Powered by Deep Web Technologies
Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Enhanced Operation Strategies for Air-Conditioning and Lighting Systems Toward Peak Power Reduction for an Office Building in Kuwait  

E-Print Network (OSTI)

Enhanced?Operation?Strategies?for?Air? Conditioning?and?Lighting? Systems?Toward?Peak?Power?Reduction? for?an?Office?Building?in?Kuwait F. Alghimlas A. Al-Mulla G.P. Maheshwari D. Al-Nakib Building and Energy Technologies Department... Environment and Urban Development Division ICEBO 2012 Manchester, United Kingdom October 23-26, 2012 Electricity?Use?by?Sector?in?Kuwait Percentages?of?Primary?Energy?Utilization Percentages?of?Electricity?Utilization Yearly?Increase?in...

Alghimlas, F.; Al-Mulla, A.; Maheshwari, G.P.; Al-Nakib, D.



Kuwait: World Oil Report 1991  

SciTech Connect

This paper reports that the major event in Kuwait today is the ongoing effort to control blowouts stemming from Iraqi demolition of oil wells and producing facilities last February. A total of 732 wells---about two- thirds of all wells in Kuwait---were blown up. All but 80 caught on fire.

Not Available



Kuwait City, Kuwait: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Kuwait: Energy Resources Kuwait: Energy Resources Jump to: navigation, search Name Kuwait City, Kuwait Equivalent URI DBpedia GeoNames ID 285787 Coordinates 29.369722°, 47.978333° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.369722,"lon":47.978333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Kuwait; The blowouts are history  

SciTech Connect

This paper reports on the capping of oil well blowouts in Kuwait. It reports on how access to the wells was gained, the well kill methods used, and future work that must be done in order to restore productivity.

Not Available



The Iraq-Kuwait Conflict  

Science Journals Connector (OSTI)

The reasons for Iraqs invasion of Kuwait on 2 August ... the links between the immediate factors that caused Iraqs invasion, and the historical forces that ... Specifically, the chapter will trace (a) Iraqs pa...



Water demand management in Kuwait  

E-Print Network (OSTI)

Kuwait is an arid country located in the Middle East, with limited access to water resources. Yet water demand per capita is much higher than in other countries in the world, estimated to be around 450 L/capita/day. There ...

Milutinovic, Milan, M. Eng. Massachusetts Institute of Technology



KU Today, May 2, 2012  

E-Print Network (OSTI)

:30 a.m. Thursday, May 3, at the BEST Conference Center in Overland Park. Full Story KUDOS Lights Out! contest winner named Twelve weeks have finally yielded a winner in the Lights Out! energy conservation competition at KU. The faculty... messages KUMC KU Alumni Association Edwards Campus Kansas Public Radio KU Today is produced by the Office of News and Media Relations, a division of Public Affairs. Timothy Caboni, vice chancellor for Public Affairs, caboni@ku.edu Jill...


KU Today, April 26, 2012  

E-Print Network (OSTI)

Thursday, April 26, 2012 KU teaches kids about nanoscale, energy A suite of new educational material at KU, as part of the Nanotechnology for Renewable Energy project, is introducing the world of nanoscale and energy to students... in elementary and middle schools. Much of the effort focuses on a new hands-on program for schools at the KU Natural History Museum, where students explore energy through the world of cartoon physics, including falling anvils, giant rubber bands and TNT...


How postcapping put Kuwait`s wells back onstream  

SciTech Connect

In late february 1991, the retreating Iraqi army blew up, or otherwise caused to blowout, some 700 wells in Kuwait. Between March and November, all of the fires were extinguished and the wells were capped. Work began in July 1991 to recomplete the damaged wells with replaced or reworked tubulars and well heads so that production could be resumed. Except for some of the earlier-capped wells into which cement was pumped, thus requiring more extensive downhole work, many of the damaged wells, particularly in Burgan field, were put back into production mode by the procedure described here, which became known as postcapping. This paper describes the equipment and techniques used in postcapping damaged wellheads.

Wilson, D. [ABB Vetco Gray Inc., Houston, TX (United States)



Kuwait poised for massive well kill effort  

SciTech Connect

This paper reports that full scale efforts to extinguish Kuwait's oil well fires are to begin. The campaign to combat history's worst oil fires, originally expected to begin in mid-March, has been hamstrung by logistical problems, including delays in equipment deliveries caused by damage to Kuwait's infrastructure. Meantime, production from a key field off Kuwait--largely unaffected by the war--is expected to resume in May, but Kuwaiti oil exports will still be hindered by damaged onshore facilities. In addition, Kuwait is lining up equipment and personnel to restore production from its heavily damaged oil fields. Elsewhere in the Persian Gulf, Saudi Arabia reports progress in combating history's worst oil spills but acknowledges a continuing threat.

Not Available



KU Today, February 27, 2012  

E-Print Network (OSTI)

, Classics Monday, Feb. 27, 2012 3:30 p.m.-5 p.m. Hall Center Seminar Room View all events TWITTER @KUNews: Introducing C Jay (Centennial), the 1912 Jayhawk mascot : http://instagr.am/p/HcdV8KjTdX/ #kubball View all tweets FEATURED...-864-3339 kurelations@ku.edu http://www.news.ku.edu Sent to ljohnson18@ku.edu why did I get this? unsubscribe from this list | update subscription preferences The University of Kansas 1314 Jayhawk Boulevard Lawrence, KS 66044 ...


Arsenic in shrimp from Kuwait  

SciTech Connect

Arsenic is ubiquitous in the environment and can accumulate in food via contaminated soil, water or air. It enters the food chain through dry and wet atmospheric deposition. Combustion of oil and coal, use of arsenical fertilizers and pesticides and smelting of ores contributes significantly to the natural background of arsenic in soils and sediments. The metal can be transferred from soil to man through plants. In spite of variation in acute, subacute, and chronic toxic effects to plants and animals, evidence of nutritional essentiality of arsenic for rats, goats, and guinea pigs has been suggested, but has not been confirmed for humans. Adverse toxic effects of arsenic as well as its widespread distribution in the environment raises concern about levels of arsenic in man`s diet. Higher levels of arsenic in the diet can result in a higher accumulation rate. Arsenic levels in marine organisms are influenced by species differences, size of organism, and human activities. Bottom dwellers such as shrimp, crab, and lobster accumulate more arsenic than fish due to their frequent contact with bottom sediments. Shrimp constitute approximately 30% of mean total seafood consumption in Kuwait. This study was designed to determine the accumulation of arsenic in the commercially important jinga shrimp (Metapenaeus affinis) and grooved tiger prawn (Penaeus semisulcatus). 13 refs., 3 figs., 1 tab.

Bou-Olayan, A.H. [Kuwait Univ. (Kuwait); Al-Yakoob, S.; Al-Hossaini, M. [Kuwait Institute for Scientific Research (Kuwait)



KU Today, November 5, 2012  

E-Print Network (OSTI)

as part of the Hall Center for the Humanities' lecture series. Full Story CAMPUS NEWS Wounded Warrior fundraiser KU's chapter of Young Americans for Liberty will host a formal charity dinner for the Wounded Warriors Project with College...


KU Today, December 6, 2012  

E-Print Network (OSTI)

.m. Friday, Dec. 7. Full Story More information TODAYS HEADLINES Algae-to-biofuel prospects KU is pursuing promising, but challenging, energy solutions, including biodiesel and other liquid transportation fuels, that can be produced from...


KU Today, December 11, 2012  

E-Print Network (OSTI)

Students perform for Broadway Holiday Revue More: photos | videos KU IN THE NEWS Science Daily (December 11, 2012) Most ancient evidence of insect camoflage Yahoo! News (December 10, 2012) Mayan apocalypse dooms medical research Native...


Kuwait Petroleum Corporation | Open Energy Information  

Open Energy Info (EERE)

Petroleum Corporation Petroleum Corporation Jump to: navigation, search Logo: Kuwait Petroleum Corporation Name Kuwait Petroleum Corporation Place Safat, Kuwait Zip 13126 Year founded 1980 Phone number (965) 1 85 85 85 Website http://www.kpc.com.kw/default. Coordinates 29.3715092°, 47.9734334° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.3715092,"lon":47.9734334,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Kuwait summons more fire fighting teams  

SciTech Connect

Kuwait is calling in more muscle to help kill its wild wells. This paper reports on the latest action in Kuwait, the leasing of well control contracts to Abel Engineering/Well Control Inc., Houston, and China Petroleum Engineering Construction Co. (CPEC). Abel is the sixth North American well control company called to the scene, while CPEC is the first summoned from the East. In addition, the service responsible for combating well fires and blowouts in the U.S.S.R.'s Azerbaijan oil fields signed an agreement with Kuwait's government, apparently involving a contract valued at more than $100 million, to extinguish fires at 150 Kuwaiti wells, reported Eastern Bloc Energy, a publication of Eastern Bloc Research Ltd., Newton Kyme, U.K. More help likely is on the way.

Not Available



Kuwait pressing toward preinvasion oil production capacity  

SciTech Connect

Oil field reconstruction is shifting focus in Kuwait as the country races toward prewar production capacity of 2 million b/d. Oil flow last month reached 1.7 million b/d, thanks largely to a massive workover program that has accomplished about as much as it can. By midyear, most of the 19 rigs in Kuwait will be drilling rather than working over wells vandalized by retreating Iraqi troops in February 1991. Seventeen gathering centers are at work, with capacities totaling 2.4 million b/d, according to state-owned Kuwait Oil Co. (KOC). This article describes current work, the production infrastructure, facilities strategy, oil recovery, well repairs, a horizontal pilot project, the drilling program, the constant reminders of war, and heightened tensions.

Tippee, B.



KU Today, April 17, 2013  

E-Print Network (OSTI)

TODAYS HEADLINES President's visit canceled President Barack Obama has canceled his April 19 event at KU in light of the tragedy at the Boston Marathon on Monday, the White House has announced. Full Story Student NSF fellowships awarded... engineering from Topeka, was recently selected as the winner of the Engineers Without Borders USA 2013 Professional Founders Award. Full Story KU IN THE NEWS Science World Report (April 17, 2013) Study: Fish oil helps in preventing premature...


KU Today, September 28, 2012  

E-Print Network (OSTI)

to dramatically drop the costs of PV technology in the future. Full Story CAMPUS NEWS Dole archive research fellow The Robert J. Dole Institute Archive and Special Collections at KU will host its 2012 Research Fellow, Prakash Kumar, from today... until Oct. 4. Kumar is researching the science of genetically modified crops, globalization and civil society resistance in India. Full Story CONNECT connect.ku.edu CAMPUS LINKS Chancellor's messages Provost e-news KUMC leadership...

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


KU Today, September 15, 2012  

E-Print Network (OSTI)

KU Today Campus Newsletter | Problems viewing this e-mail? View online. Thursday, November 15, 2012 Grant to support video game series The National Science Foundation has awarded KUs Center for Research on Learning and Filament... Games of Madison, Wis., $500,000 to design and research a new series of video games in life sciences to help all students, including learners who struggle and those with disabilities in science. Full Story TODAYS HEADLINES Humanitarian...


KU Today, July 24, 2012  

E-Print Network (OSTI)

, featuring secular holiday- and winter-themed music during local programming. Full Story CAMPUS NEWS Director of undergraduate services The College of Liberal Arts and Sciences at KU has completed its search for a new undergraduate office... the myth of college athletes as amateurs, a KU professor argues in a recently published study. Angela Lumpkin, professor of health, sport and exercise science, has proposed 14 changes for college athletics with input from the Knight Commission...


KU Today, July 5, 2012  

E-Print Network (OSTI)

KU Today Campus Newsletter | Problems viewing this e-mail? View online. Thursday, July 5, 2012 Landmark discovery for 'God particle' Researchers announced a breakthrough discovery of a subatomic particle strongly resembling the long...- sought Higgs boson, or "God particle," on Wednesday in Geneva. Read past coverage about how KU researchers have played a part in designing and monitoring the colossal detector at the European Organization for Nuclear Research, where the discovery...


Kuwait: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Kuwait: Energy Resources Kuwait: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.5,"lon":47.75,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Minimizing casing corrosion in Kuwait oil fields  

SciTech Connect

Corrosion in production strings is a well known problem in Kuwait oil fields. Failure to remedy the affected wells results mainly in undesirable dump flooding of the oil reservoirs, or in oil seepage and hydrocarbon contamination in shallow water bearing strata. Any of these situations (unless properly handled) leads to a disastrous waste of oil resources. This study discusses casing leaks in Kuwait oil fields, the nature of the formations opposite the leaks and their contained fluids, and the field measures that can be adopted in order to avoid casing leak problems.

Agiza, M.N.; Awar, S.A.



U.S. Energy Secretary Visits Kuwait | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Kuwait Kuwait U.S. Energy Secretary Visits Kuwait November 15, 2005 - 2:30pm Addthis Stop included meeting with U.S. business leaders and military troops KUWAIT CITY, KUWAIT - On Monday, November 14, 2005, U.S. Department of Energy Secretary Samuel W. Bodman toured the EQUATE petrochemical plant and met with U.S. business representatives while visiting Kuwait, as part of his trip through the Middle East. The EQUATE petrochemical plant is a joint venture between Kuwait's Petrochemical Industries Company (PIC) and U.S. company Union Carbide, a subsidiary of The Dow Chemical Company. "The EQUATE petrochemical plant is a wonderful example of international cooperation and investment. We are pleased that the joint venture between the Petrochemical Industries Company and Dow Chemical has been so


State of Kuwait Ministry of Oil | Open Energy Information  

Open Energy Info (EERE)

State of Kuwait Ministry of Oil State of Kuwait Ministry of Oil Jump to: navigation, search Logo: State of Kuwait Ministry of Oil Country Kuwait Name State of Kuwait Ministry of Oil City Kuwait City, Kuwait Website http://www.moo.gov.kw/ Coordinates 29.3697222°, 47.9783333° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":29.3697222,"lon":47.9783333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Political Advertising in Kuwait A Functional Analysis  

E-Print Network (OSTI)

Political Advertising in Kuwait A Functional Analysis Jasem Alqaseer Abstract: Most political (Kaid, 2006). In general, political advertising studies focused on the content of political advertising especially on the subject of issues vs. images in advertising. In addition, many studies of political

Almor, Amit


Characterizing Surface Temperature and Clarity of Kuwait's Seawaters Using Remotely Sensed Measurements and GIS Analyses  

E-Print Network (OSTI)

Kuwait sea surface temperature (SST) and water clarity are important water characteristics that influence the entire Kuwait coastal ecosystem. The aim of this project was to study the spatial and temporal distributions of Kuwait SST using MODIS...

Alsahli, Mohammad M. M.



KU Today, February 19, 2013  

E-Print Network (OSTI)

West Side Story Tuesday, Feb. 19, 2013 7:30 p.m. Lied Center Auditorium View all events TWITTER @SpencerMuseum Work has begun on "An Errant Line," as artist Cynthia Schira is on-site overseeing the installation of her work: http://yfrog.com.../gyuzlicj View all tweets KU IN THE NEWS Yahoo Finance (Feb. 19) Money skills key to child's future success KCUR (Feb. 4) University of Kansas changes core curriculum CONNECT connect.ku.edu CAMPUS LINKS Chancellor's messages Provost e...


Ecological disaster in Kuwait; A burning question  

SciTech Connect

Six million barrels of oil are going up in smoke each day in Kuwait, dumping 3.7 million pounds of toxic gases, soot, and smoke - including cancer-causing compounds - into the air each hour. This paper reports that the prognosis for the situation is dim. Even as specialized firefighting companies from the United States and Canada began arriving in Kuwait in March, oil officials there predicted dousing the fires would take at least two years and pumping up oil production to pre-war levels would take between five and 10 years. An oil well fire is a disaster. The effect on the ozone, the ecology, the marine life is massive. We aren't even breathing air here, we're just breathing smog.

Wray, T.K. (Waste Away Services, Perrysburg, OH (US))



Case histories of temperature surveys in Kuwait  

SciTech Connect

Most crude produced in Kuwait is from naturally flowing wells. Casing, tubing, and cement in these wells remain unchanged after completion. This study discusses the major application of temperature surveys in indicating fluid movement both inside and behind the production string, hence locating any holes in the casing. Some significant cases of temperature anomalies are examined qualitatively, and suggestions are made for a more quantitative interpretation of temperature profiles. 9 refs.

Gupta, B.S.



Airborne Studies of the Smoke from the Kuwait Oil Fires  

Science Journals Connector (OSTI)

...smoke from the Kuwait fires produced a small-scale...Concluding Remarks The airborne studies of the smoke from the Kuwait fires provided a large...1. Uncontrolled releases of oil began in January...and the oil field fires began in late February...Zimmerman). 3. An airborne study of the smoke...

Peter V. Hobbs; Lawrence F. Radke



KU Today, March 15, 2013  

E-Print Network (OSTI)

for powering vehicles. Full Story KPR sponsors Garrison Keillor event Kansas Public Radio and the Johnson County Community College Performing Arts Series are bringing Garrison Keillor to the stage March 27 in Overland Park as KPR celebrates its 60th... the non-discrimination policies: Director of the Office of Institutional Opportunity and Access, IOA@ku.edu, 1246 W. Campus Road, Room 153A, Lawrence, KS, 66045, (785)864-6414, 711 TTY. ...


