competition and U.S. energy policy.

Martin, L.G.

1986-01-01T23:59:59.000Z

414

Oil and gas developments in Middle East in 1986  

SciTech Connect (OSTI)

Petroleum production in Middle East countries during 1986 totaled 4,493,973,000 bbl (an average rate of 12,312,254 BOPD), up 22.3% from the revised 1985 total of 3,673,729,000 bbl. Iraq, Kuwait, Saudi Arabia, Abu Dhabi, and Oman had significant increased; Iran was the only Middle East country with a significant decrease. New fields went on production in Oman and Yemen Arab Republic, and significant discoveries were reported in Iraq, Yemen Arab Republic, Oman, and Syria. However, exploration was generally down in most countries. Exploration and production operations continued to be affected by war in Iraq and Iran. 8 figures, 7 tables.

Hemer, D.O.; Gohrbandt, K.H.A.

1987-10-01T23:59:59.000Z

415

Petroleum Supply Annual  

U.S. Energy Information Administration (EIA) Indexed Site

6.PDF 6.PDF Table 26. Imports of Crude Oil and Petroleum Products into the United States by Country of Origin, January 2012 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 118,223 496 94 2,901 - - - - 2,386 2,386 Algeria ................................ 3,505 - - 2,200 - - - - - - Angola ................................ 11,282 - 94 378 - - - - - - Ecuador .............................. 3,087 - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... 11,596 - - - - - - - - - Kuwait ................................. 9,882 - - - - - - - - - Libya ...................................

416

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

50 50 September 2013 Table 39. Imports of Crude Oil and Petroleum Products into the United States by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 110,695 - - 3,356 - - - - 2,112 2,112 Algeria ................................ 800 - - 2,858 - - - - - - Angola ................................ 6,792 - - - - - - - - - Ecuador .............................. 7,502 - - - - - - - 160 160 Iran ..................................... - - - - - - - - - - Iraq ..................................... 8,618 - - - - - - - - - Kuwait ................................. 8,980 - - - - - - - - - Libya ...................................

417

untitled  

U.S. Energy Information Administration (EIA) Indexed Site

PAD District 1 - Imports of Crude Oil and Petroleum Products by Country of Origin, 2012 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 176,626 185 1,396 2,823 - - - - 18,028 18,028 Algeria ................................ 16,009 - 1,396 878 - - - - 302 302 Angola ................................ 30,771 - - - - - - - 61 61 Ecuador .............................. 714 - - - - - - - 1,099 1,099 Iran ..................................... - - - - - - - - - - Iraq ..................................... 17,247 - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ...................................

418

Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

4 4 September 2013 Table 45. PAD District 1 - Year-to-Date Imports of Crude Oil and Petroleum Products by Country of Origin, January-September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 130,822 73 - 4,052 - - - 69 16,032 16,101 Algeria ................................ 4,828 - - 2,036 - - - 69 275 344 Angola ................................ 24,309 - - 669 - - - - - - Ecuador .............................. - - - - - - - - 688 688 Iran ..................................... - - - - - - - - - - Iraq ..................................... 2,713 - - - - - - - - - Kuwait ................................. - -

419

Public Sector Leadership: Government Purchasing of Energy-efficient  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Public Sector Leadership: Government Purchasing of Energy-efficient Public Sector Leadership: Government Purchasing of Energy-efficient Products to Save Energy and "Pull" the Market Title Public Sector Leadership: Government Purchasing of Energy-efficient Products to Save Energy and "Pull" the Market Publication Type Conference Proceedings Year of Publication 2004 Authors Coleman, Philip, and Jeffrey P. Harris Conference Name Kuwait ASST Workshop on Energy Conservation in Buildings Series Title Energy Efficiency for Fuelling the World Date Published 01/2004 Conference Location Kuwait Abstract In most countries, government spending represents between 10% and 25% of total economic activity, with the national government generally accounting for the largest portion. Consequently, governments' spending can exert a strong influence on the markets for the products and services they purchase, especially when this procurement is concerted. In the last decade, several governments have instituted programs designed to direct their purchasing of energy-using products to the more efficient models on the market. This has two impacts: It provides substantial direct savings to the government on its utility bills while also helping to increase the availability and lower the prices of these more efficient models for all buyers.

420

OPEC 1991 results reflect hard times  

SciTech Connect (OSTI)

This paper reports that low crude oil prices and economic tough times in industrial countries cause a lean 1991 for members of the Organization of Petroleum Exporting Countries. OPEC's 1991 annual report the member countries reported an overall loss of $12 billion in 1991 on oil revenues that fell 16.2%. Iraq and Kuwait were not included because of their unusual circumstances in the wake of the Persian Gulf war. Reduced oil revenues reflected a slide to $18.66/bbl in 1991 from $22.26/bbl in 1990 for the average price of OPEC basket crudes. As of last June 5 OPEC's basket crude price has averaged only $17.42/bbl this year, OPEC News Agency (Opecna) reported. First quarter 1992 prices averaged $16.77/bbl, compared wit $19.31/bbl in fourth quarter 1991. The average price jumped 52 cent/bbl the first week in June this year to $19.93/bbl, bouyed by Saudi Arabia's move at the end of May to shift its policy from price moderation to one in favor of higher prices, Opecna the. OPEC members increased production 1% in 1991 to an average 23.28 million b/d in spite of negligible production from Iraq and Kuwait and reduced production from Qatar.

Not Available

1992-07-20T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Weathering performance of industrial atmospheric coating systems in the Arabian Gulf  

SciTech Connect (OSTI)

The performance and durability of a number of industrial coating systems have been studied for two and a half years at five weathering sites in the industrial belt of Shuaiba Area, Kuwait, in the Arabian Gulf. The outdoor weathering performance of eleven coating systems was related to the prevailing industrial atmospheric conditions, and comparison made to their behavior under laboratory accelerated conditions. The coating systems studied included acrylic enamel, micaceous iron oxide epoxy, alkyd enamel, alkyd gloss, chlorinated rubber, polyurethane, and water-based acrylic. Experience in Kuwait has shown that with the longer hours of strong sunshine and ambient temperatures, as well as the chemical content of the atmosphere (e.g. O{sub 3}, SO{sub 2}, NO{sub X}, NH{sub 3}, Cl), dust retention and sandstorm, degrading of coatings has tended to be faster than in Western countries which most of these generic coating system were developed. Two accelerated test methods were used to evaluate the protective properties of the above mentioned coatings when applied to steel panels.

Carew, J.; Al-Hashem, A.; Riad, W.T. [Kuwait Inst. for Scientific Research, Safat (Kuwait). Materials Application Dept.; Othman, M. [Shuaiba Area Authority, Safat (Kuwait); Islam, M. [Cortest Columbus Technologies Inc., OH (United States)

1994-12-31T23:59:59.000Z

422

The potential impact on socio-economic groups of rising energy prices due to the Kuwaiti crisis  

SciTech Connect (OSTI)

The Iraqi invasion of the kingdom of Kuwait on August 2, 1990, triggered immediate increases in the world price of petroleum. With US imports of petroleum and residential, commercial, and industrial consumption of petroleum products on the rise, these price increases are already evident in the US. The differential impact of these increases on poor and minority households raises significant and potentially long-term research and policy issues for various government agencies, including the US Department of Energy. The purpose of this paper is to provide a preliminary analysis of the nature and extent of the potential impact of Iraqi-induced petroleum price changes on majority, black, and Hispanic households, as well as on poor and non-poor households. As this paper is written, the US is continuing the deployment of several hundred thousand troops, aircraft, naval vessels, and other equipment to the Persian Gulf. The objectives of this deployment are to deter Iraqi invasion of Saudi Arabia and to encourage Iraqi withdrawal from Kuwait. The outcome of these initiatives, particularly the response of the government of Iraq, could stimulate additional changes in world petroleum prices and subsequent impacts on the household energy consumption and expenditure patterns of US black, Hispanic, and poor households. 8 refs., 16 figs., 5 tabs.

Henderson, L. (Baltimore Univ., MD (USA)); Poyer, D.; Teotia, A.

1990-01-01T23:59:59.000Z

423

LEDSGP/publications | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/publications < LEDSGP Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LEDS GP Publications and Communications Material Communications Material Document Title Date LEDSGPFactsheet.pdf LEDS GP Factsheet September 2013 LEDSGPSlideDeck.pdf LEDS GP Slide Deck September 2013 Publications Document Title Date MACCCurvesPaper.pdf Broadening the Appeal of Marginal Abatement Cost Curves: Capturing Both Carbon Mitigation and Development Benefits of Clean Energy Technologies May 2012

424

ES&H Index  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Corporate Policy System Documents Corporate Policy System Documents Plan Work Procedures ESH100.1.EP.1, Implement the Environmental Management System (EMS) ESH100.1.EP.2, Implement NEPA, Cultural Resources, and Historic Properties Requirements ESH100.1.EP.3, Complete an Environmental Life-cycle Management Evaluation ESH100.1.GP.1, Manage Safety for Contracted Activities ESH100.1.GP.2, Implement ES&H General Requirements ESH100.1.GP.3, Implement the Integrated Safety Management System ESH100.1.WPC.1, Plan and Control Work Analyze and Control Hazards Procedures ESH100.2.ELC.1, Manage Electrical Hazards ESH100.2.ENV.10, Manage Surface and Storm Water Discharges ESH100.2.ENV.11, Control Scrap Metal From a Radiological Area ESH100.2.ENV.12, Obtain and Comply with Air Permits ESH100.2.ENV.13, Control Ozone Depleting Substances

425

LEDSGP/about/regional-platforms | Open Energy Information  

Open Energy Info (EERE)

regional-platforms regional-platforms < LEDSGP‎ | about Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Regional Platforms LEDS GP regional platforms lead regional peer learning, training, and collaboration; engage technical working groups, the LEDS GP Secretariat, and others to meet country and regional needs; and cultivate champions and broad support for LEDS. African Climate and Development Society The African Climate and Development Society works towards climate resilient and low carbon development in Africa by bringing together policy, practice

426

Resolving Conflicting Crystallographic and NMR Models for Solution-State DNA with Solution X-ray Diffraction  

Science Journals Connector (OSTI)

We report on synchrotron-based high-angle X-ray solution scattering measured to 2 resolution for two synthetic DNA sequences for which there are conflicting X-ray crystal and solution NMR models. ... Herein, we report on synchrotron-based high-angle X-ray solution scattering measured to 2 resolution for two synthetic DNA sequences for which there are numerous conflicting X-ray crystal and solution NMR models. ... The crystal structure of the synthetic DNA dodecamer d(CpGpCpGpApApTpTpCpGpCpG) was refined to a residual error of R = 17.8% at 1.9- resoln. ...

Xiaobing Zuo; David M. Tiede

2004-12-10T23:59:59.000Z

427

The Ebola virus glycoprotein mediates entry via a non-classical dynamin-dependent macropinocytic pathway  

SciTech Connect (OSTI)

Ebola virus (EBOV) has been reported to enter cultured cell lines via a dynamin-2-independent macropinocytic pathway or clathrin-mediated endocytosis. The route(s) of productive EBOV internalization into physiologically relevant cell types remain unexplored, and viral-host requirements for this process are incompletely understood. Here, we use electron microscopy and complementary chemical and genetic approaches to demonstrate that the viral glycoprotein, GP, induces macropinocytic uptake of viral particles into cells. GP's highly-glycosylated mucin domain is dispensable for virus-induced macropinocytosis, arguing that interactions between other sequences in GP and the host cell surface are responsible. Unexpectedly, we also found a requirement for the large GTPase dynamin-2, which is proposed to be dispensable for several types of macropinocytosis. Our results provide evidence that EBOV uses an atypical dynamin-dependent macropinocytosis-like entry pathway to enter Vero cells, adherent human peripheral blood-derived monocytes, and a mouse dendritic cell line.

Mulherkar, Nirupama [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Raaben, Matthijs [Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115 (United States); Torre, Juan Carlos de la [Department of Immunology and Microbial Science, The Scripps Research Institute, La Jolla, CA 92037 (United States); Whelan, Sean P. [Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115 (United States); Chandran, Kartik, E-mail: kartik.chandran@einstein.yu.edu [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States)

2011-10-25T23:59:59.000Z

428

Gaussian process modeling for measurement and verification of building energy savings  

Science Journals Connector (OSTI)

We present a Gaussian process (GP) modeling framework to determine energy savings and uncertainty levels in measurement and verification (M&V) practices. Existing M&V guidelines provide savings calculation procedures based on linear regression techniques that are limited in their predictive and uncertainty estimation capabilities. We demonstrate that, unlike linear regression, GP models can capture complex nonlinear and multivariable interactions as well as multiresolution trends of energy behavior. In addition, because GP models are developed under a Bayesian setting, they can capture different sources of uncertainty in a more systematic way. We demonstrate that these capabilities can ultimately lead to significantly less expensive M&V practices. We illustrate the developments using simulated and real data settings.

Yeonsook Heo; Victor M. Zavala

2012-01-01T23:59:59.000Z

429

Measurement and verification of building systems under uncertain data: A Gaussian process modeling approach  

Science Journals Connector (OSTI)

Abstract Uncertainty in sensor data (e.g., weather, occupancy) complicates the construction of baseline models for measurement and verification (M&V). We present a Monte Carlo expectation maximization (MCEM) framework for constructing baseline Gaussian process (GP) models under uncertain input data. We demonstrate that the GP-MCEM framework yields more robust predictions and confidence levels compared with standard GP training approaches that neglect uncertainty. We argue that the approach can also reduce data needs because it implicitly expands the data range used for training and can thus be used as a mechanism to reduce data collection and sensor installation costs in M&V processes. We analyze the numerical behavior of the framework and conclude that robust predictions can be obtained with relatively few samples.

Michael C. Burkhart; Yeonsook Heo; Victor M. Zavala

2014-01-01T23:59:59.000Z

430

Radiative muon capture in nuclei  

Science Journals Connector (OSTI)

The energy spectra of photons following negative muon absorption in C12, O16, Al27, Ca40, Fenat, Ho165, and Bi209 have been measured with two NaI spectrometers. The branching ratios for the emission of high energy photons give information on the induced pseudoscalar coupling constant gP in nuclear matter. The data for light nuclei are in agreement with the theoretical calculations using the nucleonic value of gP?7gA predicted by the partially conserved axial vector current hypothesis, while significantly lower values of gP are required to fit the data of the heavier elements with presently existing theoretical predictions. Disregarding the remaining theoretical uncertainties, these results can be interpreted as a further indication of the renormalization of the nucleonic form factors inside the nucleus.