KU Today, October 16, 2012  

E-Print Network (OSTI)

KU Today Campus Newsletter | Problems viewing this e-mail? View online. Tuesday, October 16, 2012 High honors for science fiction writing Kij Johnson, assistant professor of English at the University of Kansas, has won a Hugo Award..., considered the most prestigious U.S. honor for science fiction writers. Johnson earned the majority vote among six nominees in the Best Novella category. Her work The Man Who Bridged the Mist also won the Nebula Award earlier this year. Full Story...


KU Today, October 26, 2012  

E-Print Network (OSTI)

Mechanics (Oct. 25, 2012) Start your mad science CAMPUS NEWS Learn about 'the Dashing Kansan' The Adventures of Lewis Lindsay Dyche and the Advent of Kansas Conservation, a lecture and performance, will be at 7 p.m. Nov. 4 in The Commons... at Spooner Hall. Full Story KUDOS Student minority sciences conference Seventeen KU and 11 Haskell Indian Nations University students attended the 2012 Society for Advancement of Chicanos and Native Americans in Science conference last week...


KU Today, October 11, 2012  

E-Print Network (OSTI)

devices for disabilities With a $125,000 grant from the National Science Foundation, Ken Fischer, KU associate professor of mechanical engineering, is leading his students in a capstone design/build project to provide Kansans living with disabilities...s Rhetoric and the 2012 Presidential Election" at 7:30 p.m. Oct. 24 in the Kansas Union's Woodruff Auditorium. Full Story Science on Tap: Universal expansion The expansion of the universe and its cause known as one of greatest mysteries...


Institute for Software Technology Compilerbau (1 KU)  

E-Print Network (OSTI)

Aufgabenblätter · Abgabeboxg · 5 Bonuspunkte für das Vorrechnen an der Tafel · Deckblatt: 3 Compilerbau KU 2012 #12;Institute


An option pricing theory explanation of the invasion of Kuwait  

SciTech Connect

The objective of this paper is to explain the invasion of Kuwait by making an analogy between a call option and the Iraq-Kuwait situation before the invasion on August 2, 1990. A number of factors contributed to the issuance of a deep-in-the money European call option to Iraq against Kuwait. The underlying asset is the crude oil reserves under Kuwait. Price of crude oil is determined in world spot markets. The exercise price is equal to the cost of permanently annexing and retaining Kuwait. The volatility is measured by the annualized variance of the weekly rate of return of the spot price of crude oil. Time-to-expiration is equal to the time period between decision date and actual invasion date. Finally, since crude oil prices are quoted in U.S. dollars, the U.S. Treasury bill rate is assumed to be the risk-free rate. In a base-case scenario, Kuwait`s oil reserves amount to 94,500 million barrels valued at $18 a barrell in early February 1990 resulting in a market value of $1,701 billion. Because the cost of the war to Iraq is not known, we assume it is comparable to that of the U.S.-led coalition of $51.0 billion. Time-to-expiration is six months. The treasury bill rate in early 1990 was around 7.5 percent. Annualized standard deviation of weekly rates of return is 0.216. The value of Kuwait`s invasion option is $1,642.25 billion. Depending on the scenario, the value of this special option ranged between $1,450 billion and $3.624 billion. 10 refs., 1 tab.

Muhtaseb, M.R.



Analysis of sustainable water supply options for Kuwait  

E-Print Network (OSTI)

This thesis considers several options for improving the sustainability of Kuwait's water supply system. The country currently relies heavily on desalination and brackish groundwater extraction. The options considered for ...

Murtaugh, Katharine A. (Katharine Ann)


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Physical properties of soils contaminated by oil lakes, Kuwait  

SciTech Connect

In preparation for a marine assault by the coalition forces, the Iraqi Army heavily mined Kuwait`s coastal zone and the oil fields. Over a million mines were placed on the Kuwait soil. Burning of 732 oil wells in the State of Kuwait due to the Iraqi invasion caused damages which had direct and indirect effect on environment. A total of 20-22 million barrels of spilled crude oil were collected in natural desert depressions and drainage network which formed more than 300 oil lakes. The total area covered with oil reached 49 km{sup 2}. More than 375 trenches revealed the existence of hard, massive caliche (CaCO{sub 3}) subsoil which prevent leached oil from reaching deeper horizons, and limited the maximum depth of penetration to 1.75 m. Total volume of soil contaminated reached 22,652,500 m{sup 3} is still causing environmental problems and needs an urgent cleaning and rehabilitation. Kuwait Oil Company has recovered approximately 21 million barrels from the oil lakes since the liberation of Kuwait. In our examined representative soil profiles the oil penetration was not deeper than 45 cm. Infiltration rate, soil permeability, grain size distribution, aggregates formation and water holding capacity were assessed. 15 refs., 5 figs., 5 tabs.

Mohammad, A.S. [Kuwait Univ., Safat (Kuwait); Wahba, S.A.; Al-Khatieb, S.O. [Arabian Gulf Univ. (Bahrain)



Impact of Kuwait`s oil-fire smoke cloud on the sky of Bahrain  

SciTech Connect

The effects of the Kuwaiti oil well fires of 1991 on the atmospheric parameters of Bahrain (approximately 600 km southeast of Kuwait) were observed. Solar radiation, optical thickness, ultraviolet radiation, horizontal visibility, temperature, and solar spectral distribution were measured for 1991 and compared to the long-term values of 1985-1990. The relative monthly solar radiation in Bahrain was reduced by 8% (February) when 50 oil wells were burning and reduced further to 20% when 470 oil wells were on fire (April-July). In November 1991, when there were 12 oil wells burning, the recorded solar radiation became nearly equal to the long-term average. The monthly average daily optical thickness, {tau}, for the direct or beam solar radiation was calculated. The values of {tau} were found to be larger in 1991 than the average for the years 1985-1990 by nearly 58% during June and returned to normal in October (after nearly all the oil well fires were extinguished). The clear and smoked sky solar spectra distribution were detected before and during the burning of the Kuwait oil wells. Large absorption of the solar radiation was noticed on the 2nd and 3rd of March, 1991. The daily average infrared radiation during 1990 was found to be 6700.4 Whm{sup -2} and shifted to 9182.1 Whm{sup -2} in 1991. Comparison was also made between 1990 and 1991 data of the global solar radiation and the temperature. 13 refs., 12 figs., 1 tab.

Alnaser, W.E. [Univ. of Bahrain (Bahrain)] [Univ. of Bahrain (Bahrain)



KuROS: A New Airborne Ku-Band Doppler Radar for Observation of Surfaces  

Science Journals Connector (OSTI)

This study presents the new airborne Doppler radar Ku-Band Radar for Observation of Surfaces (KuROS), which provides measurements of the normalized radar cross section ? and of the Doppler velocity over the sea. The system includes two antennas ...

Grard Caudal; Danile Hauser; Ren Valentin; Christophe Le Gac



Ground level concentration of sulfur dioxide at Kuwait`s major population centers during the oil-field fires  

SciTech Connect

During the Iraqi occupation, Kuwait`s oil wells were ignited. the fires were damaging to the country`s oil resources and air quality. The impact of the oil-field fires on the air quality was studied to determine the level of exposure to pollutants in major population centers. The period of July-September 1991 was selected for examination. A mathematical model was used to compute the ground-level concentration isopleths. The results of these computations are supported by significant concentrations measured and reported by the Environmental Protection Council, Kuwait. The ground-level concentrations of sulfur dioxide in the major population centers, whether measure or estimated, were less than the ambient standards of the U.S. Environmental Protection Agency`s air pollution index. The dispersive characteristics were classified according to wind conditions. The results of this assessment provide historical data on Kuwait`s oil fires and may be useful in assessing risks resulting from this catastrophe. 6 refs., 10 fig., 2 tab.

Al-Ajmi, D.N.; Marmoush, Y.R. [Kuwait Institute for Scientific Research (Kuwait)] [Kuwait Institute for Scientific Research (Kuwait)



EA-319 Fortis Energy Marketing & Trading GP | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fortis Energy Marketing & Trading GP EA-319 Fortis Energy Marketing & Trading GP Order authorizing Fortis Energy Marketing & Trading GP to export electric energy to Canada EA-319...


Fate and control of blistering chemical warfare agents in Kuwait`s desalination industry  

SciTech Connect

Kuwait, as most of the other states located along the Western shores of the Arabian Gulf, relies upon the Gulf as its main drinking water resource via desalination. In case of seawater contamination with blistering chemical warfare agents, traces of the agents and/or degradation products in the finished water might pose a serious health hazard. The objective of the present review is to study the potential contamination, transport, fate, effect and control of blistering chemical warfare agents (CWAs), in the Kuwaiti desalination industry. In general, all the environmental factors involved in the aquatic degradation of CWAs in Kuwait marine environment except for the high salinity in case of blistering agents such as sulphur mustard, and in favor of a fast degradation process. In case of massive releases of CWAs near the Kuwaiti shorelines, turbulence resulting from tidal cycles and high temperature will affect the dissolution process and extend the toxicity of the insoluble agent. Post- and pre-chlorination during the course of seawater desalination will catalyze and significantly accelerate the hydrolysis processes of the CWAs. The heat exerted on CWAs during the power generation-desalination processes is not expected to thermally decompose them. However, the steam heat will augment the agent`s rate of hydrolysis with subsequent acceleration in their rate of detoxification. Conventional pretreatment of feed seawater for reverse-osmosis desalination is theoretically capable of reducing the concentration of CWAs by coprecipitation and adsorption on flocs formed during coagulation. Prechlorination and prolonged detention in time in pretreatment units will simultaneously promote hydrolysis reactions. 50 refs.

Khordagui, H.K. [United Nations Economic and Social Commission for West Asia, Amman (Jordan)



MEW Efforts in Reducing Electricity and Water Consumption in Government and Private Sectors in Kuwait  

E-Print Network (OSTI)

of Engineers, membership No. 1715. MEW EFFORTS IN REDUCING ELECTRICITY AND WATER CONSUMPTION IN GOVERNMENT AND PRIVATE SECTORS IN KUWAIT Eng. Iqbal Al-Tayar Manager ? Technical Supervision Department Planning and Training Sector Ministry... of Electricity & Water (MEW) - Kuwait Historical Background - Electricity ? In 1913, the first electric machine was installed in Kuwait to operate 400 lambs for Al-Saif Palace. ? In 1934, two electric generators were installed with a total capacity of 60 k...

Al-Tayar, I.



E-Print Network 3.0 - algeria iraq kuwait Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya Source: Capecchi, Mario R. - Department of Biology, University...


The crisis in Kuwait and U. S. refiners' travail  

SciTech Connect

The August 2, 1990, invasion of Kuwait on the part of Iraq has set in motion an accelerated domino affect in US fuels markets. The impact on US refiners has been generally negative, both in terms of margins and perceptions of same. This issue of Energy Detente (ED) updates a few directional indicators that affect refining margins and considers longer-term refining capacity requirements in the US. ED feels the invasion of Kuwait might force oil companies to allocate more talent, time, and financial resources to public affairs. This issue also contains the following: (1) The ED Refining Netback Data Series for the US Gulf and West Coasts, Rotterdam, and Singapore as of Aug. 24, 1990; and (2) the ED Fuel Price/Tax Series for countries of the Eastern Hemisphere Aug. 1990 edition. 4 figs., 5 tabs.

Not Available



Digital Publishing Services at KU Libraries  

E-Print Network (OSTI)

Fo lk lo ric a Jo ur na l o f D ra m at ic T he or y an d Cr iti ci sm La tin A m er ic an T he at re R ev ie w Tr ea tis e O nl in e FULL OPEN ACCESS OPEN ACCESS AFTER EMBARGO SUBSCRIBERS ONLY 11,837 Brian Rosenblum Head, Center for Faculty.... Over 1 million downloads in 2013! 8 JOURNALS IN OPEN JOURNAL SYSTEMS (JOURNALS@KU) 8 JOURNALS IN DSPACE (KU SCHOLARWORKS) & Two platforms support a range of publishing models A us le gu ng : A jo ur na l o f p hi lo so ph y Bi od iv er si ty In fo...

Reed, Marianne A.; Rosenblum, Brian



EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) Order authorizing Fortis...


Research and Graduate Studies at KU Newsletter, March 2013  

E-Print Network (OSTI)

Index 1 page 1 Research & Graduate Studies @ KU News of Interest to the University Community Past Issues Subscribe March 2013 Federal Funds Sequester Begins A sequester of federal funding began on March 1, requiring most... federal agencies including those that fund much of the sponsored research at KU to reduce their authorized spending by 5.1% for the year-ending September 30, 2013. To assist KU researchers in following issues surrounding the sequester, the Office...



KU to host symposium on GIS and mapping Nov 18  

E-Print Network (OSTI)

12/5/13 KU to host symposium on GIS and mapping Nov 18 www.lib.ku.edu/news/gis2009.shtml 1/2 Contact Us Rebecca Smith Director of Communications & Advancement KU Libraries Lawrence, Kansas 66045 rasmith@ku.edu (785) 864-1761 RESEARCH TOOLS... and mapping, an information and job fair and a student presentation competition. Last years event attracted more than 200 people from academia, the private sector and government. GIS technologies have grown in use and importance over the last two decades...



Trace gas measurements in the Kuwait oil fire smoke plume  

SciTech Connect

The authors report trace gas measurements made both inside and outside the Kuwait oil-fire smoke plume during a flight of an instrumented research aircraft on May 30, 1991. Concentrations of SO{sub 2}, CO, and NO{sub x} averaged vertically and horizontally throughout the plume 80 km downwind of Kuwait City were 106, 127, and 9.1 parts per billion by volume (ppbv), respectively, above background concentrations. With the exception of SO{sub 2}, trace gas concentrations were far below typical US urban levels and primary national ambient air quality standards. Ambient ozone was titrated by NO in the dark, dense core of the smoke plume close to the fires, and photochemical ozone production was limited to the diffuse edge of the plume. Photochemical O{sub 3} production was noted throughout the plume at a distance of 160 km downwind of Kuwait City, and averaged 2.3 ppbv per hour during the first 3 hours of transport. Little additional photochemical production was noted at a downwind range of 340 km. The fluxes of sulfur dioxide, carbon monoxide, and reactive nitrogen from the roughly 520 fires still burning on May 30, 1991 are estimated at 1.4 x 10{sup 7} kg SO{sub 2}/d, 6.9 x 10{sup 6} kg CO/d, and 2.7 x 10{sup 5} kg N/d, respectively. Generally low concentrations of CO and NO{sub x} indicate that the combustion was efficient and occurred at low temperatures. Low total nonmethane hydrocarbon concentrations suggest that the volatile components of the petroleum were burned efficiently. 37 refs., 4 figs., 4 tabs.

Luke, W.T.; Kok, G.L.; Schillawski, R.D.; Zimmerman, P.R.; Greenberg, J.P.; Kadavanich, M. [National Center for Atmospheric Research, Boulder, CO (United States)



Effect of oil pollution on fresh groundwater in Kuwait  

SciTech Connect

Massive oil fires in Kuwait were the aftermath of the Gulf War. This resulted in the pollution of air, water, and soil, the magnitude of which is unparalleled in the history of mankind. Oil fires damaged several oil well heads, resulting in the flow of oil, forming large oil lakes. Products of combustion from oil well fires deposited over large areas. Infiltrating rainwater, leaching out contaminants from oil lakes and products of combustion at ground surface, can reach the water table and contaminate the groundwater. Field investigations, supported by laboratory studies and mathematical models, show that infiltration of oil from oil lakes will be limited to a depth of about 2 m from ground surface. Preliminary mathematical models showed that contaminated rainwater can infiltrate and reach the water table within a period of three to four days, particularly at the Raudhatain and Umm Al-Aish regions. These are the only regions in Kuwait where fresh groundwater exists. After reaching the water table, the lateral movement of contaminants is expected to be very slow under prevailing hydraulic gradients. Groundwater monitoring at the above regions during 1992 showed minor levels of vanadium, nickel, and total hydrocarbons at certain wells. Since average annual rainfall in the region is only 120 mm/yr, groundwater contamination due to the infiltration of contaminated rainwater is expected to be a long-term one. 13 refs., 15 figs., 2 tabs.

Al-Sulaimi, J.; Viswanathan, M.N.; Szekely, F. [Kuwait Institute for Scientific Research, Safat (Kuwait)



Chemical and physical properties of emissions from Kuwait oil fires  

SciTech Connect

After the Iraqi retreat from Kuwait in 1991, airborne sampling was conducted in the oil fire plumes near Kuwait City and ground-level samples were taken of the air within the city. For the airborne sampling, a versatile air pollution sampler was used to determine the SO(2), elemental concentrations, the aerosol mass loadings and SO4(2-) and NO3(1-) concentrations. Striking differences between the black and white plumes were associated with high concentrations of NaCl and CaCl(2) measured in the white plumes and large numbers of carbon chain agglomerates in the black plumes. For the ground-based measurements, an annular denuder system was used to determine levels of SO(2), SO4(2-), trace elements, and mass loadings. Certain pollutant levels rose in the city during inversion conditions, when winds were too weak to continue moving the combustion products directly to the Persian Gulf, and the increased levels of Pb and certain trace elements were comparable to those in other large urban areas in Europe.

Stevens, R.; Pinto, J.; Mamane, Y.; Ondov, J.; Abdulraheem, M.