M. Dbeli; M. Doser; L. van Elmbt; M. W. Schaad; P. Trul; A. Bay; J. P. Perroud; J. Imazato; T. Ishikawa

1988-04-01T23:59:59.000Z

431

LAC Regional Platform Workshop Presentations | Open Energy Information  

Open Energy Info (EERE)

LAC Regional Platform Workshop Presentations LAC Regional Platform Workshop Presentations Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LAC Workshop Announcement Agenda Participant Package Accommodations Location & Transportation Insurance & Visas Participants Presentations Outcomes Report Links Contact Us Introductory Remarks: LAC Regional Platform and Workshop and the LEDS GP Session Document Title LEDS GP slides for LAC Event.pdf LEDS GP Slides Interactive Session 1: Planning and Sustaining a LEDS Process Document Title Fernando Farias - 1aChilev1.pdf Making the Case for LEDS and Building Political Support: Chile on Engaging Ministries and Political Leaders Lupe Guinand - 2012 11 06 PlanCC Apoyo Político VA (2)rev.pdf Planning for Climate Change Project (PlanCC) - Promoviendo Estrategias de Desarrollo Bajas en Carbono (LEDS) en el Perú

432

,"Natural Gas Plant Field Production: Natural Gas Liquids "  

U.S. Energy Information Administration (EIA) Indexed Site

Field Production: Natural Gas Liquids " Field Production: Natural Gas Liquids " ,"Click worksheet name or tab at bottom for data" ,"Worksheet Name","Description","# Of Series","Frequency","Latest Data for" ,"Data 1","Natural Gas Plant Field Production: Natural Gas Liquids ",16,"Monthly","9/2013","1/15/1981" ,"Release Date:","11/27/2013" ,"Next Release Date:","Last Week of December 2013" ,"Excel File Name:","pet_pnp_gp_a_epl0_fpf_mbbl_m.xls" ,"Available from Web Page:","http://www.eia.gov/dnav/pet/pet_pnp_gp_a_epl0_fpf_mbbl_m.htm" ,"Source:","Energy Information Administration"

433

Effect of ozone and granular activated coal (GAC) on the bioactivity of drinking water  

SciTech Connect (OSTI)

In this research, the appearance of easily biodegradable organic material in ozonation and granular activated coal (GAC) filtration was studied. The amount of bioactivity was measured by conventional AOC analyses used in two different modes and also using quite a new growth potential (GP) method. GAC filtration without ozone doubled the amount of AOC of the chemically treated surface water, whereas by ozonation with GAC filtration it was possible to halve the amount of the AOC. The measurement of GP was noticeably simpler than measuring AOC, but for wider use more parallel studies are needed for the comparability of the results of the analysis.

Sallanko, J.; Iivari, P.; Heiska, E. [University of Oulu, Oulu (Finland). Water Resources and Environmental Engineering Laboratory

2009-07-01T23:59:59.000Z

434

Radiative muon absorption in calcium  

Science Journals Connector (OSTI)

The photon spectrum from radiative absorption of negative muons in Ca40 has been measured with a high-resolution pair spectrometer. The data are analyzed in order to determine the induced pseudoscalar coupling constant gp in nuclear matter. When compared to models which use a realistic nuclear response function and avoid the closure approximation, a value of gp/gA=4.01.5 is obtained, which indicates a quenching of this coupling compared to the nucleonic value by a factor 0.570.25.

A. Frischknecht; W. Stehling; G. Strassner; P. Trul; J. C. Alder; C. Joseph; J. F. Loude; J. P. Perroud; D. Ruegger; T. M. Tran; W. Dahme; H. Panke; R. Kopp

1985-11-01T23:59:59.000Z

435

The changes of ?-glycerophosphate dehydrogenase isozymes in Solenopsis invicta queens during development and colony founding  

E-Print Network [OSTI]

Alleles RESULTS AND DISCUSSION 20 20 22 Location of ot-GPDH Activity Developmental Changes in Activity Characterizations of 4-GPDH Alleles 22 24 29 SUMMARY REFERENCES CITED VITA 36 38 42 LIST OF FIGURES Fig. 1. --The 4-GP Cycle of Insect... with their sustained metabolic activity. ? GPO -d t 1 f ~t' . --2h * tl mitochondrial reactions that may control respiration in flight muscle: the oxidations of pyruvate, proline, and o(-glycerophosphate (&-GP). For both pyruvate and proline oxidation the key...

Dowler, Megan Gail

2012-06-07T23:59:59.000Z

436

Using short time pressure buildup tests to calculate gas reserves  

E-Print Network [OSTI]

-in Time ht l & dt 2 &ht 3 Transient Gp FiC, ure 1. Graphical Presentation of Sullivan. Poston en4 Piper's Method THEORY The basic equation for the radial flow of a single phase fluid in a porous medium& is i 8 kp Bp Bp ? ( " ) =citip- r Br p Br Br...) must be the same for any shut-in time. in the plot of p/z vs Ip p 1. Gp if the isochronal, transient line is parallel to the static line. Fig. 2 illustrates the graphical presentation of this idea. Mathematically, we must have (qyc)l ~ p (7ll )2...

Vu, Trang Dinh

2012-06-07T23:59:59.000Z

437

Space-Time Curvature Signatures in Bose-Einstein Condensates  

E-Print Network [OSTI]

We derive a generalized Gross-Pitaevski (GP) equation immersed on a electromagnetic and a weak gravitational field starting from the covariant Complex Klein-Gordon field in a curved space-time. We compare it with the GP equation where the gravitational field is added by hand as an external potential. We show that there is a small difference of order $g z/c^2$ between them that could be measured in the future using Bose-Einstein Condensates (BEC). This represents the next order correction to the Newtonian gravity in a curved space-time.

Matos, Tonatiuh

2015-01-01T23:59:59.000Z

438

Solving planning-graph by compiling it into CSP Minh Binh Do & Subbarao Kambhampati  

E-Print Network [OSTI]

Solving planning-graph by compiling it into CSP Minh Binh Do & Subbarao Kambhampati Department to adapt CSP search techniques into the backward search phase of Graphplan. This paper describes GP-CSP, a system that does planning by automati- cally converting Graphplan's planning graph into a CSP encoding

Kambhampati, Subbarao

439

Mountable eddy current sensor for in-situ remote detection of surface and sub-surface fatigue cracks  

DOE Patents [OSTI]

A wireless, integrated, mountable, portable, battery-operated, non-contact eddy current sensor that provides similar accuracy to 1970's laboratory scale equipment (e.g., a Hewlett-Packard GP4194A Impedance Analyzer) at a fraction of the size and cost.

Yepez, III, Esteban (Albuquerque, NM); Roach, Dennis P. (Albuquerque, NM); Rackow, Kirk A. (Albuquerque, NM); DeLong, Waylon A. (Albuquerque, NM)

2011-09-06T23:59:59.000Z

440

A regulon conserved in monocot and dicot plants defines a functional module in antifungal plant immunity  

Science Journals Connector (OSTI)

...Ulrike Gobel Kurt Stuber Mariola Pi?lewska-Bednarek Ann Loraine Paul Schulze-Lefert Shauna Somerville Ralph Panstruga a Department...774 . 31 Srinivasasainagendra V Page GP Mehta T Coulibaly I Loraine AE ( 2008 ) CressExpress: A tool for large-scale mining...

Matt Humphry; Pawe? Bednarek; Birgit Kemmerling; Serry Koh; Mnica Stein; Ulrike Gbel; Kurt Stber; Mariola Pi?lewska-Bednarek; Ann Loraine; Paul Schulze-Lefert; Shauna Somerville; Ralph Panstruga

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

The Fusion Protein of Respiratory Syncytial Virus Triggers p53-Dependent Apoptosis  

Science Journals Connector (OSTI)

...interfering with the fusion activity of the protein...induced. Confocal laser scanning microscopy...human RSV F protein (hF-GFP) was predominantly...either bF-GFP, hF-GFP, or gp40-GFP...analyzed by confocal laser scanning microscopy...postinduction of bF-GFP or hF-GFP expression...

Julia Eckardt-Michel; Markus Lorek; Diane Baxmann; Thomas Grunwald; Gnther M. Keil; Gert Zimmer

2008-01-23T23:59:59.000Z

442

Laser Capture Microdissection Assessment of Virus Compartmentalization in the Central Nervous Systems of Macaques Infected with Neurovirulent Simian Immunodeficiency Virus  

Science Journals Connector (OSTI)

...amplify viral RNA from laser capture samples, and...of gp41 increases the fusion activity of the virion by efficient exposure of fusion epitopes followed by binding...for assistance with laser capture microdissection...Gutmann, M Opravil, and HF Gunthard, Swiss HIV Cohort...

Kenta Matsuda; Charles R. Brown; Brian Foley; Robert Goeken; Sonya Whitted; Que Dang; Fan Wu; Ronald Plishka; Alicia Buckler-White; Vanessa M. Hirsch

2013-05-29T23:59:59.000Z

443

Unusual Molecular Architecture of the Machupo Virus Attachment Glycoprotein  

Science Journals Connector (OSTI)

...conserved across the New World HF arenaviruses, a third...glycosylation by matrix-assisted laser desorption ionization-time...segment from all New World HF arenaviruses (MACV, JUNV...GP1. Matrix-assisted laser desorption ionization-time...sites across New World HF arenaviruses mapped onto...

Thomas A. Bowden; Max Crispin; Stephen C. Graham; David J. Harvey; Jonathan M. Grimes; E. Yvonne Jones; David I. Stuart

2009-06-03T23:59:59.000Z

444

Chimeric human parainfluenza virus bearing the Ebola virus glycoprotein as the sole surface protein is immunogenic and highly protective against Ebola virus challenge  

SciTech Connect (OSTI)

We generated a new live-attenuated vaccine against Ebola virus (EBOV) based on a chimeric virus HPIV3/{delta}F-HN/EboGP that contains the EBOV glycoprotein (GP) as the sole transmembrane envelope protein combined with the internal proteins of human parainfluenza virus type 3 (HPIV3). Electron microscopy analysis of the virus particles showed that they have an envelope and surface spikes resembling those of EBOV and a particle size and shape resembling those of HPIV3. When HPIV3/{delta}F-HN/EboGP was inoculated via apical surface of an in vitro model of human ciliated airway epithelium, the virus was released from the apical surface; when applied to basolateral surface, the virus infected basolateral cells but did not spread through the tissue. Following intranasal (IN) inoculation of guinea pigs, scattered infected cells were detected in the lungs by immunohistochemistry, but infectious HPIV3/{delta}F-HN/EboGP could not be recovered from the lungs, blood, or other tissues. Despite the attenuation, the virus was highly immunogenic, and a single IN dose completely protected the animals against a highly lethal intraperitoneal challenge of guinea pig-adapted EBOV.

Bukreyev, Alexander [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)], E-mail: abukreyev@nih.gov; Marzi, Andrea; Feldmann, Friederike [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Zhang Liqun [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Yang Lijuan; Ward, Jerrold M. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Dorward, David W. [Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Hamilton, Montana (United States); Pickles, Raymond J. [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Murphy, Brian R. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Feldmann, Heinz [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Department of Medical Microbiology, University of Manitoba (Canada); Collins, Peter L. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)

2009-01-20T23:59:59.000Z

445

A forward genetic strategy reveals destabilizing mutations in the ebolavirus2 glycoprotein that alter its protease dependence during cell entry3  

E-Print Network [OSTI]

1 1 A forward genetic strategy reveals destabilizing mutations in the ebolavirus2 glycoprotein, Harvard Medical8 School, Boston, MA 021159 10 Running title: CATHEPSIN B-INDEPENDENT ENTRY BY EBOLAVIRUS Ebolavirus entry into cells requires proteolytic disassembly of the viral glycoprotein, GP. This2 proteolytic

Chandran, Kartik

446

Spatial interactions among ecosystem services in an urbanizing agricultural watershed  

Science Journals Connector (OSTI)

...R Mulholland P Robertson GP ( 2010 ) Bioenergy sustainability at the Regional Scale...stock values were estimates from the literature (30, 37, 38) and assumed that belowground...Occurrence of nitrate in groundwater--A review. J Environ Qual 22(3):392 ZZQQhy402...

Jiangxiao Qiu; Monica G. Turner

2013-01-01T23:59:59.000Z

447

Genetic programming needs better benchmarks  

Science Journals Connector (OSTI)

Genetic programming (GP) is not a field noted for the rigor of its benchmarking. Some of its benchmark problems are popular purely through historical contingency, and they can be criticized as too easy or as providing misleading information concerning ... Keywords: benchmarks, genetic programming

James McDermott; David R. White; Sean Luke; Luca Manzoni; Mauro Castelli; Leonardo Vanneschi; Wojciech Jaskowski; Krzysztof Krawiec; Robin Harper; Kenneth De Jong; Una-May O'Reilly

2012-07-01T23:59:59.000Z

448

Cationic Amphiphile with Shikimic Acid Headgroup Shows More Systemic Promise Than Its Mannosyl Analogue as DNA Vaccine Carrier in Dendritic Cell Based Genetic Immunization  

Science Journals Connector (OSTI)

Zhai, Y.; Yang, J. C.; Spiess, P.; Nishimura, M. I.; Overwijk, W. W.; Roberts, B.Cloning and characterization of the genes encoding the murine homologues of the human melanoma antigens MART1 and gp100 J. Immunother. ... Zhai, Yifan; Yang, James C.; Spiess, Paul; Nishimura, Michael I.; Overwijk, Willem W.; Roberts, Bruce; Restifo, Nicholas P.; Rosenberg, Steven A. ...

Ramishetti Srinivas; Priya P. Karmali; Dipankar Pramanik; Arup Garu; Yenugonda Venkata Mahidhar; Bharat K. Majeti; Sistla Ramakrishna; Gunda Srinivas; Arabinda Chaudhuri

2010-01-05T23:59:59.000Z

449

Immunosuppression in Melanoma Immunotherapy: Potential Opportunities for Intervention  

Science Journals Connector (OSTI)

...org . Laszlo G. Radvanyi Willem W. Overwijk Patrick Hwu Authors Affiliation: Department...Immunol 2005;174:2591-601. 15 Overwijk WW, Tsung A, Irvine KR, et al. gp100...J Exp Med 1998;188:277-86. 16 Overwijk WW, Theoret MR, Finkelstein SE, et...

Gregory Lize; Laszlo G. Radvanyi; Willem W. Overwijk; Patrick Hwu

2006-04-01T23:59:59.000Z

450

Toll-like Receptors in Tumor Immunotherapy  

Science Journals Connector (OSTI)

...1122-34. 43 Surman DR, Dudley ME, Overwijk WW, Restifo NP. Cutting edge: CD4...Acad Sci U S A 2002;99:931-6. 66 Overwijk WW, Tsung A, Irvine KR, et al. gp100...J Immunother 1997;20:15-25. 68 Overwijk WW, Theoret MR, Finkelstein SE, et...