New results on GP Com  

E-Print Network (OSTI)

We present high resolution optical and UV spectra of the 46 min orbital period, helium binary, GP Com. Our data contains simultaneous photometric correction which confirms the flaring behaviour observed in previous optical and UV data. In this system all lines show a triple peaked structure where the outer two peaks are associated with the accretion disc around the compact object. The main aim of this paper is to constrain the origin of the central peak, also called ``central spike''. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is ~10 km/s indicating that its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. Our resolution is higher than that of previous data which allows us to resolve structure in the central peak of the line. The central spike in three of the HeI lines shows another peak blueshifted with respect to the main peak. We propose that one of the peaks is a neutral helium forbidden transition excited in a high electron density region. This forbidden transition is associated with the permitted one (the stronger peak in two of the lines). The presence of a high electron density region again favours the white dwarf as their origin.

L. Morales-Rueda; T. R. Marsh; D. Steeghs; E. Unda-Sanzana; Janet H. Wood; R. C. North



Social and Economic Challenges of Implementing Sustainable Materials on Buildings in Kuwait  

E-Print Network (OSTI)

electrical load reached in 2012 was 11,850MW and according to 2011 statistics each person in Kuwait consumes 600L of water a day. By implementing LEED we hope these figures will significantly decrease. There will be economic benefits from an obvious... for the materials and resources credit for an existing building in Kuwait will be highlighted LEED EB O&M Points Scale Building Owners and Decision Makers in Kuwait have to Understand the Benefits of Implementing LEED A green building will reduce the negative...

Al-Foraih, R.; Al-Fahad, F.



Research and Graduate Studies at KU Newsletter, April 2012  

E-Print Network (OSTI)

Nine KU Students, Alumni Receive NSF Fellowships 6 Doctoral Hooding Ceremony Scheduled for May 12 6 KU-Haskell Student Research Symposium is April 17 7 John Colombo Steps Down as HSCL Chair, Succeeded by Bruce Frey 7 Etzel-Wise, Iles...@ku.edu. Index 1 page 7 John Colombo Steps Down as HSCL Chair, Succeeded by Bruce Frey After 19 years as chair of the Human Subjects Committee, Lawrence Campus (HSCL), John Colombo, professor of psychology and director of the Life Span Institute...



Implementation of Simple Measures for Savings Water and Energy Consumption in Kuwait Government Buildings  

E-Print Network (OSTI)

This paper gives in details the efforts made by the Public Services Department (PSD) to reduce water and energy consumptions in the Ministry of Social Affairs and Labour's (MOSAL) buildings in Kuwait. PSD manages around 125 buildings distributed...

Albaharani, H.; Al-Mulla, A.


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


International project finance : the case of Kuwait Fund for Arab Economic Development  

E-Print Network (OSTI)

This thesis examines the record of the Kuwait Fund for Arab Economic Development (KFAED) in light of changing fashions regarding the proper role and management of such funds in the development finance process. The key ...

Al-Jassar, Sulaiman Ahmed



Offshore sedimentary facies of a modern carbonate ramp, Kuwait, northwestern Arabian-Persian Gulf  

Science Journals Connector (OSTI)

The Kuwait example studied here may serve as a model for ancient carbonate ramp systems just as the classicalbut markedly differentsouthern Arabian-Persian Gulf ramp of the Trucial Coast (United Arab...

Eberhard Gischler; Anthony J. Lomando



Ozone chemistry in the smoke from the Kuwait oil fires  

SciTech Connect

Ozone depletion occurred in the core of the plume of smoke from the Kuwait oil fires within 100 km of the fires, primarily in regions where NO{sub x} concentrations were high and ultraviolet flux was near zero. Rapid conversion of NO to NO{sub 2} can explain almost all of the ozone loss. Ozone was produced in diffuse regions of the plume, where the ultraviolet flux was higher than in the core. However, due to the relatively high ratio of nonmethane hydrocarbons to NO{sub x}, ozone production was slow. Since ozone was produced in a much larger volume than it was depleted, the plume as a whole was a source of ozone on a regional scale. 27 refs., 4 figs., 1 tab.

Herring, J.A.; Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)



Research and Graduate Studies at KU Newsletter, May 2012  

E-Print Network (OSTI)

of Lawrence. He succeeds John Colombo, director of the Life Span Institute, who had served as chair since 1993. "John has worked hard to establish an institutional review board with a uniquely positive reputation, said Frey. The Human Subjects Committee... for May 12 2 Far Above Campaign Goal: Elevate KU to New Heights 2 Bruce Frey Named Chair of Human Subjects Committee of Lawrence 3 Grant Program Seeks Proposals for Seed Funding of External Support 3 Frank Schoenen Receives 2012 KU Research...



Studies of the Kuwait oil fire plume during midsummer 1991  

SciTech Connect

This paper reports aircraft observations of the Kuwait oil fire plume conducted during the period July 31-August 17, 1991. During this study the plume was transported almost exclusively to the south of Kuwait over the Persian Gulf and the Arabian Peninsula. The plume base was generally found to be well above the surface, in some cases as high as 1-2 km; plume tops did not exceed 5 km. Aerosol mass (based on measured aerosol constituents) in the central section of the plume, ca. 150-200 km downwind of the source region, was found to be >500 {mu}g/m{sup 3}, with number densities in the size range (approximate) 0.2 < d < 3 {mu}m (where d is diameter) as high as 30,000/cm{sup 3}. The aerosol was composed of (in order of approximate contribution to mass) inorganic salts, elemental carbon, and organic carbon. Sodium chloride constituted a surprisingly large component of the soluble inorganic mass. The aerosol particles appeared to function as good cloud condensation nuclei, with a large fraction of accumulation mode particles (by number) activated at a supersaturation of 0.6%. Under conditions in which the plume was relatively compact, transmittance of solar radiation to the surface was only 10-20%. Plume albedo was observed to be as low as 2-3% close to the source region, consistent with the high elemental-carbon concentrations present in the plume. Trace gas concentrations were consistent with fuel composition and with current knowledge of atmospheric chemical processes. Sulfur dioxide concentrations close to the source region were found to be as high as 300-400 ppb. The emissions factor for S (expressed as a percentage) was estimated to be 1.8%, which is consistent with estimates of a fuel sulfur content of 2-2.5%. SO{sub 2} was found to be only slowly oxidized (<1%/h). Nitrogen oxide concentrations were found to be quite low (<50 ppb near the source, decreasing to 1-2 ppb well downwind), which is consistent with a crude oil nitrogen source. 32 refs., 15 figs., 7 tabs.

Daum, P.H.; Al-Sunaid, A.; Busness, K.M.; Hales, J.M.; Mazurek, M. [Brookhaven National Lab., Upton, NY (United States)



Chemical composition of emissions from the Kuwait oil fires  

SciTech Connect

Airborne measurements in the smoke from the Kuwait oil fires in May and June 1991 indicate that the combined oil and gas emissions were equivalent to the consumption of about 4.6 million barrels of oil per day. The combustion was relatively efficient, with about 96% of the fuel carbon burned emitted as CO{sub 2}. Particulate smoke emissions averaged 2% of the fuel burned, of which about 20% was soot. About two-thirds of the mass of the smoke was accounted for by salt, soot, and sulfate. The salt most likely originated from oil field brines, which were ejected from the wells along with the oil. The salt accounts for the fact that many of the plumes were white. SO{sub 2} and NO{sub x} were removed from the smoke at rates of about 6 and 22% per hour, respectively. The high salt and sulfate contents explain why a large fraction of the particles in the smoke were efficient cloud condensation nuclei. 14 refs., 3 figs., 1 tab.

Ferek, R.J.; Hobbs, P.V.; Herring, J.A. [Univ. of Washington, Seattle, WA (United States); Laursen, K.K. [National Center for Atmospheric Research, Boulder, CO (United States); Weiss, R.E. [Oregon Graduate Institute of Science and Technology, Beaverton, OR (United States); Rasmussen, R.A. [Radiance Research, Inc., Seattle, WA (United States)



Taking stock of Saddam's fiery legacy in Kuwait  

SciTech Connect

Six months after Saddam Hussein's torching of more than 700 Kuwaiti oil wells, health officials, meteorologists, and environmental experts convened during mid-August in Cambridge, Massachusetts, to assess the impact of the fires. The soot cloud produced by the fires hasn't produced a nuclear winter, nor are the carbon dioxide and other gases released going to have an appreciable effect on global warming, although regional weather changes are possible. So far adverse health effects from the heavy pall of pollution caused by the fires have been surprisingly mild. This isn't to say that premature deaths will not occur, but many scientists had feared much worse. Nevertheless, all researchers concede that the data for this particular conclusion are still preliminary, and they expressed concerns that health problems may worsen in the coming months. Most of the health effects are expected in a region blanketed by a plume of smoke 800 to 1,000 kilometers long. The average concentrations of the primary pollutants it contains, carbon-based particles and sulfur dioxide, are similar to those in any large urban center. Still, the oil fires increase the pollution burden on Kuwait, which already had a problem with particulates in the air, and some epidemiologists expect that the extra pollutants will take their toll.

Hoffman, M.



Optical extinction of smoke from the Kuwait oil fires  

SciTech Connect

Aircraft-based measurements of optical extinction, optical scattering, and particle mass concentrations were obtained in the smoke from the Kuwait oil fires during May and June 1991. These measurements were used to derive optical absorption, single-scattering albedo ({anti {omega}}), specific absorption and the amount of soot in the smoke. Measurements were made in smoke from individual oil wells, pool fires and in composite smoke plumes. The value of {anti {omega}} for smoke from the individual fires was either 0.35-0.4 (for the black smoke) or 0.85-0.95 (for the white smoke). For the aged composite plume from all of the fires, {anti {omega}} ranged from 0.52 to 0.6. The specific absorption of the composite smoke varied from about 2 m{sup 2} g{sup {minus}1} near the fires to about 1.5 m{sup 2} g{sup {minus}1} well downwind. 8 refs., 2 figs., 1 tab.

Weiss, R.E. [Radiance Research, Inc., Seattle, WA (United States); Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)



8KU Renewables GmbH | Open Energy Information  

Open Energy Info (EERE)

KU Renewables GmbH KU Renewables GmbH Jump to: navigation, search Name 8KU Renewables GmbH Place Berlin, Germany Zip 10117 Sector Renewable Energy Product Berlin-based start-up renewables investment firm. Coordinates 52.516074°, 13.376987° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.516074,"lon":13.376987,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Greater Burgan of Kuwait: world's second largest oil field  

SciTech Connect

Greater Burgan (Main burgan, Magwa, and Ahmadi) field is located in the Arabian Platform geologic province and the stable shelf tectonic environment of the Mesopotamian geosyncline, a sedimentary basin extending from the Arabian shield on the west to the complexly folded and faulted Zagros Mountains on the east. The structural development in Cretaceous time represents a major anticlinorium bounded by a basin to the west and a synclinorium to the east. Greater Burgan is located within this anticlinorium. The field consists of three dome structures 25 km wide and 65 km long with gentle dips of only few degrees. Faults have little throw and did not contribute to the trapping mechanism. The structural deformation may have been caused by halokinetic movements and most likely by basement block faulting that may have started in the Paleozoic. Greater Burgan was discovered in 1938. All production during the last 40 years has been by its natural pressure. Although natural gas injection has been carried out for some time, no waterflooding has been initiated yet. Recoverable reserves of the field are 87 billion bbl of oil. During the last 5 years giant reserves have been added in this field from the deeper strata of Jurassic age. Several deep wells have been drilled to the Permian for the purpose of discovering gas. So far, no Permian gas has been found in Kuwait. The Permian is 25,000 ft deep, and it is unlikely gas will be found there in the future. However, the potential of the Jurassic reservoirs will be a major target in the future. Also, there is a great possibility of discovering oil in stratigraphic traps, as several producing strata in the nearby fields pinch out on the flanks of this giant structure. Enhanced oil recovery should add significant reserves in the future.

Youash, Y.Y.



GIS Day @ KU 2010 Symposium Schedule and Opening Remarks  

E-Print Network (OSTI)

GIS Day @ KU is part of a nationwide event to promote awareness of geographic information systems (GIS), and how we use this evolving tool to analyze our world. We continue our tradition of bringing together a community of GIS users from academia...

GIS Day @ KU Planning Committee; Eric Weber



Change in regime and transfer function models of global solar radiation in Kuwait  

Science Journals Connector (OSTI)

The development of the models for global solar radiation in Kuwait is based on removing the annual periodicity and seasonal variation. The first methodology used here is the change in regime technique that relies on dividing the observations into two ... Keywords: ARMA model, Harmonic analysis, Solar radiation, Transfer function

S. A. Al-Awadhi



NNSA Signs Memorandum with Kuwait to Increase Cooperation on Nuclear Safeguards and Nonproliferation  

ScienceCinema (OSTI)

On June 23, 2010, the National Nuclear Security Administration (NNSA) signed a Memorandum of Cooperation on nuclear safeguards and other nonproliferation topics with the Kuwait National Nuclear Energy Committee (KNNEC). NNSA Administrator Thomas D'Agostino and KNNEC's Secretary General, Dr. Ahmad Bishara, signed the memorandum at a ceremony at U.S. Department of Energy headquarters in Washington.

Thomas D'Agostino



NNSA Signs Memorandum with Kuwait to Increase Cooperation on Nuclear Safeguards and Nonproliferation  

SciTech Connect

On June 23, 2010, the National Nuclear Security Administration (NNSA) signed a Memorandum of Cooperation on nuclear safeguards and other nonproliferation topics with the Kuwait National Nuclear Energy Committee (KNNEC). NNSA Administrator Thomas D'Agostino and KNNEC's Secretary General, Dr. Ahmad Bishara, signed the memorandum at a ceremony at U.S. Department of Energy headquarters in Washington.

Thomas D'Agostino



Kinematics of the helium accretor GP Com  

E-Print Network (OSTI)

We present time-resolved spectra of the double-degenerate binary star, GP Com. The spectra confirm the presence and period (46.5 min) of the `S'-wave feature found by Nather, Robinson and Stover. GP Com is erratically variable at X-ray and UV wavelengths. We have found the equivalent variability in our data, which, as also seen in UV data, is mostly confined to the emission lines. The HeII 4686 changes by the largest amount, consistent with X-ray driven photo-ionisation. The flaring part of the line profiles is broader than the average, as expected if they are dominated by the inner disc. The HeII 4686 profile is especially remarkable in that its blue-shifted peak is 1400 km/s from line centre compared to 700 km/s for the HeI lines (the red-shifted peak is blended with HeI 4713). We deduce that HeII 4686 emission is confined to the inner 1/4 of the disc. We suggest that the activity of the inner disc indicates that accretion is significant (and unstable) there, in contrast to quiescent dwarf novae, in support of models in which GP Com is in a (quasi-)steady-state of low mass transfer rate. GP Com shows triple-peaked lines profiles which consist of the usual double-peaked profiles from a disc plus a narrow component at line centre. We find evidence for both radial velocity and flux variability in this component, inconsistent with a nebula origin. The radial velocity amplitude and its phase relative to the `S'-wave are consistent with an origin on the accreting white dwarf, if the mass ratio, q = M2/M1, is of order 0.02, as expected on evolutionary grounds. However this explanation is still not satisfactory as the systemic velocity of the narrow component shows significant variation from line to line, and we have no explanation for this.

T. R. Marsh



An examination of the perceived need and recommended body of knowledge for architectural internship programs in Kuwait  

E-Print Network (OSTI)

This study stresses and reflects a professional concern for the state of architecture in Kuwait, with a specific emphasis on the development of competence of architectural students and recent graduates on professional knowledge areas...

Abdullah, Mohammad



Sustainable water resources development in Kuwait : an integrated approach with comparative analysis of the case of Singapore  

E-Print Network (OSTI)

This thesis assesses the water resource status of Kuwait and Singapore, both countries considered as water scarce. The institutional aspect of Integrated Water Resource Management (IWRM) efforts in both countries is closely ...

Nazerali, Nasruddin A



Research and Graduate Studies at KU Newsletter, November 2012  

E-Print Network (OSTI)

literature, historical context, and cultural theory. He is the author of 12 books about Shakespeare, the Renaissance, and early modern culture. His most recent work demonstrates how something as seemingly insignificant as a poem could influence... information about the awards, including past recipients and selection criteria, is available online. The nomination deadline for the 2013 awards is Tuesday, January 29, 2013. In this issue 1 Higuchi-KU Endowment Research Achievement Awards...



Research and Graduate Studies at KU Newsletter, February 2012  

E-Print Network (OSTI)

4 National Science Foundation: Non- compliant Letters of Collaboration 4 RGS Posts Three Positions in Research Integrity 4 Hall Center Humanities Lecture Features KUs Jeff Moran 5 Langston Hughes Visiting Professor to Present Lecture... by Hydrogen Peroxide Conserves Feedstock and Minimizes Carbon Footprint Molley McVey, Mechanical Engineering: Biomechanical Analysis of Postural Instability in Parkinson's Disease Please Respond to FDP Faculty Workload Survey of Federally Funded PIs...