Chrystal M. Paulos; Andrew Kaiser; Claudia Wrzesinski; Christian S. Hinrichs; Lydie Cassard; Andrea Boni; Pawel Muranski; Luis Sanchez-Perez; Douglas C. Palmer; Zhiya Yu; Paul A. Antony; Luca Gattinoni; Steven A. Rosenberg; Nicholas P. Restifo

2007-09-15T23:59:59.000Z

451

Elastic parabolic equation solutions for underwater acoustic problems using seismic sources  

E-Print Network [OSTI]

, Washington 98105 Jon M. Collis Department of Applied Mathematics and Statistics, Colorado School of Mines.1121/1.4790355] PACS number(s): 43.30.Ma, 43.30.Dr, 43.20.Gp, 43.30.Zk [MS] Pages: 1358­1367 I. INTRODUCTION A class

452

Evaluation of a Prototype Flow Cytometry Test for Serodiagnosis of Canine Visceral Leishmaniasis  

Science Journals Connector (OSTI)

...G, Jr , A Teva, AL Ferreira, CB dos Santos, IS Pinto, CT de-Azevedo and A Falqueto...54-59. 12. Borja-Cabrera, GP , FN Santos, FS Bauer, LE Parra, I Menz, AA Morgado...Rocha, RD , CM Gontijo, SM Eloi-Santos, A Teixeira Carvalho, R Correa-Oliveira...

Henrique Gama Ker; Wendel Coura-Vital; Rodrigo Dian de Oliveira Aguiar-Soares; Bruno Mendes Roatt; Ndia das Dores Moreira; Cludia Martins Carneiro; Evandro Marques de Menezes Machado; Andra Teixeira-Carvalho; Olindo Assis Martins-Filho; Rodolfo Cordeiro Giunchetti; Mrcio Sobreira Silva Arajo; Eduardo Antonio Ferraz Coelho; Denise da Silveira-Lemos; Alexandre Barbosa Reis

2013-10-09T23:59:59.000Z

453

EMULATING A GRAVITY MODEL TO INFER THE SPATIOTEMPORAL DYNAMICS OF AN INFECTIOUS DISEASE  

E-Print Network [OSTI]

EMULATING A GRAVITY MODEL TO INFER THE SPATIOTEMPORAL DYNAMICS OF AN INFECTIOUS DISEASE Roman grid. · Use pre-calculated matrices {Mtk}. GP-EMULATOR - BASED APPROACH · Based on constructing a new (proportions of zeros) on a pre-selected grid of parameters. · Second stage: We make inference based

Bjørnstad, Ottar Nordal

454

Sparse Gaussian Process Toolbox Lehel Csato  

E-Print Network [OSTI]

process · MATLAB programming language · NETLAB toolbox Provides: · GUI demos for teaching GPs · Variety://www.tuebingen.mpg.de/csatol · http://www.ncrg.aston.ac.uk/Projects/SSGP Gaussian Process Inference Gaussian process (GP) models datasets. Matlab Implementation Uses a matlab structure net. The initialisation of the structure

455

Genetic Programming of Full Knowledge Bases for Fuzzy Logic Controllers  

E-Print Network [OSTI]

Genetic Programming of Full Knowledge Bases for Fuzzy Logic Controllers Daryl Battle Lucent in fuzzy logic control applications. An extension to a rule learning GP system is presented that achieves and fuzzy logic. These methods have proven to be effective in designing intelligent control systems

Fernandez, Thomas

456

Air-stable droplet interface bilayers on oil-infused surfaces  

Science Journals Connector (OSTI)

...by Air Force Office of Scientific Research Basic Research Initiative Grant FA9550-12-1-0464 (to S.A.S.) and the SunShot Program of the Office of Energy Efficiency and Renewable Energy (G.P.). The authors declare no conflict of interest...

Jonathan B. Boreyko; Georgios Polizos; Panos G. Datskos; Stephen A. Sarles; C. Patrick Collier

2014-01-01T23:59:59.000Z

457

HIV Fusion Peptide Penetrates, Disorders, and Softens T-Cell Membrane Mimics  

E-Print Network [OSTI]

HIV Fusion Peptide Penetrates, Disorders, and Softens T-Cell Membrane Mimics Stephanie Tristram of N-terminal gp41 fusion peptide (FP) of human immunodeficiency virus type 1 (HIV-1) with model membranes in order to elucidate how FP leads to fusion of HIV and T-cell membranes. FP constructs were (i

Weliky, David

458

Creation of Quasi-One-Dimensional Strontium Rydberg Atoms Shuzhen Ye,1  

E-Print Network [OSTI]

GP-A-17 Creation of Quasi-One-Dimensional Strontium Rydberg Atoms Shuzhen Ye,1 state such as a low- state or a polarized Stark state. Here, we examine the photoexcitation of strontium. In strontium the "nd" states possess high two-photon excitation rates, display a large quantum defect

459

Statistical Deterministic  

E-Print Network [OSTI]

of OL weights / H 1=2 ). H !1: Posterior of net output converges (with p. 1) to zero-mean Gaussian D) = P (D j #18;)P (#18;) P (D) (1) to calculate P (t j x; D) by marginalizing over #18;. Karlsruhe | November 10, 1998 5 #12; Regression with Gaussian Processes Prior P (y(x)) zero-mean GP with covariance

Seeger, Matthias

460

Towards Improved Prediction of Ocean Processes Using Statistical Machine Learning  

E-Print Network [OSTI]

on Gaussian Process (GP) regression, which provide improved estimates of ocean currents and also have current estimates from the Southern California Bight provided by the Regional Ocean Modeling System (ROMS with sensors like HF-Radar have allowed accurate predictions of ocean currents, temperature, and other

Sukhatme, Gaurav S.

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Classification of Seafloor Habitats using Genetic Programming  

E-Print Network [OSTI]

habitats. The initial motivation to use GP for this task came from a work on diesel engine diagnosis [11 for Marine Science and Technology Curtin University of Technology GPO Box U1987, Perth, WA 6845, Australia y understand- ing of the acoustic backscatter from marine macro-benthos (MMB), including mainly seagrass, algae

Fernandez, Thomas

462

Mechanisms of protein stabilization at very low pH ISBN 978-7-5487-0356-3  

E-Print Network [OSTI]

ArsH from heterogeneous expression in E.coli BL21 A strategy to produce monoclonal antibodies against gp96 by prime-boost regimen using endogenous protein and E. coli heterologously-expressed fragment limonitic ore Effect of organic extractant, pH and temperature change, on bioleaching The effects of p

Neshich, Goran

463

Genotyping of 27 Human Papillomavirus Types by Using L1 Consensus PCR Products by a Single-Hybridization, Reverse Line Blot Detection Method  

Science Journals Connector (OSTI)

...Apple C. M. Wheeler Department...Roche Molecular Systems, Inc., Alameda...and cohort studies that HPV infection...Perkin-Elmer, Foster City, Calif...A cohort study of the risk...case-control study in Taiwan...Schiffman M. H. Wheeler C. M. Epidemiology...GP5 primer systems. . Remmink...

P. E. Gravitt; C. L. Peyton; R. J. Apple; C. M. Wheeler

1998-10-01T23:59:59.000Z

464

A quadratic cumulative production model for the material balance of an abnormally pressured gas reservoir  

E-Print Network [OSTI]

. .................................................................................. 48 3.28 Summary plot of p/z vs. Gp ? Case 3. ................................................................................... 48 3.29 Plot of pore volume compressibility computed using Fetkovich, et al. approach and compared to laboratory data... aquifers in southern Louisiana and adjacent areas of the continental shelf (ref. 23). .................................................................................................................................. 23 2.3 Geopressure ratio (geostatic...

Gonzalez, Felix Eduardo

2005-02-17T23:59:59.000Z

465

Enhancement of the E(J,B) power law characterization for superconducting wires from  

E-Print Network [OSTI]

3GP3-7 1 Enhancement of the E(J,B) power law characterization for superconducting wires from. This method has many advantages compared to the conventional measurements on short samples: voltages's characteristics, according to the winding process, e.g., the bending radius and the tensile strength. I

466

Rational HIV Immunogen Design to Target Specific Germline B Cell Receptors  

Science Journals Connector (OSTI)

...multimerized on nanoparticles, this immunogen (eOD-GT6) activates germline and mature VRC01-class B cells. Thus, eOD-GT6 nanoparticles have promise as a vaccine...and mature (Mat) antibodies to gp120 and eOD variants. Values represent KD s in nM measured...

Joseph Jardine; Jean-Philippe Julien; Sergey Menis; Takayuki Ota; Oleksandr Kalyuzhniy; Andrew McGuire; Devin Sok; Po-Ssu Huang; Skye MacPherson; Meaghan Jones; Travis Nieusma; John Mathison; David Baker; Andrew B. Ward; Dennis R. Burton; Leonidas Stamatatos; David Nemazee; Ian A. Wilson; William R. Schief

2013-05-10T23:59:59.000Z

467

Bacillus anthracis Diversity in Kruger National Park  

Science Journals Connector (OSTI)

...S. Department of Energy (NN20-CBNP...Klevytska L. B. Price J. M. Schupp G...P. Keim L. B. Price A. M. Klevytska...Klevytska L. B. Price P. Keim D. T...has a recorded history of periodic anthrax...Arizona 86011-5640, USA. Kimothy.Smith...

K. L. Smith; V. DeVos; H. Bryden; L. B. Price; M. E. Hugh-Jones; P. Keim

2000-10-01T23:59:59.000Z

468

NEWS & VIEWS NATURE|Vol 441|15 June 2006 A drawback of the Zhu et al. study, and of  

E-Print Network [OSTI]

these regions. The gp120 molecules sit atop the legs, with a sugar-coated face upwards and the variable loops surface chemistry, mainly attach at defects or edge-atom sites in the lattice, where the carbon atoms trigger the break- up of the carbon lattice, ultimately destroying the entire graphitic structure? One

Aksay, Ilhan A.

469

PWR's xenon oscillation control through a fuzzy expert system automatically designed by means of genetic programming  

Science Journals Connector (OSTI)

This work proposes the use of genetic programming (GP) for automatic design of a fuzzy expert system aimed to provide the control of axial xenon oscillations in pressurized water reactors (PWRs). The control methodology is based on three axial offsets ... Keywords: Axial xenon oscillations control, Fuzzy logic, Genetic programming

Roberto P. Domingos; Gustavo H. F. Caldas; Cludio M. N. A. Pereira; Roberto Schirru

2003-12-01T23:59:59.000Z

470

[Faculty of Science Information and Computing Sciences  

E-Print Network [OSTI]

[Faculty of Science Information and Computing Sciences] Indexed fixed points Andres Löh Dept. of Information and Computing Sciences, Utrecht University P.O. Box 80.089, 3508 TB Utrecht, The Netherlands Web pages: http://www.cs.uu.nl/wiki/Center GP meeting, 21 November 2008 #12;[Faculty of Science Information

Löh, Andres

471

Analytical Challenges and Recent Advances in the Determination of Estrogens in Water Environments  

Science Journals Connector (OSTI)

......MIPs for E2 were synthesized from 4-vinyl pyridine and ethylene dimethacrylate as a functional monomer and cross-linking...2007). 91. D.D. Fine, G.P. Breidenbach, T.L. Price, and S.R. Hutchins. Quantitation of estrogens in ground......

Rodica Domnica Briciu; Agata Kot-Wasik; Jacek Namiesnik

2009-02-01T23:59:59.000Z

472

A mutation in the putative Mg(2+)-binding site of Gs alpha prevents its activation by receptors.  

Science Journals Connector (OSTI)

...10 p.M GTPyS and 10 ,uM isoproterenol (Iso) (A, *, *). A wt S49 4 ISO T10 JM o- S~~~~TP GpS 0- - B CYC- /54N a sI 10 AM XGPy S VOL...filled symbols) of 10 puM isoproterenol (Iso). preference for guanine nucleotide diphosphates...

J D Hildebrandt; R Day; C L Farnsworth; L A Feig

1991-10-01T23:59:59.000Z

473

Role of RelGsu in Stress Response and Fe(III) Reduction in Geobacter sulfurreducens  

Science Journals Connector (OSTI)

...development and A-factor production in Myxococcus xanthus. Genes...antagonism between opposing active sites in a bifunctional RelA/SpoT...3-monophosphate (ppGp) and antibiotic production in Streptomyces clavuligerus...essential zinc ion in the active site. Cell 97: 371-381. 72...

Laurie N. DiDonato; Sara A. Sullivan; Barbara A. Meth; Kelly P. Nevin; Reg England; Derek R. Lovley

2006-10-13T23:59:59.000Z

474

Venezuelan Equine Encephalitis Virus Replicon Particle Vaccine Protects Nonhuman Primates from Intramuscular and Aerosol Challenge with Ebolavirus  

Science Journals Connector (OSTI)

...Reston virus (RESTV), Sudan virus (SUDV), Tai Forest...Sciences, Penzberg, Germany) thermal cycler. Fluorescence was measured...expression of Ebola virus and Sudan virus GP. BHK cells were infected...report the protective efficacy of Sudan ebolavirus (SUDV) and Zaire...

Andrew S. Herbert; Ana I. Kuehne; James F. Barth; Ramon A. Ortiz; Donald K. Nichols; Samantha E. Zak; Spencer W. Stonier; Majidat A. Muhammad; Russell R. Bakken; Laura I. Prugar; Gene G. Olinger; Jennifer L. Groebner; John S. Lee; William D. Pratt; Max Custer; Kurt I. Kamrud; Jonathan F. Smith; Mary Kate Hart; John M. Dye

2013-02-13T23:59:59.000Z

475

Bluetongue virus coat protein VP2 contains sialic acid-binding domains, and VP5 resembles enveloped virus fusion proteins  

Science Journals Connector (OSTI)

...of the rotavirus VP4 spike (PDB ID code 1KQR) (14). When the ribbon model...expression of nonstructural protein 2 (NS2) at 16 h after BTV infection of HeLa...fusion proteins gp41 of HIV (PDB ID code 1SZT) (24) and HA2 of influenza...

Xing Zhang; Mark Boyce; Bishnupriya Bhattacharya; Xiaokang Zhang; Stan Schein; Polly Roy; Z. Hong Zhou

2010-01-01T23:59:59.000Z

476

Stabilizing Exposure of Conserved Epitopes by Structure Guided Insertion of Disulfide Bond in HIV-1 Envelope Glycoprotein  

E-Print Network [OSTI]

bond will snap Env into a conformation that is less mobile and stably expose conserved sites. Therefore, we analyzed the interface between these gp120 layers (layers 1, 2 and 3) and identified residues that may form disulfide bonds when substituted...

Kassa, Aemro; Dey, Antu K.; Sarkar, Pampi; Labranche, Celia; Go, Eden P.; Clarck, Danile F.; Sun, Yide; Nandi, Avishek; Hartog, Karin; Desaire, Heather; Montefiori, David; Carfri, Andrea; Srivastava, Indresh K.; Barnett, Susan W.