E-Print Network (OSTI)

. Universitaria O4510 Mexico City, MEXICO Abstract. The paper describes a hybrid approach for dynamic system), relative humidity (H), solar radiation (R) and wind speed (V) and direction (D) were recorded. The time system modelling and prediction was presented. This MB-GP approach has used small values of GP parameters

Fernandez, Thomas

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Markov Models for GP and Variablelength GAs with Homologous Crossover  

E-Print Network (OSTI)

Markov Models for GP and Variable­length GAs with Homologous Crossover Riccardo Poli School Abstract In this paper we present a Markov model for GP and variable­length GAs with homolo­ gous crossover from the parents. We obtain this result by using the core of Vose's model for GAs in conjunction

Fernandez, Thomas


Mapping the peculiar binary GP Com  

E-Print Network (OSTI)

We present high resolution spectra of the AM CVn helium binary GP Com at two different wavelength ranges. The spectra show the same flaring behaviour observed in previous UV and optical data. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is \\~10 km/s which indicates its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. The Stark effect seems to affect significantly the central spike of some of the lines suggesting that it forms in a high electron density region. This again favours the idea that the central spike originates in the white dwarf. We present Doppler maps obtained for the emission lines which show three clear emission regions.

L. Morales-Rueda; T. R. Marsh; R. C. North



Emission factors for particles, elemental carbon, and trace gases from the Kuwait oil fires  

SciTech Connect

Emission factors are presented for particles, elemental carbon (i.e., soot), total organic carbon in particles and vapor, and for various trace gases from the 1991 Kuwait oil fires. Particle emissions accounted for {approximately} 2% of the fuel burned. In general, soot emission factors were substantially lower than those used in recent {open_quotes}nuclear winter{close_quotes} calculations. Differences in the emissions and appearances of some of the individual fires are discussed. Carbon budget data for the composite plumes from the Kuwait fires are summarized; most of the burned carbon in the plumes was in the form of CO{sub 2}. Fluxes are presented for several combustion products. 26 refs., 1 fig., 5 tabs.

Laursen, K.K.; Ferek, R.J.; Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States); Rasmussen, R.A. [Oregon Graduate Institute of Science and Technology, Beaverton, OR (United States)



Assessment of damage to the desert surfaces of Kuwait due to the Gulf War  

SciTech Connect

This is a preliminary report on a joint research project by Boston University and the Kuwait Institute for Scientific Research that commenced in April 1992. The project aim is to establish the extent and nature of environmental damage to the desert surface and coastal zone of Kuwait due to the Gulf War and its aftermath. Change detection image enhancement techniques were employed to enhance environmental change by comparison of Landsat Thematic Mapper images obtained before the wars and after the cessation of the oil and well fires. Higher resolution SPOT images were also utilized to evaluate the nature of the environmental damage to specific areas. The most prominent changes were due to: (1) the deposition of oil and course-grained soot on the desert surface as a result of oil rain'' from the plume that emanated from the oil well fires; (2) the formation of hundreds of oil lakes, from oil seepage at the damaged oil well heads; (3) the mobilization of sand and dust and (4) the pollution of segments of the coastal zone by the deposition of oil from several oil spills. Interpretation of satellite image data are checked in the field to confirm the observations, and to assess the nature of the damage. Final results will be utilized in establishing the needs for remedial action to counteract the harmful effects of the various types of damage to the environment of Kuwait.

El-Baz, F. (Boston Univ., MA (United States). Center for Remote Sensing); Al-Ajmi, D. (Kuwait Inst. for Scientific Research (Kuwait). Environmental and Earth Sciences Div.)



Measurement of polynuclear aromatic hydrocarbon concentrations in the plume of Kuwait oil well fires  

SciTech Connect

Following their retreat from Kuwait during February and March of 1991, the Iraqi Army set fire to over 500 oil wells dispersed throughout the Kuwait oil fields. During the period of sampling from July to August 1991, it was estimated that between 3.29 {times} 10{sup 6} barrels per day of crude oil were combusted. The resulting fires produced several plumes of black and white smoke that coalesced to form a composite ``super`` plume. Because these fires were uncontrolled, significant quantities of organic materials were dispersed into the atmosphere and drifted throughout the Middle East. The organic particulants associated with the plume of the oil well fires had a potential to be rich in polynuclear aromatic hydrocarbon (PAH) compounds. Based on the extreme mutagenic and carcinogenic activities of PAHs found in laboratory testing, a serious health threat to the population of that region potentially existed. Furthermore, the Kuwait oil fire plumes represented a unique opportunity to study the atmospheric chemistry associated with PAHs in the plume. If samples were collected near the plume source and from the plume many kilometers downwind from the source, comparisons could be made to better understand atmospheric reactions associated with particle-bound and gas-phase PAHs. To help answer health-related concerns and to better understand the fate and transport of PAHs in an atmospheric environment, a sampling and analysis program was developed.

Olsen, K.B.; Wright, C.W.; Veverka, C. [Pacific Northwest Lab., Richland, WA (United States); Ball, J.C. [Ford Motor Co., Dearborn, MI (United States). Scientific Research Lab.; Stevens, R. [US Environmental Protection Agency (United States). Atmospheric Research and Exposure Assessment Lab.



Radiative effects of the smoke clouds from the Kuwait oil fires  

SciTech Connect

The radiative effects of the smoke from the Kuwait oil fires were assessed by measuring downwelling and upwelling solar flux, as well as spectral solar extinction beneath, above, and within the smoke plume. Seven radiation flight missions were undertaken between May 16 and June 2, 1991, to characterize the plume between the source region in Kuwait and approximately 200 km south, near Manama, Bahrain. The authors present results from one flight representative of conditions of the composite plume. On May 18, 1991, in a homogeneous, well-mixed region of smoke approximately 100 km downstream of the fires, visible optical depths as high as 2 were measured, at which time transmission to the surface was 8%, while 78% of the solar radiation was absorbed by the smoke. The calculated instantaneous heating rate inside the plume reached 24 K/d. While these effects are probably typical of those regions in the Persian Gulf area directly covered by the smoke, there is no evidence to suggest significant climatic effects in other regions. 13 refs., 3 figs., 1 tab.

Pilewskie, P.; Valero, F.P.J. [NASA/Ames Research Center, Moffett Field, CA (United States)



Geological model of the Jurassic section in the State of Kuwait  

SciTech Connect

Until the end of the seventies, the knowledge of Jurassic Geology in the State of Kuwait was very limited, since only one deep well was drilled and bottomed in the Triassic sediments. Few scattered wells partially penetrated the Jurassic sequence. During the eighties, appreciable number of wells were drilled through the Jurassic, and added a remarkable volume of information. consequently it was necessary to analyze the new data, in order to try to construct a geological model for the Jurassic in the State of Kuwait. This paper includes a number of isopach maps explaining the Jurassic depositional basin which also helps in trying to explain the Jurassic basin in the Arabian Gulf basin. Structural evolution of the Jurassic sequence indicated an inversion of relief when compared with the Cretaceous sequence. In fact, the main Cretaceous arches were sites of sedimentation troughs during the Jurassic period. This fact marks a revolution in the concepts for the Jurassic oil exploration. One of the very effective methods of the definition of the Jurassic structures is the isopaching of the Gotnia Formation. Najmah, Sargelu and Marrat Formations include the main Jurassic reservoirs which were detected as a result of the exploration activities during the eighties. Selective stratigraphic and structural cross sections have been prepared to demonstrate and explain the nature of the Jurassic sediments.

Yousif, S.; Nouman, G.



The role of the charged residues of the GP2 helical regions in Ebola entry  

Science Journals Connector (OSTI)

The glycoprotein (GP) of Ebola is the sole structural protein that forms ... , the full length of GP gene of Ebola Zaire species, 2028 base pairs in length ... safe approach to dissecting the entry mechanism of Ebola

Haiqing Jiang; Jizhen Wang; Balaji Manicassamy



Chain-aggregate aerosols in smoke from the Kuwait oil fires  

SciTech Connect

Electrooptical scattering was used to detect aggregated particle chains in the smoke from the Kuwait oil fires. Nonsphericity was detected by the change in light scattering brought about by induced alignment of particles when subjected to a pulsed, bipolar electric field. Measured parameters included the steady state enhancement of light scattering for complete orientation of the particles, and the rotational diffusion constant, calculated from the time required for the particles to relax to a random orientation after the electric field was removed. Chain aggregates of soot formed within seconds of combustion for those fires producing black smoke. These aggregates agglomerated to some extent in the smoke near the fires, but then remained relatively unchanged for several hours of travel downwind. Very little nonsphericity was detected for particles in the plume of white smoke, which consisted primarily of salt brine products emitted along with the oil. 10 refs., 4 figs., 1 tab.

Weiss, R.E. [Radiance Research, Inc., Seattle, WA (United States); Kapustin, V.N. [Institute of Atmospheric Physics, Moscow (Russian Federation); Hobbs, P.V. [Univ. of Washington, Seattle, WA (United States)



An approach to predict tarmat breakdown in Minagish Reservoir in Kuwait  

SciTech Connect

Minagish Oolite reservoir, Minagish Field in Kuwait is characterized by tarmat presence at the oil-water contact. A water flooding project is planned for the reservoir. This paper discusses the possibility of tarmat break-down upon water injection below it. It was found that differential pressure at tarmat would be mainly due to water injection and that differential pressure due to oil production would be negligible. This paper suggests a technique to predict tarmat break-down time, response time at the nearest producer or observation well and the time at which water injection should be switched from below tarmat to above it. Also, the technique could be used to predict the differential pressure at tarmat anywhere in the reservoir.

Osman, M.E.



Multicriteria decision making in electricity demand management: the case of Kuwait  

Science Journals Connector (OSTI)

Electricity demand in Kuwait has substantially increased over the years and this increase is attributed to population growth, increase in the number of buildings, and the extensive use of air-conditioning system during the very hot weather in the summer. The amount of electrical energy generated reached 48 444 308 megawatt hour (MWH) in 2007. Such growth calls for extensive investment in the continuous expansion of the existing power plants and constructing new ones. To rationalise the consumption of electricity, several conservation policies have to be implemented. In this work, we have attempted to diagnose such problem and solicit expert opinions in order to provide the proper remedies. Because the problem comprises several criteria that are subjective in nature, multicriteria decision-making approaches were suggested. The Analytical Hierarchy Process (AHP) was used as a decision tool to assess the different policies that could be used to bring about electricity conservation.

Mohammed Hajeeh



Corrosion Protection byCorrosion Protection by ShewanellaShewanella oneidensisoneidensis MRMR--11 EsraEsra KuKu11, Ken Nealson, Ken Nealson22 andand FlorianFlorian MansfeldMansfeld11  

E-Print Network (OSTI)

Corrosion Protection byCorrosion Protection by ShewanellaShewanella oneidensisoneidensis MRMR--11 EsraEsra KuKu11, Ken Nealson, Ken Nealson22 andand FlorianFlorian MansfeldMansfeld11 1.1. Corrosion and Environmental Effects Laboratory (CEEL)Corrosion and Environmental Effects Laboratory (CEEL) TheThe Mork

Southern California, University of


Event:LEDS GP Event at Bonn | Open Energy Information  

Open Energy Info (EERE)

Bonn Bonn Jump to: navigation, search Calendar.png LEDS GP Event at Bonn: 17:00 - 19:15pm on 2012/05/23 This event will be co-hosted by the International Partnership on Mitigation and MRV (http://www.mitigationpartnership.net/) and the LEDS Global Partnership (http://openei.org/wiki/LEDSGP). The event titled Catalyzing Cooperative Action for Low Emissions Development will take place on May 23, 2012 from 17:00-19:15 at the BMU Headquarters in Bonn and will be followed by a reception from 19:15-20:30. The purpose of the event is to share information and learning related to current activities, to discuss and receive feedback on these activities, and to explore opportunities for linking with related initiatives. Event Details Name LEDS GP Event at Bonn Date 2012/05/23


Contribution of power and desalination plants to the levels of volatile liquid hydrocarbons in the nearby coastal areas of Kuwait  

SciTech Connect

The levels and distribution of volatile liquid hydrocarbons (VLHs) were determined in Kuwait`s coastal areas in the vicinity of outlets of power and desalination plants. About 230 samples were collected from the selected sampling locations over the 4 seasons. The VLHs in the samples were analyzed using Grob`s closed-loop stripping technique and GC with FID and confirmed by GC/MS. The results showed that significant levels of VLHs were present. The levels ranged from 307 to 6,500 ng/L and from 2,880 to 7,811 ng/L in Kuwait Bay and Sulaibekhat Bay, respectively. The annual average for VLHs near Al-Zor power plant ranged from 465 to 4,665 ng/L. Benzenoids formed the bulk (about 80%) of the VLHs present. Comparison with the levels in the outlets indicated that Doha West power plant contributed much higher levels of VLHs to the coastal areas than Al-Zor plant.

Saeed, T.; Khordagui, H.; Al-Hashash, H. [Kuwait Inst. for Scientific Research, Safat (Kuwait). Environmental Sciences Dept.] [Kuwait Inst. for Scientific Research, Safat (Kuwait). Environmental Sciences Dept.



AIDS awareness exhibit to open at KU Libraries on September 10  

E-Print Network (OSTI)

will unveil a new interdisciplinary exhibit, "Reach Out: Scholarly and Visual Communication to Promote AIDS Awareness," in its multimedia Library Gallery space with an opening on September 10, 2009. The opening will be held from 5-7 p.m. in the third floor... gallery area of Watson Library. The event is free and open to the public; please RSVP to Courtney Foat, cfoat@ku.edu or 785-864-0970. The exhibit will feature scholarly work by faculty and students from departments across KU, including Journalism and Mass...



Composition analyses of size-resolved aerosol samples taken from aircraft downwind of Kuwait, Spring 1991  

SciTech Connect

Analyses are reported for eight aerosol samples taken from the National Center for Atmospheric Research Electra typically 200 to 250 km downwind of Kuwait between May 19 and June 1, 1991. Aerosols were separated into fine (D{sub p} < 2.5 {mu}m) and coarse (2.5 < D{sub p} 10 {mu}m) particles for optical, gravimetric, X ray and nuclear analyses, yielding information on the morphology, mass, and composition of aerosols downwind of Kuwait. The mass of coarse aerosols ranged between 60 and 1971 {mu}g/m{sup 3} and, while dominated by soil derived aerosols, contained considerable content of sulfates and salt (NaCl) and soot in the form of fluffy agglomerates. The mass of fine aerosols varied between 70 and 785 {mu}g/m{sup 3}, of which about 70% was accounted for via compositional analyses performed in vacuum. While most components varied greatly from flight to flight, organic matter and fine soils each accounted for about 1/4 of the fine mass, while salt and sulfates contributed about 10% and 7%, respectively. The Cl/S ratios were remarkably constant, 2.4 {+-} 1.2 for coarse particles and 2.0 {+-} 0.2 for fine particles, with one flight deleted in each case. Vanadium, when observed, ranged from 9 to 27 ng/m{sup 3}, while nickel ranged from 5 to 25 ng/m{sup 3}. In fact, fine sulfates, vanadium, and nickel occurred in levels typical of Los Angeles, California, during summer 1986. The V/Ni ratio, 1.7 {+-} 0.4, was very similar to the ratios measured in fine particles from combusted Kuwaiti oil, 1.4 {+-} 0.9. Bromine, copper, zinc, and arsenic/lead were also observed at levels between 2 and 190 ng/m{sup 3}. The presence of massive amounts of fine, typically alkaline soils in the Kuwaiti smoke plumes significantly modified their behavior and probably mitigated their impacts, locally and globally. 16 refs., 1 fig., 3 tabs.

Cahill, T.A.; Wilkinson, K. [Univ. of California, Davis, CA (United States); Schnell, R. [National Center for Atmospheric Research, Boulder, CO (United States)



Dynamical and radiative response to the massive injection of aerosol from Kuwait oil burning fires  

SciTech Connect

The effects of the injection of large amount of soot comparable to that produced in the burning of oil wells in Kuwait were studied using a 2-D mesoscale model. During the three day numerical simulation the ground-atmosphere system appears to be strongly perturbed. A surface cooling is produced in the first two days above and downwind of the sources. The cooling, between -10 C over the desert and -0.5 C over the sea is dependent on the surface characteristics. The temperature decrease at the ground results in a stratified troposphere which inhibits convection and perturbs the normal diurnal variability of the boundary layer while the upper levels are driven by the radiative warming of the aerosol layer. In this region after few hours the simulation produces a warming of 0.8 C reaching a maximum of 6 C is after 60 hours. During the last 2 days of simulation the long wave radiation emitted by the low altitude atmospheric layers contribute to mitigate the surface cooling. A detailed discussion of the radiative and the dynamical interactions is given and it is shown that beside the specific interest in the short term effects these results may be useful to parameterize the smoke source for a General Circulation Model (GCM) simulation.

Ferretti, R.; Visconti, G. [Univ. L`Aquila (Italy)



Daily dispersion model calculations of the Kuwait oil fire smoke plume  

SciTech Connect

The Atmospheric Release Advisory Capability (ARAC) provided daily forecasts of the position and spatial character of the Kuwait oil fire smoke plume to the NSF-coordinated research aircraft missions in the Persian Gulf. ARAC also provided daily plume dispersion products to various nations in the Persian Gulf region under the auspices of the World Meteorological Organization for a period of nearly 5 months. Forecasted three dimensional winds were provided to ARAC from the US Air Force Global Weather Central`s Relocatable Wind Model (RWM). The RWM winds were spaced approximately 90 km in the horizontal and were located at the surface, 1000 ft., 2000 ft, 5000 ft and every 5000 ft up to 30,000 ft elevation. The forecast periods were 0, 6, 24, and 36 hours from both 0000 and 1200 UTC. A wind field model (MATHEW) corrected for terrain influences on the wind. The smoke plume was dispersed using a three dimensional particle-in-cell code (ADPIC) with buoyant plume rise capability. Multiple source locations were used to represent the burning oil fields. Improved estimates of the source term and emission factors for the smoke were incorporated into the ADPIC calculations as the field measurement data were made available.

Ellis, J.S.; Foster, C.S.; Foster, K.T.; Sullivan, T.J. [Lawrence Livermore National Lab., CA (United States); Baskett, R.L.; Nasstrom, J.S.; Schalk, W.W. III [EG and G Energy Measurements, Inc., Pleasanton, CA (United States); Greenly, G.D. [IT Corp., Irvine, CA (United States)



Daily dispersion model calculations of the Kuwait oil fire smoke plume  

SciTech Connect

The Atmospheric Release Advisory Capability (ARAC) provided daily forecasts of the position and spatial character of the Kuwait oil fire smoke plume to the NSF-coordinated research aircraft missions in the Persian Gulf. ARAC also provided daily plume dispersion products to various nations in the Persian Gulf region under the auspices of the World Meteorological Organization for a period of nearly 5 months. Forecasted three dimensional winds were provided to ARAC from the US Air Force Global Weather Central's Relocatable Wind Model (RWM). The RWM winds were spaced approximately 90 km in the horizontal and were located at the surface, 1000 ft., 2000 ft, 5000 ft and every 5000 ft up to 30,000 ft elevation. The forecast periods were 0, 6, 24, and 36 hours from both 0000 and 1200 UTC. A wind field model (MATHEW) corrected for terrain influences on the wind. The smoke plume was dispersed using a three dimensional particle-in-cell code (ADPIC) with buoyant plume rise capability. Multiple source locations were used to represent the burning oil fields. Improved estimates of the source term and emission factors for the smoke were incorporated into the ADPIC calculations as the field measurement data were made available.

Ellis, J.S.; Foster, C.S.; Foster, K.T.; Sullivan, T.J. (Lawrence Livermore National Lab., CA (United States)); Baskett, R.L.; Nasstrom, J.S.; Schalk, W.W. III (EG and G Energy Measurements, Inc., Pleasanton, CA (United States)); Greenly, G.D. (IT Corp., Irvine, CA (United States))



www.ku.edu/safety The Clery Act Annual Security Report  

E-Print Network (OSTI)

attain maximum effectiveness unless everyone contributes to making it work. Safety and security are bothwww.ku.edu/safety The Clery Act Annual Security Report The Annual Fire Report Calendar Year 2012 of drug and liquor laws In this report you will find information about: Reporting Crime Safety

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network 3.0 - assign p-gp inhibitor Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Branch, National Institute of Mental Health Collection: Biology and Medicine 27 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...


Assessment of the histopathological lesions and chemical analysis of feral cats to the smoke from the Kuwait oil fires  

SciTech Connect

Twenty-six adult or subadult feral cats were collected from Kuwait approximately 8 months after the ignition of the Kuwait oil wells. These animals were obtained from two sources: 12 animals from Kuwait City, a relatively smoke-free area, and 14 from the city of Ahmadi, an area with heavy smoke. Animals were euthanized and a complete set of tissues consisting of all major organs was taken for histopathology. Samples of lung, liver, kidney, urine, and blood were also taken for toxicology. Histopathological lesions observed in the lung were mild accumulations of anthracotic pigment in the lungs of 17 cats. Hyperplasia of the bronchial and bronchiolar gland in 8 cats, and smooth muscle hyperplasia of bronchioles in 14 cats. Tracheal gland hyperplasia was observed in 7 cats, and minimal squamous metaplasia of the tracheal mucosa in 17 cats, Laryngeal lesions consisted of submucosal gland hyperplasia in 2 cats and squamous metaplasia of the mucosa in 5 cats. Hyperplasia of the nasal submucosal glands was observed in 6 animals. The pharyngeal mucosa as well as other organs and organ systems were normal in all cats. Atomic absorption analysis for 11 metals was performed; vanadium and nickel levels (two metals that were present in the smoke from the oil fires) are not indicative of substantial exposure to the oil fires. Based on the histopathological findings and toxicological analysis, it is felt that inhalation of air contaminated with smoke from the oil fires had little or no long-term effect on the animals examined. 36 refs., 3 figs., 7 tabs.

Moeller, R.B. Jr.; Dick, E.J.; Pletcher, J.M. [Armed Forces Institute of Pathology, Washington, DC (United States)] [and others



Assessment of the histopathological lesions and chemical analysis of feral cats to the smoke from Kuwait oil fires  

SciTech Connect

Twenty-six adult or subadult feral cats were collected from Kuwait approximately 8 months after the ignition of the Kuwait oil wells. These animals were obtained from two sources: 12 animals from Kuwait City, a relatively Co smoke-free area, and 14 from the city of Alimadi, an area with heavy smoke. Animals were euthanized and a complete set of tissues consisting of all 0 major organs was taken for histopathology. Samples of lung, liver, kidney, urine, and blood were also taken for toxicology. Histopathological lesions observed in the lung were mild accumulations of anthracotic pigment in the lungs of 17 cats. Hyperplasia of the bronchial and bronchiolar gland in 8 cats, and smooth muscle hyperplasia of bronchioles in 14 cats. Iracheal gland hyperplasia was observed in 7 cats, and minimal squamous metaplasia of the tracheal mucosa in 17 cats, Laryngeal lesions consisted of submucosal gland hyperplasia in 2 cats and squamous metaplasia of the mucosa in 5 cats. Hyperplasia of the nasal submucosal glands was observed in 6 animals. The pharyngeal mucosa as well as other organs and organ systems (a) were normal in all cats. Atomic absorption analysis for 11 metals was performed; vanadium and nickel levels (two metals that were present in the smoke from the oil fires) are not indicative of substantial exposure to the oil fires. Based on the histopathological findings and toxicological analysis, it is felt that inhalation of air contaminated with smoke from the oil fires had little or no long-term effect on the animals examined.

Moeller, R.B.; Kalasinsky, V.F.; Razzaque, M.; Centeno, J.A.; Dick, E.J.



Markov Chain Models for GP and Variable-length GAs with Homologous Crossover  

E-Print Network (OSTI)

Markov Chain Models for GP and Variable-length GAs with Homologous Crossover Riccardo Poli School mcphee@mrs.umn.edu Abstract In this paper we present a Markov chain model for GP and variable-length GAs of the genetic material taken from the parents. We obtain this result by using the core of Vose's model for GAs

Poli, Riccardo


An evaluation of acid frac/matrix stimulation of a tight limestone formation in exploratory wells in Kuwait  

SciTech Connect

With the advent of Kuwait's intensive exploratory activities to locate and test deeper geologic structures, tighter and very low porosity limestone formations were progressively encountered. Most of these hydrocarbon bearing formations initially appeared to be very stubborn and hardly indicated any fluid influx into the well-bore. In certain cases the hydrostatic head was nearly completely removed by unloading the well practically down to perforations, thereby creating optimum draw-down but it either resulted in poor inflow or none at all. In the absence of currently available chemicals, equipment, job design engineering and better understanding of tight carbonate formations and their responses to various acid formulations, some of these could have slipped into unattractive categories. With the implementation of specially designed matrix and acid-frac treatments, these formation have, however, been unmasked and turned out to be highly potential finds now. This paper basically outlines the salient features of theoretical and operational aspects of stimulating and testing some of the very low porosity hard limestone formations in Kuwait recently.

Singh, J.R.



Event:LEDS GP Event at Rio+20 | Open Energy Information  

Open Energy Info (EERE)

Rio+20 Rio+20 Jump to: navigation, search Calendar.png LEDS GP Event at Rio+20: 15:30 - 17:00 on 2012/06/19 The purpose of the event is to share information on current LEDS GP activities and explore opportunities for collaboration with other related activities. We are looking forward to an exciting discussion on how we can work together to foster low emissions development around the world. The "LEDS Global Partnership - Enhancing Global Collaboration on Low Emissions Development" will be held on June 19th, 2012 from 15:30-17:00 at the U.S. Center, located at the Athletes Park in Barra da Tijuca, across from Rio Centro. Event Details Name LEDS GP Event at Rio+20 Date 2012/06/19 Time 15:30 - 17:00 Location Brazil Organizer LEDS GP Tags LEDS, CLEAN, Training


Effect of Ebola virus proteins GP, NP and VP35 on VP40 VLP morphology  

Science Journals Connector (OSTI)

Recently we described a role for Ebola virus proteins, NP, GP, and VP35 in enhancement of VP40 VLP budding. To explore the possibility that VLP structure was altered by co-expression of EBOV proteins leading t...

Reed F Johnson; Peter Bell; Ronald N Harty



Increased frequencies of sister chromatid exchanges (SCE) in peripheral blood lymphocytes of U.S. troops deployed in Kuwait  

SciTech Connect

Concern over potential exposure of U.S. troops to genotoxic emissions generated in oil well fires prompted a Biologic Surveillance Initiative to examine levels of genetic damage in a cohort of troops deployed in Kuwait. Blood was drawn from members of the 11th Armored Cavalry Regiment on June 6, 1991 while they were stationed in Germany (PRE, n=61), on August 11, 1991 after being deployed in Kuwait (DURING, n=51) and again on October 10, 1991 after returning to Germany (POST, n=36). Cells were cultured for 68-72 hours in RPMI 1640 medium supplemented with 15% fetal bovine serum, 1% phytohemagglutinin and 10 {mu}g/ml 5-bromo-2`-deoxyuridine. Metaphase cells were prepared by standard techniques and stained with Hoechst 33258 plus Giemsa to visualize SCE. Whenever possible, a total of 25 well-spread and well-stained cells were evaluated for each individual. Only 26 soldiers had values available for all three sampling points. Data on 50 soldiers was available for PRE and DURING sampling while data on 35 samples was available for a PRE vs POST comparison. The average frequency of SCE/cell increased from 4.33 {plus_minus} 0.53 in the PRE samples to 5.12 {plus_minus} 0.64 in the DURING samples to 5.28 {plus_minus} 0.72 in the POST samples. The PRE values were significantly different from both the DURING and POST values (p<0.001) using the paired t-test. While these results suggest that this cohort was potentially exposed to genotoxic materials, the source of the exposure(s) is presently not known.

McDiarmid, M.A. Kolodner, K. [John Hopkins Univ., Baltimore, MD (United States); Scott, B.G. [Army Environmental Hygiene Agency, Aberdeen, MD (United States)] [and others



Chemical compatibility study of Cooley L18KU, Herculite, and Elephant Mat with Hanford tank waste  

SciTech Connect

An independent chemical compatibility review of various wrapping and absorbent/padding materials was conducted to evaluate resistance to chemicals and constituents present in liquid waste from the Hanford underground tanks. These materials will be used to wrap long-length contaminated equipment when such equipment is removed from the tanks and prepared for transportation and subsequent disposal or storage. The materials studied were Cooley L18KU, Herculite, and Elephant Mat. The study concludes that these materials are appropriate for use in this application.

Mercado, J.E.



LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop | Open  

Open Energy Info (EERE)

GP Second Annual Event: Learning and Leading on LEDS Workshop GP Second Annual Event: Learning and Leading on LEDS Workshop Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us Calendar.png LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop: on 2013/02/27 (February 27 - March 1, 2013) The LEDS Global Partnership is convening its second annual global workshop to bring together leading practitioners from countries and international institutions to share lessons and strengthen cooperation on low emission development around the world. The workshop will convene peer learning and collaboration sessions on common topics of interest defined by the African Climate & Development Society, Asia LEDS



E-Print Network (OSTI)

CLIMATE CHANGE IMPACTS ON HYDROELECTRIC POWER G.P. Harrison(1), H.W. Whittington(1) and S.W. Gundry implications for the design, operation and viability of hydroelectric power stations. This describes attempts to predict and quantify these impacts. It details a methodology for computer based modelling of hydroelectric

Harrison, Gareth


On the description of the bearing capacity of electro-discharge machined G.P Petropoulosa  

E-Print Network (OSTI)

electro-discharge machining (EDM) is the most widely and successfully applied for the machining of variousOn the description of the bearing capacity of electro-discharge machined surfaces G.P Petropoulosa with the investigation of a set of "non-common" surface topography parameters of EDMed surfaces that describe

Aristomenis, Antoniadis


Evolving Recurrent Linear-GP for Document Classification and Word Tracking  

E-Print Network (OSTI)

Evolving Recurrent Linear-GP for Document Classification and Word Tracking Xiao Luo, A. Nur Zincir word sequences. During this process, word sequences of documents are tracked, frequent patterns of temporal sequences within a document. This in return automates the process of word tracking, frequent word

Zincir-Heywood, Nur


RoMEO Green at the University of Kansas: An experiment to encourage interest and participation among faculty and jumpstart populating the KU ScholarWorks Repository  

E-Print Network (OSTI)

Universities around the world are beginning to develop digital repositories in order to offer new methods for the distribution and preservation of the intellectual output of their faculty. The University of Kansas (KU) is among these universities...

Mercer, Holly; Emmett, Ada



Publications from Research Conducted at GP-SANS | ORNL Neutron Sciences  

NLE Websites -- All DOE Office Websites (Extended Search)

Publications from Research Conducted at GP-SANS Publications from Research Conducted at GP-SANS 2013 Publications Anovitz L. M., Cole D. R., Rother G., Allard L. F., Jackson A. J., Littrell K. C., "Diagenetic changes in macro- to nano-scale porosity in the St. Peter sandstone: an (ultra) small angle neutron scattering and backscattered electron imaging analysis", Geochimica et Cosmochimica Acta 102, 280-305 (2013). Black S. B., Chang Y., Bae C., Hickner M. A., "FTIR characterization of water-polymer interactions in superacid polymers", Journal of Physical Chemistry B 117, 16266-16274 (2013). Boukhalfa S., He L., Melnichenko Y. B., Yushin G., "Small-angle neutron scattering for in situ probing of ion adsorption inside micropores", Angewandte Chemie International Edition 52, 4618-4622 (2013).


A GP-Based Hyper-Heuristic Framework for Evolving 3-SAT Heuristics  

E-Print Network (OSTI)

.502 - - 0.560 start FLIP v v RANDOM l | IFV pro, v, v MAX SCR l [, op] | MIN SCR l [, op] MAX AGE l [, op] l ALL | IFL pro, l, l ALL USC | RAND USC | SCR Z l [, op] op TIE RAND | TIE AGE | TIE SCR pro 0 for SAT using GP-HH. MAC SCR l selects a variable from list l that by flipping will maximize the number

Fernandez, Thomas


Envelope Deglycosylation Enhances Antigenicity of HIV-1 gp41 Epitopes for Both Broad Neutralizing Antibodies and Their Unmutated Ancestor Antibodies  

E-Print Network (OSTI)

The HIV-1 gp41 envelope (Env) membrane proximal external region (MPER) is an important vaccine target that in rare subjects can elicit neutralizing antibodies. One mechanism proposed for rarity of MPER neutralizing antibody generation is lack...

Ma, Ben-Jiang; Alam, S. Munir; Go, Eden P.; Lu, Xiaozhi; Desaire, Heather; Tomaras, Georgia D.; Bowman, Cindy; Sutherland, Laura L.; Scearce, Richard M.; Santra, Sampa; Letivn, Norman L.; Kepler, Thomas B.; Liao, Hua-Xin; Haynes, Barton F.



Murder at Mer Rounge: a dialogue on the activities of the Ku Klux Klan in northwestern Louisiana, 1921-1924  

E-Print Network (OSTI)

supported me during the whole project, giving me ideas, and offering a shoulder to cry on. Thank you to Joanna Patton, who was a great source of advice on how to structure my paper and arguments, and who was always willing to tell me if an idea made... D. W. Griffith's Birth of a Nation in 1915. The Ku Klux Klan in Northern Louisiana began organizing in the late teens and early twenties. In late 1991, George Mallory Patton was rummaging through some old records of the KKK in Morehouse Parish...

Peterson, Hannah Bethann



Kuwait and Iraq  

Science Journals Connector (OSTI)

A short sector (58 km) of the northern coast of the Persian Gulf lies within Iraq. The area is dominated by the large...

Eric Bird



Welcome to Architecture at KU! Thank you for your interest in the professional degree paths for undergraduate Architecture students in the  

E-Print Network (OSTI)

Welcome to Architecture at KU! Thank you for your interest in the professional degree paths for undergraduate Architecture students in the School of Architecture, Design and Planning at the University in architecture and culminate with professional degrees in architecture or the allied fields of urban planning

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Involvement of viral envelope GP2 in Ebola virus entry into cells expressing the macrophage galactose-type C-type lectin  

SciTech Connect

Highlights: {yields} Ebola virus infection is mediated by binding to and fusion with the target cells. {yields} Structural feature of the viral glycoprotein determines the infectivity. {yields} Surface C-type lectin, MGL, of macrophages and dendritic cells mediate the infection. {yields} GP2, one of glycoprotein subunits, plays an essential role in MGL-mediated infection. {yields} There is a critical amino acid residue involved in high infectivity. -- Abstract: Ebola virus (EBOV) infection is initiated by the interaction of the viral surface envelope glycoprotein (GP) with the binding sites on target cells. Differences in the mortality among different species of the Ebola viruses, i.e., Zaire ebolavirus (ZEBOV) and Reston ebolavirus (REBOV), correspond to the in vitro infectivity of the pseudo-typed virus constructed with the GPs in cells expressing macrophage galactose-type calcium-type lectin (MGL/CD301). Through mutagenesis of GP2, the transmembrane-anchored subunit of GP, we found that residues 502-527 of the GP2 sequence determined the different infectivity between VSV-ZEBOV GP and -REBOV GP in MGL/CD301-expressing cells and a histidine residue at position 516 of ZEBOV GP2 appeared essential in the differential infectivity. These findings may provide a clue to clarify a molecular basis of different pathogenicity among EBOV species.