2013-10-13T23:59:59.000Z

477

Characterization and assessment of uncertainty in San Juan Reservoir Santa Rosa Field  

E-Print Network [OSTI]

This study proposes a new, easily applied method to quantify uncertainty in production forecasts for a volumetric gas reservoir based on a material balance model (p/z vs. Gp). The new method uses only observed data and mismatches between regression...

Becerra, Ernesto Jose

2005-02-17T23:59:59.000Z

478

Estimation of original gas in place from short-term shut-in pressure data for commingled tight gas reservoirs with no crossflow  

E-Print Network [OSTI]

gas production (GP) under these circumstances. This research studies different empirical methods to estimate the original gas in place (OGIP) for one-layer or commingled two-layer tight gas reservoirs without crossflow, from short-term (72-hour) shut...

Khuong, Chan Hung

2012-06-07T23:59:59.000Z

479

Exploiting Two Intelligent Models to Predict Water Level: A field study of Urmia lake, Iran  

E-Print Network [OSTI]

Exploiting Two Intelligent Models to Predict Water Level: A field study of Urmia lake, Iran Shahab. The measurements from a single tide gauge at Urmia Lake, Northwest Iran, were used to train and validate the GP of Tabriz, Tabriz, Iran. Tel: 0098-411-3392786 Fax: 0098-411-3345332, (e-mail: sha- hab kvk66@yahoo

Fernandez, Thomas

480

Fluorescent protein pair emit intracellular FRET signal suitable for FACS screening  

SciTech Connect (OSTI)

The fluorescent proteins ECFP and HcRed were shown to give an easily resolved FRET-signal when expressed as a fusion inside mammalian cells. HeLa-tat cells expressing ECFP, pHcRed, or the fusion protein pHcRed-ECFP were analyzed by flow cytometry after excitation of ECFP. Cells expressing HcRed-ECFP, or ECFP and HcRed, were mixed and FACS-sorted for FRET positive cells: HcRed-ECFP cells were greatly enriched (72 times). Next, cloned human antibodies were fused with ECFP and expressed anchored to the ER membrane. Their cognate antigens (HIV-1 gp120 or gp41) were fused to HcRed and co-expressed in the ER. An increase of 13.5 {+-} 1.5% (mean {+-} SEM) and 8.0 {+-} 0.7% in ECFP fluorescence for the specific antibodies reacting with gp120 or gp41, respectively, was noted after photobleaching. A positive control (HcRed-ECFP) gave a 14.8 {+-} 2.6% increase. Surprisingly, the unspecific antibody (anti-TT) showed 12.1 {+-} 1.1% increase, possibly because overexpression in the limited ER compartment gave false FRET signals.

Johansson, Daniel X. [Karolinska Institutet, Department of Medicine, Karolinska Hospital, 171 76 Stockholm (Sweden); Brismar, Hjalmar [Karolinska Institutet, Department of Woman and Child Health, Karolinska Hospital, 171 76 Stockholm (Sweden); Royal Institute of Technology, Department of Cell Physics, KTH/SCFAB, 106 91 Stockholm (Sweden); Persson, Mats A.A. [Karolinska Institutet, Department of Medicine, Karolinska Hospital, 171 76 Stockholm (Sweden)]. E-mail: mats.persson@ki.se

2007-01-12T23:59:59.000Z

Note: This page contains sample records for the topic "kuwait gp guadeloupe" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Herbein et al. Retrovirology 2010, 7:34 http://www.retrovirology.com/content/7/1/34  

E-Print Network [OSTI]

functions in viral pathogenesis, notably by modulating cell signaling. The role of HIV-1 proteins (Nef, Tat Nef, Tat, Vpr, and gp120 proteins have been detected in the serum of HIV-1 infected patients. Possibly-1 pro- teins such as Nef, Tat, and Vpr have been detected in serum of HIV-1 infected patients

Paris-Sud XI, Université de

482

MBGP IN MODELLING AND PREDICTION Carlos OliverMorales  

E-Print Network [OSTI]

. Universitaria O4510 Mexico City, MEXICO Abstract. The paper describes a hybrid approach for dynamic system), relative humidity (H), solar radiation (R) and wind speed (V) and direction (D) were recorded. The time An alternative representation in GP for dynamic system modelling and prediction was presented. This MB

Fernandez, Thomas

483

Ultra-sensitive Calorimetry for Microwave Cyclotron Resonance in a Two-Dimensional Electron Gas  

E-Print Network [OSTI]

GP-B-1 Ultra-sensitive Calorimetry for Microwave Cyclotron Resonance in a Two-dimensional electron in GaAs quantum wells. We construct a differential nano-calorimetry which can operate at 300 mK the sensitivity for detecting CR heating to several nano-watts. This ultra-sensitive technique opens up

484

Numer. Math. 19,195-205 (1972) 0 by Springer-Verlag 1972  

E-Print Network [OSTI]

Fractions and Jacobi's Algorithm* W. A. Beyer Los Alamos Scientific Laboratory, Los Alamos, New Mexico M. S. Waterman Idaho State University, Pocatello, Idaho Received March 26,1971 Abstract. Ergodic computational at Los Alamos Scientific Laboratory. The work was also sup- ported in part by NSF grant GP-28313to M

Waterman, Michael S.

485

Single Molecule Force Spectroscopy of Salt-dependent Bacteriophage T7 Gene 2.5 Protein Binding to  

E-Print Network [OSTI]

Single Molecule Force Spectroscopy of Salt-dependent Bacteriophage T7 Gene 2.5 Protein Binding by single molecule force spectroscopy. T7 gp2.5- 26C, lacking 26 acidic C-terminal residues, also reduces of single DNA molecules by stretch- ing the molecules and measuring the required force for a given extension

Richardson, Charles C.

486

Use of Microdosing and Accelerator Mass Spectrometry To Evaluate the Pharmacokinetic Linearity of a Novel Tricyclic GyrB/ParE Inhibitor in Rats  

Science Journals Connector (OSTI)

...Novel Tricyclic GyrB/ParE Inhibitor in Rats Michael A. Malfatti a Victoria Lao a Courtney...preclinical drug candidate (GP-4) in rats as a step toward human microdosing studies...pharmacological dose was assessed in Sprague-Dawley rats. Plasma PKs over the 3 pharmacological...

Michael A. Malfatti; Victoria Lao; Courtney L. Ramos; Voon S. Ong; Kenneth W. Turteltaub

2014-08-18T23:59:59.000Z

487

A Class of Stochastic Volatility Models for Environmental Applications  

E-Print Network [OSTI]

Pharmaceuticals Inc. Ke Wang, Pfizer Inc. F. Jay Breidt, Colorado State University Richard A. Davis, Columbia stochastic volatility modeling to this context, resulting in a stochastic heteroscedastic process (SHP), which is unconditionally stationary and non-Gaussian. Conditional on a latent GP, the SHP

Breidt, F. Jay

488

STUDENT MENTAL HEALTH POLICY  

E-Print Network [OSTI]

pastoral care as well as teaching Take positive steps to promote students well-being Ensure the health students to make contact with their GP or local mental health services. The Duty of Care and Negligence1 STUDENT MENTAL HEALTH POLICY Revised January 2013 #12;2 A. INTRODUCTION 1. Context Widening

Martin, Ralph R.

489

University of Connecticut Health Center  

E-Print Network [OSTI]

with regarding any aspects of your health care. We will only communicate with those individuals that you note old) Grand Parent (GP) Parent (PA) Cousin (CO) Health Care Agent (HC) Sibling (SB) DCF Worker (PS) In) Cousin (CO) Health Care Agent (HC) Sibling (SB) DCF Worker (PS) In-law (IL) Spouse (SP) Foster Parent (FP

Oliver, Douglas L.