Usami, Katsuaki [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Matsuno, Keita; Igarashi, Manabu [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Denda-Nagai, Kaori [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Takada, Ayato [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Irimura, Tatsuro, E-mail: irimura@mol.f.u-tokyo.ac.jp [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)



The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII-hMDR1 Cells  

E-Print Network (OSTI)

The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII ABSTRACT The human multi-drug resistance membrane transporter, P-glycoprotein, or P-gp, has been of which can prove molecular mechanisms. Determination of the elementary kinetic rate constants

Mittal, Aditya


Exposure to particle-bound polyaromatic hydrocarbons in the Al-Mansoria residential area during the Kuwait oil fires. A qualitative appraisal of the adsorption role  

SciTech Connect

High ambient levels of inhalable particulate matter (PM[sub 10]) were detected in residential areas during the oil well burning in Kuwait (February-November 1991). Because inhalation exposures to PM[sub 10] were significant (data on PAH quantification are scarce), it became possible to describe the exposure to PM[sub 10]-associated PAHs of alternative courses of events, such as PAH-particle interaction mechanisms. Depending on particle adsorption characteristics (affinity and site availability), it is concluded that, contrary to what is currently believed, low levels of ambient PM[sub 10] levels did not indicate low PAH exposures in Al-Mansoria residential area during May 10-31, 1991. Due to the frequent presence of dust particles in the ambient air caused by the heavy dust fallout in Al-Mansoria (average > 65 tons/km[sup 2]) during May, 1991, the predicted patterns can be explained by two hypothesized mechanisms. The first is a two-step process: loss of PAHs from low affinity sites and reabsorption onto stronger affinity ones leading to low surface coverage at high PM[sub 10] concentrations. The second involves dilution of PAH-containing soot with aeolian particles. Both events can lead to low ambient PAHs at high PM[sub 10] levels or high ambient PAHs at low PM[sub 10] levels. 27 refs., 12 refs., 2 tabs.

Al-Yakoob, S.N.; Abdal, Y. (Kuwait Inst. for Scientific Research (Kuwait)); Nasrallah, H. (College of Health Sciences, Kuwait (Kuwait)); Al-Majed, N. (Ministry of Public Health, Kuwait (Kuwait))



NIOSH testimony on Kuwait before the subcommittee on hospitals and health care, committee on veterans' affairs by J. S. Andrews, September 16, 1992  

SciTech Connect

The testimony summarizes potential adverse health effects related to service in the Persian Gulf as presented by the Department of Health and Human Services. An estimated 9,000 workers from 43 different countries battled the burning oil wells in Kuwait from February 1991 through early November 1991 when the last was capped. Exposures and health effects in US military personnel, Kuwaiti citizens, and fire fighters were described. The hazards to the soldiers were largely dependent on the concentration of the pollutants in the air near the camps. Fortunately, the plume from the fires rose up to 10,000 and 12,000 feet, mixed with the air and then dispersed for several thousand miles downwind over a period of several weeks. The particles and gases contained in the plume were diluted as the plume travelled. Even so, some minor respiratory problems were present among the soldiers. Some of the hydrocarbons measured at low concentrations have been shown to produce cancer in laboratory animals only when present at higher levels of exposure. Based on the exposure information gathered, the author concludes that there will not likely be a detectable increase in lung cancer in Gulf War Veterans as a result of the oil well fires.

Not Available



Labor, nationalism, and imperialism in eastern Arabia: Britain, the Shaikhs, and the Gulf oil workers in Bahrain, Kuwait and Qatar, 1932-1956  

SciTech Connect

This study examines the lack of a noticeable indigenous labor movement in the contemporary Gulf Arab countries of Bahrain, Kuwait and Qatar; it focuses on the emergence, after the discovery of oil, of an industrial Gulf labor force, and on the evolution of the British policy towards oil and Gulf oil workers. The period examined begins with the discovery of oil in Bahrain in 1932 (the first such discovery on the Arab side of the Gulf), and ends with the Suez Crisis of 1956. The latter is a watershed event in Gulf history. It is argued that the Suez Crisis was in large part responsible for the long-term defeat of the indigenous labor movement in the Gulf. Attention is given to the parts played by the British Government of India, the Foreign Office, the local Shaikhs, the Gulf nationalists, and by the workers themselves. Policies towards workers passed through two different periods. In the first, 1932-1945, the Government of India had no direct interest in the Gulf labor situation; in the second, 1946-1956, the Foreign Office took increased interest in the welfare of local oil workers, primarily because of the importance of oil to reconstruction of the British economy after the war. However, the Suez Crisis in 1956 convinced the British to withdraw their support for the workers.

Saleh, H.M.A.



Unliganded HIV-1 gp120 core structures assume the CD4-bound conformation with regulation by quaternary interactions and variable loops  

SciTech Connect

The HIV-1 envelope (Env) spike (gp120{sub 3}/gp41{sub 3}) undergoes considerable structural rearrangements to mediate virus entry into cells and to evade the host immune response. Engagement of CD4, the primary human receptor, fixes a particular conformation and primes Env for entry. The CD4-bound state, however, is prone to spontaneous inactivation and susceptible to antibody neutralization. How does unliganded HIV-1 maintain CD4-binding capacity and regulate transitions to the CD4-bound state? To define this mechanistically, we determined crystal structures of unliganded core gp120 from HIV-1 clades B, C, and E. Notably, all of these unliganded HIV-1 structures resembled the CD4-bound state. Conformational fixation with ligand selection and thermodynamic analysis of full-length and core gp120 interactions revealed that the tendency of HIV-1 gp120 to adopt the CD4-bound conformation was restrained by the V1/V2- and V3-variable loops. In parallel, we determined the structure of core gp120 in complex with the small molecule, NBD-556, which specifically recognizes the CD4-bound conformation of gp120. Neutralization by NBD-556 indicated that Env spikes on primary isolates rarely assume the CD4-bound conformation spontaneously, although they could do so when quaternary restraints were loosened. Together, the results suggest that the CD4-bound conformation represents a 'ground state' for the gp120 core, with variable loop and quaternary interactions restraining unliganded gp120 from 'snapping' into this conformation. A mechanism of control involving deformations in unliganded structure from a functionally critical state (e.g., the CD4-bound state) provides advantages in terms of HIV-1 Env structural diversity and resistance to antibodies and inhibitors, while maintaining elements essential for entry.

Kwon, Young Do; Finzi, Andrs; Wu, Xueling; Dogo-Isonagie, Cajetan; Lee, Lawrence K.; Moore, Lucas R.; Schmidt, Stephen D.; Stuckey, Jonathan; Yang, Yongping; Zhou, Tongqing; Zhu, Jiang; Vicic, David A.; Debnath, Asim K.; Shapiro, Lawrence; Bewley, Carole A.; Mascola, John R.; Sodroski, Joseph G.; Kwong, Peter D. (Harvard-Med); (NIH); (Hawaii); (L.F. Kimball); (Columbia); (VCCRI); (Arkansas); (DFCI)



Major Vault Protein May Affect Nonhomologous End-Joining Repair and Apoptosis Through Ku70/80 and BAX Downregulation in Cervical Carcinoma Tumors  

SciTech Connect

Purpose: We investigated the relationship between major vault protein (MVP) expression, the nonhomologous end-joining (NHEJ) repair gene Ku70/80, and related genes involved in the regulation of apoptosis and proliferation to shed light on the possible causes of genetic instability, tumor progression, and resistance to oncologic treatment in patients with clinical cervical cancer. Methods and Materials: One hundred sixteen consecutive patients with localized cervix carcinoma were prospectively included in this study from July 1997 to Dec 2003. Patients were staged according to the tumor, node, metastasis (TNM) classification. Forty patients had Stage I disease, 45 had Stage II, and 31 had Stage III/IVA. Most patients had squamous tumors (98 cases) and Grades II (52 cases) and III (45 cases) carcinomas. Expression of MVP, Ku70/80, Insulin-Like Growth Factor-1 receptor (IGF-1R), BCL2-associated X protein (BAX), B-cell CLL/lymphoma 2 (BCL-2), p53, and Ki67 was studied by using immunohistochemistry in paraffin-embedded tumor tissue. Results: Tumors overexpressing MVP (65 of 116 cases) showed low levels of Ku70/80 (p = 0.013) and BAX expression (p < 0.0001). Furthermore, low Ku70/80 expression was strongly related to suppressed BAX (p < 0.001) and, to a lesser extent, upregulated BCL-2 (p = 0.042), altered p53 (p = 0.038), and increased proliferation (p = 0.002). Conclusion: We hypothesize that an early regulatory mechanism favors homologous or NHEJ repair at first, mediated by vaults along with other factors yet to be elucidated. If vaults are overexpressed, NHEJ repair may be suppressed by means of several mechanisms, with resultant genomic instability. These mechanisms may be associated with the decision of damaged cells to survive and proliferate, favoring tumor progression and reducing tumor response to oncologic treatment through the development of resistant cell phenotypes. Additional clinical studies are necessary to test this hypothesis.

Lloret, Marta [Radiation Oncology Department, Hospital Universitario Dr. Negrin, Las Palmas de Gran Canaria (Spain); Instituto Canario de Investigacion del Cancer, Canary Islands (Spain)], E-mail: mllosae@hotmail.com; Lara, Pedro Carlos; Bordon, Elisa [Radiation Oncology Department, Hospital Universitario Dr. Negrin, Las Palmas de Gran Canaria (Spain); Instituto Canario de Investigacion del Cancer, Canary Islands (Spain); Fontes, Fausto [Instituto Canario de Investigacion del Cancer, Canary Islands (Spain); Rey, Agustin [Pathology Department, Hospital Universitario Dr. Negrin, Las Palmas de Gran Canaria (Spain); Instituto Canario de Investigacion del Cancer, Canary Islands (Spain); Pinar, Beatriz [Radiation Oncology Department, Hospital Universitario Dr. Negrin, Las Palmas de Gran Canaria (Spain); Instituto Canario de Investigacion del Cancer, Canary Islands (Spain); Falcon, Orlando [Instituto Canario de Investigacion del Cancer, Canary Islands (Spain); Gynecological Oncology Department, Hospital Universitario Materno-Infantil, Las Palmas de Gran Canaria (Spain)



The GP Patient Survey for use in primary care in the National Health Service in the UK - development and psychometric characteristics  

E-Print Network (OSTI)

Abstract Background The UK National GP Patient Survey is one of the largest ever survey programmes of patients registered to receive primary health care, inviting five million respondents to report their experience of NHS primary healthcare...

Campbell, John; Smith, Patten; Nissen, Sonja; Bower, Peter; Elliott, Marc; Roland, Martin



Effects of sequence changes in the HIV-1 gp41 fusion peptide on CCR5 inhibitor resistance  

SciTech Connect

A rare pathway of HIV-1 resistance to small molecule CCR5 inhibitors such as Vicriviroc (VCV) involves changes solely in the gp41 fusion peptide (FP). Here, we show that the G516V change is critical to VCV resistance in PBMC and TZM-bl cells, although it must be accompanied by either M518V or F519I to have a substantial impact. Modeling VCV inhibition data from the two cell types indicated that G516V allows both double mutants to use VCV-CCR5 complexes for entry. The model further identified F519I as an independent determinant of preference for the unoccupied, high-VCV affinity form of CCR5. From inhibitor-free reversion cultures, we also identified a substitution in the inner domain of gp120, T244A, which appears to counter the resistance phenotype created by the FP substitutions. Examining the interplay of these changes will enhance our understanding of Env complex interactions that influence both HIV-1 entry and resistance to CCR5 inhibitors.

Anastassopoulou, Cleo G.; Ketas, Thomas J. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Sanders, Rogier W. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States) [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Laboratory of Experimental Virology, Department of Medical Microbiology, Center for Infection and Immunity Amsterdam (CINIMA), Academic Medical Center of the University of Amsterdam, Amsterdam (Netherlands); Johan Klasse, Per [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Moore, John P., E-mail: jpm2003@med.cornell.edu [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)



Glycosyl-phosphatidylinositol (GPI)-anchored membrane association of the porcine reproductive and respiratory syndrome virus GP4 glycoprotein and its co-localization with CD163 in lipid rafts  

SciTech Connect

The porcine reproductive and respiratory syndrome virus (PRRSV) glycoprotein 4 (GP4) resembles a typical type I membrane protein in its structure but lacks a hydrophilic tail at the C-terminus, suggesting that GP4 may be a lipid-anchored membrane protein. Using the human decay-accelerating factor (DAF; CD55), a known glycosyl-phosphatidylinositol (GPI) lipid-anchored protein, chimeric constructs were made to substitute the GPI-anchor domain of DAF with the putative lipid-anchor domain of GP4, and their membrane association and lipase cleavage were determined in cells. The DAF-GP4 fusion protein was transported to the plasma membrane and was cleaved by phosphatidylinositol-specific phospholipase C (PI-PLC), indicating that the C-terminal domain of GP4 functions as a GPI anchor. Mutational studies for residues adjacent to the GPI modification site and characterization of respective mutant viruses generated from infectious cDNA clones show that the ability of GP4 for membrane association corresponded to virus viability and growth characteristics. The residues T158 ({omega} - 2, where {omega} is the GPI moiety at E160), P159 ({omega} - 1), and M162 ({omega} + 2) of GP4 were determined to be important for virus replication, with M162 being of particular importance for virus infectivity. The complete removal of the peptide-anchor domain in GP4 resulted in a complete loss of virus infectivity. The depletion of cholesterol from the plasma membrane of cells reduced the virus production, suggesting a role of lipid rafts in PRRSV infection. Remarkably, GP4 was found to co-localize with CD163 in the lipid rafts on the plasma membrane. Since CD163 has been reported as a cellular receptor for PRRSV and GP4 has been shown to interact with this receptor, our data implicates an important role of lipid rafts during entry of the virus.

Du, Yijun [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Shandong Key Laboratory of Animal Disease Control and Breeding, Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Jinan (China); Pattnaik, Asit K. [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States)] [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States); Song, Cheng [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Yoo, Dongwan, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Li, Gang, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Institute of Animal Science and Veterinary Medicine, Chinese Academy of Agricultural Sciences, Beijing (China)



Detection of Nitrogen and Neon in the X-ray Spectrum of GP Com with XMM/Newton  

E-Print Network (OSTI)

We report on X-ray spectroscopic observations with XMM/Newton of the ultracompact, double white dwarf binary, GP Com. With the Reflection Grating Spectrometers (RGS) we detect the Lyman alpha and beta lines of hydrogen-like nitrogen (N VII) and neon (Ne X), as well as the helium-like triplets (N VI and Ne IX) of these same elements. All the emission lines are unresolved. These are the first detections of X-ray emission lines from a double-degenerate, AM CVn system. We detect the resonance (r) and intercombination (i) lines of the N VI triplet, but not the forbidden (f) line. The implied line ratios for N VI, R = f/i < 0.3, and G = (f + i)/r ~1, combined with the strong resonance line are consistent with formation in a dense, collision-dominated plasma. Both the RGS and EPIC/MOS spectra are well fit by emission from an optically thin thermal plasma (model cevmkl in XSPEC). Helium, nitrogen, oxygen and neon are required to adequately model the spectrum, however, the inclusion of sulphur and iron further improves the fit, suggesting these elements may also be present at low abundance. We confirm in the X-rays the underabundance of both carbon and oxygen relative to nitrogen, first deduced from optical spectroscopy by Marsh et al. The average X-ray luminosity of ~3e30 ergs/s implies a mass accretion rate of ~9e-13 solar masses per year. The implied temperature and density of the emitting plasma, combined with the presence of narrow emission lines are consistent with production of the X-ray emission in an optically thin boundary layer just above the surface of the white dwarf.

Tod E. Strohmayer



KU Today, August 29, 2012  

E-Print Network (OSTI)

S EVENTS MEETING Information session: Interdisciplinary Seed Grants Wednesday, Aug. 29, 2012 3:30 p.m.-5 p.m. Spooner Hall The Commons View all events TWITTER @thecommonsku Still a few seats at next week's Idea Caf: Birth Certificates...


KU Today, March 6, 2013  

E-Print Network (OSTI)

, published by the University of Iowa Press. Full Story Vote in KPR's Classical Top 60 Kansas Public Radio listeners can have their say about their favorite classical music by voting in KPRs Classical Top 60. Listeners can choose their five... favorite selections from among the 100 all-time greatest pieces of classical music. The top 60 selections will be broadcast in April. Full Story CAMPUS NEWS Retirement luncheon announced The annual retirement recognition for faculty...


KU Today, May 4, 2012  

E-Print Network (OSTI)

Friday, May 4, 2012 Changes in Kansas oil, gas production Oil production in Kansas rose and natural gas production declined in 2011 as crude oil prices remained high and gas prices fell, according to estimates from the Kansas...