490

Oriented Attachment of Cytochrome P450 2C9 to a Self-Assembled Monolayer on a Gold Electrode as a Biosensor Design  

E-Print Network [OSTI]

V.V. , Bulko, T.V. , Suprun, E.V. , Kuznetsova, G.P. ,V.V. , Bulko, T.V. , Suprun, E.V. , Chalenko, Y.M. ,V.V. , Bulko, T.V. , Suprun, E.V. , Chalenko, Y.M. ,

Schneider, Elizabeth

2011-01-01T23:59:59.000Z

491

LESSONS LEARNED FROM A LANDFILL SLOPE FAILURE INVOLVING  

E-Print Network [OSTI]

LESSONS LEARNED FROM A LANDFILL SLOPE FAILURE INVOLVING GEOSYTNTHETICS Virginia L. Wilson.L. Soderman and G.P. Raymond November 12, 1998 #12;LESSONS LEARNED FROM A LANDFILL SLOPE FAILURE INVOLVING slopes at waste containment facilities. The Geneva Landfill is located near Geneva, Ohio which

492

High-resolution reversible folding of hyperstable RNA tetraloops using molecular dynamics simulations  

Science Journals Connector (OSTI)

...according to the approach proposed in the work by Chen and Pappu (20) to eliminate spurious ion-pairing artifacts...constant pressure of 1 atm. Dinucleotide Stacking PMFs. r(ApA), r(GpG), and r(UpU) dinu-cleotides were...

Alan A. Chen; Angel E. Garca

2013-01-01T23:59:59.000Z

493

Organisation of the Adaptive Computing in Design and Manufacture 2004 Conference. April 20-22, 2004, Engineers House, Clifton, Bristol, UK.  

E-Print Network [OSTI]

, Engineers House, Clifton, Bristol, UK. GENETIC PROGRAMMING WITHIN CIVIL ENGINEERING David Shaw1 , John Miles or real number strings. · Active vs Passive: Because GP usually evolves computer programs, the solutions binary strings i.e. passive structures, which require post-processing. · Variable vs fixed length

Fernandez, Thomas

494

Gifts in Memory of LEHIGH UNIVERSITY 1 Anonymous, in memory of  

E-Print Network [OSTI]

Gifts in Memory of LEHIGH UNIVERSITY 1 Anonymous, in memory of Gerald G. Leeman '71P '10GP Michael P. Ament, in memory of Hilda P. Ament and Miles K. Ament '49 Allen M. Barnett, in memory of Matthew A. Yantis '01 Samuel W. Barnhart, in memory of Donald H. Dimmick '55 Dorothy Barrows, in memory

Gilchrist, James F.

495

An Opto-electric Smart Material Detector with Wavelength-Dependent Bob Zheng,1  

E-Print Network [OSTI]

GP-B-19 An Opto-electric Smart Material Detector with Wavelength-Dependent Logic Bob and Computer Engineering, Rice University, Houston, Texas, U.S.A. Smart materials are artificial materials, or the coherent, collective oscillations of conduction-band electrons, are ideal sensors for smart materials due

496

NEW YORK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION  

E-Print Network [OSTI]

, constructed, operated and maintained Best Management Practices ("BMPs") that discharge or propose to dischargeFACT SHEET For NEW YORK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION Draft New York State) Permit No. GP-0-09-001 Issued Pursuant to Article 17, Titles 7, 8 and Article 70 of the Environmental

Pawlowski, Wojtek

497

Countries - U.S. Energy Information Administration (EIA)  

Gasoline and Diesel Fuel Update (EIA)

Countries Countries Glossary › FAQS › Overview Data Reports Analysis Briefs Countries Algeria Angola Argentina Australia Azerbaijan Brazil Canada China Colombia Congo (Brazzaville) Ecuador Egypt Gabon India Indonesia Iran Iraq Japan Kazakhstan Korea, South Kuwait Libya Malaysia Mexico Nigeria Norway Oman Qatar Russia Saudi Arabia Singapore South Africa Sudan and South Sudan Syria Thailand Turkey United Arab Emirates United Kingdom Venezuela Yemen Regional Caribbean Caspian Sea East China Sea Eastern Mediterranean Middle East & North Africa South China Sea Special Topics Emerging East Africa Energy OPEC Revenues Fact Sheet World Oil Transit Chokepoints World Regions Oil Production Oil Consumption Proved Reserves Click country for more information | Zoom Out | Zoom to: Zoom to Country: Afghanistan Albania Algeria American Samoa Angola

498

Countries - U.S. Energy Information Administration (EIA) - U.S. Energy  

Gasoline and Diesel Fuel Update (EIA)

Countries Countries Glossary › FAQS › Overview Data Reports Analysis Briefs Countries Algeria Angola Argentina Australia Azerbaijan Brazil Canada China Colombia Congo (Brazzaville) Ecuador Egypt Gabon India Indonesia Iran Iraq Japan Kazakhstan Korea, South Kuwait Libya Malaysia Mexico Nigeria Norway Oman Qatar Russia Saudi Arabia Singapore South Africa Sudan and South Sudan Syria Thailand Turkey United Arab Emirates United Kingdom Venezuela Yemen Regional Caribbean Caspian Sea East China Sea Eastern Mediterranean Middle East & North Africa South China Sea Special Topics Emerging East Africa Energy OPEC Revenues Fact Sheet World Oil Transit Chokepoints ERROR: Invalid Country Code The link you followed is incorrect. The administrator of this site has been notified via email. Thank you for your patience. Choose your country from the menu below; or, return to Country Profiles

499

Governance for Sustainable Development in the Arab Region | Open Energy  

Open Energy Info (EERE)

Sustainable Development in the Arab Region Sustainable Development in the Arab Region Jump to: navigation, search Name Governance for Sustainable Development in the Arab Region: Institutions and Instruments for Moving Beyond an Environmental Management Culture Agency/Company /Organization United Nations Economic and Social Commission for Western Asia Sector Energy Focus Area Energy Efficiency, Renewable Energy, Buildings, Industry, Transportation Topics Finance, Implementation, Policies/deployment programs Resource Type Guide/manual Website http://www.escwa.un.org/inform Country Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Sudan, Syria, United Arab Emirates, Yemen Western Asia, Northern Africa, Western Asia, Western Asia, Western Asia, Western Asia, Western Asia, Western Asia, Western Asia, Northern Africa, Western Asia, Western Asia, Western Asia

500

Crude Oil and Gasoline Price Monitoring  

Gasoline and Diesel Fuel Update (EIA)

What drives crude oil prices? What drives crude oil prices? November 13, 2013 | Washington, DC An analysis of 7 factors that influence oil markets, with chart data updated monthly and quarterly Crude oil prices react to a variety of geopolitical and economic events November 13, 2013 2 price per barrel (real 2010 dollars, quarterly average) Low spare capacity Iraq invades Kuwait Saudis abandon swing producer role Iran-Iraq War Iranian revolution Arab Oil Embargo Asian financial crisis U.S. spare capacity exhausted Global financial collapse 9-11 attacks OPEC cuts targets 1.7 mmbpd OPEC cuts targets 4.2 mmbpd Sources: U.S. Energy Information Administration, Thomson Reuters 0 20 40 60 80 100 120 140 1970 1975 1980 1985 1990 1995 2000 2005 2010 imported refiner acquisition cost of crude oil