KU Today, January 14, 2013  

E-Print Network (OSTI)

across the world together. Phillip Vardiman, assistant professor of health, sport and exercise science, is conducting a study to see how such events might bring different areas of medicine together, not in the hope of winning medals, but providing... for Advancement of Hispanics/Chicanos & Native Americans in Science. Full Story TODAYS EVENTS MEN'S BASKETBALL Men's basketball vs. Baylor Monday, January 14, 2013 8 p.m. Allen Fieldhouse View all events TWITTER @kubigjay It may be cold...


KU Today, February 28, 2012  

E-Print Network (OSTI)

and Gas Association, and Joe Spease, Sierra Club of Kansas, for a discussion about hydraulic fracturing. Full Story TODAYS EVENTS LECTURE Kansas-Missouri Italian Renaissance Art Symposium Tuesday, Feb. 28, 2012 5:15 p.m.-7 p.m. Spencer...AM, which will change its format to an all- business news station March 5. Full Story Dole to host talk on 'fracking' The Dole Institute of Politics Student Advisory Board will host Edward Cross, president of the Kansas Independent Oil...


KU Today, April 4, 2012  

E-Print Network (OSTI)

everywhere. Full Story TODAYS HEADLINES Breakthrough for solar panel material Judy Wu, Distinguished Professor of Physics and Astronomy at the University of Kansas, believes graphene will lead to high-efficiency, ultrathin solar panels...


Possible physical self-asserting of the homogeneous vector potential. A testing puzzle based on a G.P. Thomson-like arrangement  

E-Print Network (OSTI)

It is suggested a testing puzzle able to reveal the self-asserting property of the homogeneous vector potential field. As pieces of the puzzle are taken three reliable entities : (i) influence of a potential vector on the de Broglie wavelength (ii) a G.P. Thomson-like experimental arrangement and (iii) a special coil designed to create a homogeneous vector potential. The alluded property is not connected with magnetic fluxes surrounded by the vector potential field lines, but it depends on the fluxes which are outside of the respective lines. Also the same property shows that in the tested case the vector potential field is uniquely defined physical quantity, free of any adjusting gauge. So the phenomenology of the suggested quantum test differs on that of macroscopic theory where the vector potential is not uniquely defined and allows a gauge adjustment. Of course that the proposed test has to be subjected to adequate experimental validation.

Spiridon Dumitru



Daylighting systems for the Kuwait National Museum  

E-Print Network (OSTI)

for the degree of MASTER OF SCIENCE Approved as to style and content by: _______________________________ _____________________________ Liliana O. Beltran Paul K.... Woods (Chair of Committee) (Member) _______________________________ _____________________________ Rodney C. Hill...

Ahn, Byoungsoo



Antibody elicited against the gp41 N-heptad repeat (NHR) coiled-coil can neutralize HIV-1 with modest potency but non-neutralizing antibodies also bind to NHR mimetics  

Science Journals Connector (OSTI)

Following CD4 receptor binding to the HIV-1 envelope spike (Env), the conserved N-heptad repeat (NHR) region of gp41 forms a coiled-coil that is a precursor to the fusion reaction. Although it has been a target of drug and vaccine design, there are few monoclonal antibody (mAb) tools with which to probe the antigenicity and immunogenicity specifically of the NHR coiled-coil. Here, we have rescued HIV-1-neutralizing anti-NHR mAbs from immune phage display libraries that were prepared (i) from b9 rabbits immunized with a previously described mimetic of the NHR coiled-coil, N35CCG-N13, and (ii) from an HIV-1 infected individual. We describe a rabbit single-chain Fv fragment (scFv), 8K8, and a human Fab, DN9, which specifically recognize NHR coiled-coils that are unoccupied by peptide corresponding to the C-heptad repeat or CHR region of gp41 (e.g. C34). The epitopes of 8K8 and DN9 were found to partially overlap with that of a previously described anti-NHR mAb, IgG D5; however, 8K8 and DN9 were much more specific than D5 for unoccupied NHR trimers. The mAbs, including a whole IgG 8K8 molecule, neutralized primary HIV-1 of clades B and C in a pseudotyped virus assay with comparable, albeit relatively modest potency. Finally, a human Fab T3 and a rabbit serum (both non-neutralizing) were able to block binding of D5 and 8K8 to a gp41 NHR mimetic, respectively, but not the neutralizing activity of these mAbs. We conclude from these results that NHR coiled-coil analogs of HIV-1 gp41 elicit many Abs during natural infection and through immunization, but that due to limited accessibility to the corresponding region on fusogenic gp41 few can neutralize. Caution is therefore required in targeting the NHR for vaccine design. Nevertheless, the mAb panel may be useful as tools for elucidating access restrictions to the NHR of gp41 and in designing potential improvements to mimetics of receptor-activated Env.

Josh D. Nelson; Heather Kinkead; Florence M. Brunel; Dan Leaman; Richard Jensen; John M. Louis; Toshiaki Maruyama; Carole A. Bewley; Katherine Bowdish; G. Marius Clore; Philip E. Dawson; Shana Frederickson; Rose G. Mage; Douglas D. Richman; Dennis R. Burton; Michael B. Zwick


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



NLE Websites -- All DOE Office Websites (Extended Search)

DOP (5-2011) DOP (5-2011) Supersedes (7-2010) issue DECLARATION of OCCUPATIONAL MEDICINE PROVIDER GENERAL INFORMATION PURPOSE All Contractors and their lower-tier subcontractors must comply with the Department of Energy's Worker Safety and Health Program regulation, 10 CFR 851, "Worker Safety and Health Program (WSHP). The WSHP enforces worker safety and health requirements including, but not limited to, standards of the Occupational Safety and Health Administration (OSHA), American National Standards Institute (ANSI) and Workers Compensation Laws as incorporated in the SNL WSHP. APPLICABILITY Contractors at all tiers which meet the applicability criteria must establish and provide comprehensive


What's New in the KU Libraries  

E-Print Network (OSTI)

have a redesigned Government Information Page with a new feature - a rolling 'interesting features' section. The Libraries will use this to highlight items of particular relevance to users, and features will be changed on a regular basis. See: http... such as John Wilson's 'A Song of Thanksgiving for the Lasting Remembrance of God's Wonderful Works' (1603), William Morrell's 'New England' (1625) and the complete works of Anne Bradstreet and Edward Taylor, and continues through to early twentieth- century...



Investiganactivi delKu Klux Klan  

E-Print Network (OSTI)

en masa a las ciencias, muchos en- tramos por cuestiones de acciden- tes, porque conocemos a personas, pero a cada paso que avanzamos est el peligro de...




GIS Day @ KU 2007 Symposium Schedule  

E-Print Network (OSTI)

continue our tradition of bringing together a community of GIS users from academia, business and government. This year's focus is on the range of available software solutions (both proprietary and open-source), and how GIS and the web are combining...

GIS Day @ KU Planning Committee



Conceptual Liquefied Natural Gas (LNG) terminal design for Kuwait  

E-Print Network (OSTI)

containment systems (Pepper and Shah 2004) ..............................................5 6. Single containment tanks (UH IELE 2003b).........................................................................5 7. Double containment tanks (UH IELE 2003b...)........................................................................7 8. Full containment tanks (UH IELE 2003b).............................................................................7 9. Underground LNG storage tank (UH IELE 2003b)...............................................................7 10. Three...

Aljeeran, Fares



Improving Operational Strategies of an Institutional Building in Kuwait  

E-Print Network (OSTI)

operation strategies. The study focused on the major end user systems of the building main source of energy that is electricity, namely the air-conditioning, and lighting systems. It was estimated that for the base year, which was selected to be year 1999...

Al-Ragom, F.



Energy Conservation Program in Kuwait: A Local Perspective  

E-Print Network (OSTI)

(petrol, natural gas, and coal), hydropower, and nuclear energy. According to the International Energy Agency (IEA) 1997 annual report, the industrialized countries including North America and Western Europe consumed more than 50% of the energy used... emissions come from developing countries (9,118 million metric tons) and the former Soviet Union and Eastern Europe (3,148 million metric tons) [2]. 1.2 Environmental Energy Impact There are environmental and health impacts associated...

Hajiah, A. E.



The life cycle assessment of concrete manufacturing in Kuwait  

E-Print Network (OSTI)

Concrete is the second most widely used material in the world after water. Annually 9,120 million tons of concrete are produced, which is an equivalent of 1.3 tons of concrete per individual. As the world's primary ...

El Mostafa, Mayce (Mayce A.)



*PSD:Position Sensitive Detector GP2D12/GP2D15 Distance Measuring Sensors  

E-Print Network (OSTI)

control circuit is unnecessary. (4) Low cost Tec.U970501 (1) TVs (2) Personal computers (3) Cars (4) · In the absence of device specification sheets, SHARP takes no responsibility for any defects that may occur

Wedeward, Kevin


Dynamically polarized target for the gp2 and GpE experiments at Jefferson Lab  

We describe a dynamically polarized target that has been utilized for two electron scattering experiments in Hall A at Jefferson Lab. The primary components of the target are a new, high cooling power 4 He evaporation refrigerator, and a re-purposed, superconducting split-coil magnet. It has been used to polarize protons in irradiated NH3 at a temperature of 1 K and at fields of 2.5 and 5.0 Tesla. The performance of the target material in the electron beam under these conditions will be discussed. Maximum polarizations of 28% and 95% were obtained at those fields, respectively. To satisfy the requirements of both experiments, the magnet had to be routinely rotated between angles of 0, 6, and 90 degrees with respect to the incident electron beam. This was accomplished using a new rotating vacuum seal which permits rotations to be performed in only a few minutes.

Pierce, Joshua J. [JLAB, Newport News, VA (United States); Maxwell, James D. [MIT, Amherst, MA (United States); Badman, Toby E. [Univ. of New Hampshire, Durham, NH (United States); Brock, James D. [JLAB, Newport News, VA (United States); Carlin, Christopher R. [JLAB, Newport News, VA (United States); Crabb, Donald G. [Univ. of Virginia, Charlottesville, VA (United States); Day, Donal B. [Univ. of Virginia, Charlottesville, VA (United States); Keith, Christopher D. [JLAB, Newport News, VA (United States); Kvaltine, Nicholas D. [Univ. of Virginia, Charlottesville, VA (United States); Meekins, David G. [JLAB, Newport News, VA (United States); Mulholland, Jonathan R.L. [Univ. of Tennessee, Knoxville, TN (United States); Shields, Joshua A. [Univ. of Virginia, Charlottesville, VA (United States); Slifer, Karl J. [Univ. of New Hampshire, Durham, NH (United States)



Research and Graduate Studies at KU Newsletter, January 2013  

E-Print Network (OSTI)

within 60 days of your return (along with the Travel Expense Report and appropriate receipts). Applications must be reviewed and approved by RGS before arrangements are finalized for a trip. Applications can be mailed, e-mailed as a PDF, faxed... 153A, Lawrence, KS 66045, (785) 864-6414, 711 TTY. ...



Connecting to KU Teaching & Research Departments: Task Force Report  

E-Print Network (OSTI)

This report includes review of numerous local and national assessments of libraries and library users.



Research and Graduate Studies at KU Newsletter, June 2012  

E-Print Network (OSTI)

/key personnel due to the hiring, replacement, or loss of an investigator Exceptions exist for: ? RFAs with only one due date, ? Specific FOAs that allow post-submission materials to facilitate the goal of the program ? Institutional training... doctoral candidate per year. Earning honors and being nominated for this award means you have achieved a significant accomplishment.? Other Argersinger Prize nominees were: ? Jo Zanice Bond de Perez, ?Race, Place and Family: Narratives of the Civil...



A Functional Interaction between gp41 and gp120 Is Observed for Monomeric but Not Oligomeric, Uncleaved HIV-1 Env gp140  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 40 :s453-s458. 42. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 43. Svergun, DI . 1991. Mathematical...

Miklos Guttman; Kelly K. Lee




E-Print Network (OSTI)

a gentle introduction to the process of oil exploration and production (Section 2). The data integration of future work (Section 8). 2. Oil Exploration and Production Oil exploration and production is the process to Oil Exploration and Production Tina Yu, Dave Wilkinson and Deyi Xie ChevronTexaco Information

Fernandez, Thomas


Better GP benchmarks: community survey results and proposals  

Science Journals Connector (OSTI)

We present the results of a community survey regarding genetic programming benchmark practices. Analysis shows broad consensus that improvement is needed in problem selection and experimental rigor. While views expressed in the survey dissuade us from ... Keywords: Benchmarks, Community survey, Genetic programming

David R. White; James Mcdermott; Mauro Castelli; Luca Manzoni; Brian W. Goldman; Gabriel Kronberger; Wojciech Ja?kowski; Una-May O'Reilly; Sean Luke




E-Print Network (OSTI)

..................................................................................... 11 Waste Tanks ..................................................................................................................... 11 Immobilization of Waste Contained in Underground Tanks


Monitoring gp43 Antigenemia in Paracoccidioidomycosis Patients during Therapy  

Science Journals Connector (OSTI)

...Intergroup comparisons were performed by using the Kruskal-Wallis test. RESULTS Table 1 shows the characteristics of...Microbiol. 29: 1610-1615. 29 Restrepo, A. 1966. La prueba de inmunodifusion en el diagnostico de la paracoccidioidomicosis...

Silvia Helena Marques da Silva; Flvio Queiroz-Telles; Arnaldo Lopes Colombo; Maria Heloisa Souza Lima Blotta; Jos Daniel Lopes; Zoilo Pires de Camargo



Name: Entry: Gp: 1 Indian Institute of Technology, Delhi  

E-Print Network (OSTI)

relation R #18; A#2;A is an equivalence. R = f (a; b) : f(a) = f(b) g Re exivity: for all a 2 S : (a; a) 2 Marks: 80 Q1 [8 Marks] Equivalences. Suppose f : A ! B is a total function. Prove that the following(c). By transitivity of equality, f(a) = f(c), whence (a; c) 2 R. Q2 [8+8 Marks] Partial Orders. In a partial order h

Prasad, Sanjiva


Molecular mechanisms of HIV gp120-induced neurotoxicity  

E-Print Network (OSTI)

the NMDA receptor antagonist memantine. Brain Research. 706:antagonists such as memantine (on the market) or MK801,

Medders, Kathryn Elizabeth


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


ORIGINAL PAPER GP challenge: evolving energy function for protein  

E-Print Network (OSTI)

different amino acids encoded in the genetic material (DNA or RNA sequence). Each amino acid includes an a-carbon carbon, oxygen and nitrogen atoms form a protein backbone. This backbone forms several repeating local structures such as alpha helices, beta sheets or loops, known as secondary structure elements (see Fig. 1

Aickelin, Uwe


Page 1 of 4 Policy GP 38 January 24, 2008  

E-Print Network (OSTI)

sustainability and environmental literacy in teaching, research, operations and outreach at colleges the ecological integrity of our grounds and employ sustainable building design and construction principles and Procedures Revision Date Revision No. Subject: Sustainability 1.0 Purpose: In adopting this policy, Simon


Merrimac Supercomputing with Stream Extended Abstract for GP2  

E-Print Network (OSTI)

units, and utilize a deep register hierarchy with high local band- width to match the bandwidth demands us to place hun- dreds of functional units on a single chip but provides limited global on for operating a small number of functional units. Graphics processors utilize the inherent parallelism

Dally, William J.


Re-examination of the current architectural curriculum at Kuwait University  

E-Print Network (OSTI)

and society in general. Architectural education is in desperate need of change and improvement, primarily through reforming the heart of the architectural education--its curriculum. This study reviews the existing program of the Department of Architecture...

Abdullah, Mohammad



Numerical analysis of the laterally loaded piles in the Kuwait offshore environment  

SciTech Connect

An attempt is made to present an automated analysis of laterally loaded piles using subgrade reaction theory and the P-delta curves governing the soil properties. The finite difference method is applied in establishing the governing equations. The pile response is obtained using the boundary conditions improved by Newtonian method. Results obtained are forces, moments, deflections and soil reactions for various depths of strata in which such piles exist. Based on these results future recommendations are made.

Al-Obaid, Y.F.



Department of Defense Kuwait oil fire health risk assessment. (The 'Persian Gulf Veterans' registry'). Background paper  

SciTech Connect

Second report prepared in response to P.L. 102-585--the Persian Gulf War Veterans' Health Status Act. (First report focused on the VA 'Persian Gulf War Veterans' Health Registry.') Assesses whether DoD's response 'meets the provisions of the law under which it was mandated,' assesses its 'potential utility ... for scientific study and assessment of the intermediate and long-term health consequences of military service in the Persian Gulf theater of operations during the Persian Gulf War,' and addresses some other related questions.

Not Available



"Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data"  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" "No","Identified","Advanced Metering Systems","Biomass","Excluded","Electric On-Grid","On Federal or Indian Land, On User Site",0,"Scope 1","Long-Term (> 10)","Electric Renewable Energy","Agricultural byproducts","NA","Line Item","Acquire More Fuel-Efficient Vehicles","Compressed Natural Gas (CNG)","Buses","B100","Direct","Guiding Principles","Met",2.2,"LEED® Certified","D&D in Progress","Actual"


unknown title  

E-Print Network (OSTI)

rs ch un g s-sc hw er p un kt Fa ku lt t 1 0 Fa ku lt t 0 9 Fa ku lt t 0 6 Fa ku lt t 0 5 Fa ku lt t 0 4 Fa ku lt t 0 3 Fa ku lt t 0 2 Fa ku lt

unknown authors


KU to open Library Annex on west campus that will hold 1.6 million volumes  

E-Print Network (OSTI)

the addition of 1.6 miles of linear shelving space each year. The Library Annex will relieve overcrowded stacks and enable the libraries to increase the space available for library users. Circulating materials will be reshelved more quickly and stacks... will be less densely packed with materials, making shelf-browsing easier for library users. More individual study and group study spaces will be configured as well. One of the real advantages of the Library Annex is the climate-controlled environment...



Ku80 Deletion Suppresses Spontaneous Tumors and Induces a p53-Mediated DNA Damage Response  

Science Journals Connector (OSTI)

...when incapable of reaching the water source. Morbidities were scored...chow (Harlan Teklad) and water were supplied ad libitum...min using a Pantak X-ray generator (320 kV/10 mA with 0.5-mm...to the oxidative stress of atmospheric (21) O2 (25). 53BP1 rapidly...

Valerie B. Holcomb; Francis Rodier; YongJun Choi; Rita A. Busuttil; Hannes Vogel; Jan Vijg; Judith Campisi; and Paul Hasty



Radiation sensitivities of the human cancer cell lines were enhanced by silencing Ku80 gene  

Science Journals Connector (OSTI)

...Tokyo, Hongo, Tokyo 113, Japan. To whom requests for reprints...Tokyo, Hongo, Tokyo 113, Japan. The radiation sensitivity of leukemic progenitor...Tochigi-ken, 329-04, Japan ABSTRACT The radiation sensitivity of leukemic progenitor...

Yoshinori Nimura; Tetsuya Kawata; Masayoshi Saito; Cuihua Liu; Jyunko Okamura; Naohiko Seki; Craig Stevens; Akira Nakagawara; Takenori Ochiai; and Hideki Tanzawa



DRAFT: Not to be duplicated or quoted without permission KU and Kansas City: Partnership for Excellence  

E-Print Network (OSTI)

which lead to advances in aerospace technology--all are products of a society which links education research created the Internet. Faculty funded by the Defense Department and the National Science Foundation and research. The National Governors' Association recently reported "In the new economy, the fastest growing


Design, Prototyping and Measurement of EVLA Ku-Band Feed Horn Sivasankaran Srikanth  

E-Print Network (OSTI)

EDM (electric discharge machining) technique was used in the measurements. The horn was mounted.6 and a length of 42.3 at the center frequency. The horn has five machined aluminum sections including-loaded corrugations. Machined aluminum disks that make up the ring-loaded corrugations are press fitted

Groppi, Christopher


Implementation of Smart Operation Strategies for Air-Conditioning and Lighting Systems for Ministries Complex in the State of Kuwait  

E-Print Network (OSTI)

of the smart operation strategies. These savings led to a reduction of $1,500 per typical summer day of the MEW fuel bill and 8,918 kg/day of CO2 emissions. To make MC building more energy efficient, it is recommended to retrofit AHUs and secondary chilled...

Al-Mulla, A.; Maheshwari, G. P.; Al-Nakib, D.; Ishaqali, H.


Number and Size Distribution of Airborne Nanoparticles during Summertime in Kuwait: First Observations from the Middle East  

Science Journals Connector (OSTI)

(12-14) Nevertheless, the NPF barrier imposed by high pre-existing particles in polluted environment can be overshadowed by the extremely high precursor gases. ... Roadside vegetation barriers are used in many urban areas to restrict air and noise pollution from reaching roadside pedestrians, but their effectiveness in limiting the movement of nanoparticles is not yet known. ...

Abdullah N. Al-Dabbous; Prashant Kumar



Promoting social change in the Arab Gulf: two case studies of communication programmes in Kuwait and Bahrain.  

E-Print Network (OSTI)

??The thesis presents rich empirical analysis of the role of public relations in facilitating participation in social change in the Arab Gulf. The focus is (more)

Al Saqer, Layla Hassan



Hydrogeophysical methods for analyzing aquifer storage and recovery systems  

E-Print Network (OSTI)

1995. Hydrogeology of the Dammam formation in Umm GudairGeology and hydrogeology of the Dammam formation in Kuwait.freshwater storage in the Dammam formation, Kuwait. Arabian

Minsley, B.J.



Another Viewpoint (AVP)  

E-Print Network (OSTI)

the oil wells and installations in Saudi Arabia, Kuwait andKuwait, or simply assure relatively cheap supplies of oil? Some of these objectives, if well

Tuma, Elias H




E-Print Network (OSTI)

Kuwaits pioneering Investment Authority was deliberately designed to provide for the day when the Emirates oil wells




Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network (OSTI)

Iraq, Jordan, Kuwait, Persian Gulf, Saudi Arabia, Yemen.Iraq, Jordan, Kuwait, Persian Gulf, Saudi Arabia, Yemen.Gordon. Gazetteer of the Persian Gulf, 'Oman, and Central

Alissa, Reem IR


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network (OSTI)

Oil and Politics in the Gulf: Rulers and Merchants in Kuwait and Qatar, (Oil and Politics in the Gulf: Rulers and Merchants in Kuwait and Qatar,

Alissa, Reem IR



Therapeutic Tumor Immunity Induced by Polyimmunization with Melanoma Antigens gp100 and TRP-2  

Science Journals Connector (OSTI)

...Lond.), 372: 100-103, 1994. 4 Overwijk W. W., Tsung A., Irvine K. R...Rodriguez F., Whitton J. L., Overwijk W. W., Restifo N. P., Reisfeld...Apolloni E., Ronca R., Zamboni P., Overwijk W. W., Surman D. R., Restifo N...

Sanjeev Kumar Mendiratta; Gerald Thai; Nima K. Eslahi; Nikolyn M. Thull; Majed Matar; Vincenzo Bronte; Federica Pericle



Structure and complete nucleotide sequence of the Marek's disease herpesvirus gp57-65 gene.  

Science Journals Connector (OSTI)

...His Arg Asn 1260 1270 1280 1290 1300 1310 * * * * * * CTC CTC AOC CGC ATT CCA OTA TOG OAC MT TOG ACG AA ACA AM TAT ACO TGC AOA...Ph. Ie His Sor Thr Arg Lys Ile Ph. 1500 1510 1520 1530 1540 1550 * * * * * * OAT TAT MT CTC ATT GTT ATO TAG TTG TGA TmT ATT MA...

P M Coussens; L F Velicer



GP commissioning: implications for the third Helen Dickinson1 and Robin Miller  

E-Print Network (OSTI)

(Secretary of State for Health, 2010) heralded reforms described as the `biggest upheaval of the NHS outcome focus, extended choice etc),recent reform processes have shown that during implementation be for the third sector. NHS reform and policy drivers To some extent, the recently proposed reforms

Birmingham, University of


Isolate-Specific Differences in the Conformational Dynamics and Antigenicity of HIV-1 gp120  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 36 :1277-1282. 72. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomacromolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 73. Svergun, DI . 1991. Mathematical...

Thaddeus M. Davenport; Miklos Guttman; Wenjin Guo; Brad Cleveland; Maria Kahn; Shiu-Lok Hu; Kelly K. Lee



How to Draw a Straight Line Using a GP: Benchmarking Evolutionary Design Against 19th  

E-Print Network (OSTI)

Kinematic Synthesis Hod Lipson Computational Synthesis Laboratory, Mechanical & Aerospace Engineering, and Computing & Information Science, Cornell University, Ithaca NY 14850, USA hod.lipson@cornell.edu Abstract, and a number of human-competitive inventions are shown. 1 Introduction Kinematics � the science of pure motion

Fernandez, Thomas



Annual Energy Outlook 2012 (EIA)

. . . . . . . . . . . . . . . . . . . . 45 Appendix D. Derivation of Pattern Asymmetry Test Equation . . . . . . . . . . . . . . . . . 55 Tables 3.1 Gasoline Price Levels Move...


E-Print Network 3.0 - alveolar epithelial gp60 Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

of the underlying mammary mesenchyme by the presumptive mammary epithelium to establish a bulb of ... Source: Scott, Matthew - Departments of Developmental Biology, Genetics, &...


Bounding the Gaussian Process Information Gain: Applications to PAC-Bayes and GP Bandit  

E-Print Network (OSTI)

Process Information Gain 23/3/10 1 / 23 #12;PAC-Bayesian Theorems PAC-Bayesian Recipe (x, y) Datapoint does not depend on data S! Lift result to smart classifier Q(f) = Q(f; S). What's the cost? n-1 D[Q P] How does it work? Variational (Fenchel) inequality

Seeger, Matthias


E-Print Network 3.0 - african clade-a gp160 Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

in most of sub-Saharan Africa, clade E (A... conservation of the novel epitopes in HIV-1 sequences classified as having been African in origin is notable... to the gag, nef,...


Climate Change in Scotland: Impact on Mini-Hydro G.P. Harrison  

E-Print Network (OSTI)

be generated from wind, wave, biomass or small- or mini-hydro plant. Production from these resources some 300 MW is small hydro potential capable of producing energy at less than 7p/kWh (Garrad Hassan, 2001). Although many of the better sites for small and mini-hydro have already been developed

Harrison, Gareth


Author's personal copy Kaly UL and Jones GP (1998) Mangrove restoration: A potential tool for  

E-Print Network (OSTI)

, Texas, USA. Marine Ecology ­ Progress Series 151: 165­179. Mitsch WJ and Gosselink JG (2000) Wetlands-year monitoring study. Restoration Ecology 12: 29­35. Thayer GW (ed.) (1992) Restoring the Nation and Kreeger DA (eds.) (2000) Concepts and Controversies in Tidal Marsh Ecology. Dordrecht: Kluwer Academic

Langerhans, Brian


Special Publication No. 3, Ticks and Tickborne Diseases, II. Hosts, Part 2. G-P  

E-Print Network (OSTI)

.. (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella..... (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella...

Doss, Mildred A.; Farr, Marion M.; Roach, Katharine F.; Anastos, George


Jrgen Primdahl, Department of Geoscience and Natural ressource Management, University of Copenhagen e-mail: jpr@life.ku.dk  

E-Print Network (OSTI)

Jørgen Primdahl, Department of Geoscience and Natural ressource Management, University Pirita, New Zealand · Dry land sheep farming in transition to dairy · Irrigation and intensification-population · Emerging tourism and increased hunting · Significant support for aforestation and montado management #12


PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair  

E-Print Network (OSTI)

regions of PAXX1-204 and PAXXV199A/F201A were amplified from the vectors by PCR and cloned into the pcDNA3.1(-) vector (a gift from Dr. V. Bolanos-Garcia) together with GFP or FLAG tags using In-Fusion (Clontech). Vectors were sequenced by the DNA... -treated or treated for 1 hour with 300 M phleomycin to induce large numbers of DSBs, before being harvested either at this point or after an additional 1-hour recovery period in phleomycin-free medium after three PBS washes. Cells were washed twice in ice-cold PBS...

Ochi, Takashi; Blackford, Andrew N.; Coates, Julia; Jhujh, Satpal; Mehmood, Shahid; Tamura, Naoka; Travers, Jon; Wu, Qian; Draviam, Viji M.; Robinson, Carol V.; Blundell, Tom L.; Jackson, Stephen P.



The K/U ratio of the silicate Earth: Insights into mantle composition, structure and thermal evolution  

E-Print Network (OSTI)

2009 Editor: R.D. van der Hilst Keywords: potassium uranium argon degas radiogenic volatile structure consisting of at least two independent reservoirs: a depleted upper mantle and a chemically in the silicate Earth. Although the budgets of thorium (Th) and uranium (U) in the planet are well

Mcdonough, William F.


Controls and Measurements of KU Engine Test Cells for Biodiesel, SynGas, and Assisted Biodiesel Combustion  

E-Print Network (OSTI)

.................................................................................................................. 127 Table 4. Torque output and standard deviation under different reformate flow rates between 0 and 15 liters per minute... to maintain 1,800 revolutions per minute (rpm) needed for the generator. The current setup allows for all the components of the engine to be operated independent of each other; it is important to note that the original design by BEC did not allow...

Cecrle, Eric Daniel




E-Print Network (OSTI)

at the ASME Joint Fluids Engineering and LubricationASME, Journal of Fluids Engineering, 1977, pp. 231-239. 8.ASME, Journal of Fluids Engineering, Vol. 99, 1977, pp. 666-

Humphrey, Joseph A.C.



Viruses: incredible nanomachines. New advances with filamentous phages  

E-Print Network (OSTI)

) resonance energy transfer gp8 Gene 8 product; the protein coded by viral gene number 8 (gp3, gp5, gp6, gp7. The technique of phage display has provided powerful methodology for identification and optimisation of ligands

Hemminga, Marcus A.


Building for Oil: Corporate Colonialism, Nationalism and Urban Modernity in Ahmadi, 1946-1992  

E-Print Network (OSTI)

from Arabia, 1930-1960: Iraq, Jordan, Kuwait, Persian Gulf,from Arabia, 1930-1960: Iraq, Jordan, Kuwait, Persian Gulf,King Faisals Palace in Bagdad, Iraq, 1928. (Source: Wilson

Alissa, Reem IR


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Prof. Cauligi (Raghu) Raghavendra Vice Dean for Global Academic Initiatives  

E-Print Network (OSTI)

and Turkey ­ DEN Opportunities: Kuwait Oil Company, Aviation Safety in IFEZ, Korea, PEMEX and UNAM in Mexico

Zhou, Chongwu


China Energy Primer  

E-Print Network (OSTI)

Oil Reserves (2008) Saudi Arabia Iran Iraq Venezuela Kuwait United Arab Emirates Russian Federation Libya Kazakhstan Nigeria Canada US Qatar

Ni, Chun Chun



Wald L., Baleynaud J.-M., 1999. Observing air quality over the city of Nantes by means of Landsat thermal infrared data. International Journal of Remote Sensing, 20, 5, 947-959.  

E-Print Network (OSTI)

oil wells in Kuwait were set on fire. As a result smoke plumes have obscured the sky south of Kuwait. As an example, the relative monthly solar radiation in Bahrain, 600 km south-east of Kuwait, was reduced by upto

Paris-Sud XI, Université de


Selected Abstracts & Bibliography of International Oil Spill Research, through 1998  

E-Print Network (OSTI)

Kuwait, Middle East, oil and gas fields, oil refinery, oil waste, oil well,Equipment Kuwait Oil Co. 1991. Mideast well fire, oil spillKuwait, Persian Gulf, Saudia Arabia, Oil spill, cleanup, oil spills, crude, oil spill incidents, oil spills-pipeline, warfare, oil skimmers, oil wells,

Louisiana Applied Oil Spill Research & Development Program Electronic Bibliography



Targeted Immunotherapy Using Reconstituted Chaperone Complexes of Heat Shock Protein 110 and Melanoma-associated Antigen gp100  

Science Journals Connector (OSTI)

...Spiess P., Nichimura M. I., Overwijk W. W., Roberts B., Restifo N. P...Immunother., 20: 15-25, 1997. 28 Overwijk W. W., Tsung A., Irvine K. R...Methods, 53: 31-40, 1992. 34 Overwijk W. W., Lee D. S., Surman D. R...

Xiang-Yang Wang; Xing Chen; Masoud H. Manjili; Elizabeth Repasky; Robert Henderson; John R. Subjeck



Binding Characteristics and Antitumor Properties of 1A10 Bispecific Antibody Recognizing gp40 and Human Transferrin Receptor  

Science Journals Connector (OSTI)

...Litwin Sylvia Hsieh-Ma Tim Shi R. Katherine Alpaugh Gregory P. Adams Ellen J. Wolf...Litwin, Sylvia Hsieh-Ma, Tim Shi, R. Katherine Alpaugh, Gregory P. Adams, Ellen J...603, 1989. 2. LoBuglio, A. F., Wheeler, R. H., Trang, J., Haynes, A...

Anne R. Amoroso; Joseph I. Clark; Samuel Litwin; Sylvia Hsieh-Ma; Tim Shi; R. Katherine Alpaugh; Gregory P. Adams; Ellen J. Wolf; David B. Ring; and Louis M. Weiner



Molecular dissection of Rauscher virus gp70 by using monoclonal antibodies: localization of acquired sequences of related envelope gene recombinants  

Science Journals Connector (OSTI)

...and reagents provided by Drs. Norman Klinman, Judy Teale, Jeffery Hubert, David Katz, Thomas Shinnick, and Gregor Sutcliffe...767-774. 22. Schaffhausen, B. S., Silver, J. E. & Benjamin, T. L. (1978) Proc. Natl. Acad. Sci. USA 75,79-83...

H L Niman; J H Elder



PAPER CATEGORY: Genetic Programming 1 Effects of Tree Size and State Number on GP-Automata Bidding Strategies  

E-Print Network (OSTI)

deregulation of the electrical transmission network, the Federal Energy Regulatory Commission (FERC) hopes a genetic algorithm (GA) to evolve bidding strategies for the electric energy market. These strategies strategies to develop. The results have been written up specifically for the electric energy market

Fernandez, Thomas


Ten years of health workforce planning in the Netherlands: a tentative evaluation of GP planning as an example  

Science Journals Connector (OSTI)

In many countries, health-care labour markets are constantly being challenged by an alternation of shortage and oversupply. Avoiding these cyclic variations is a major challenge. In the Netherlands, a workforc...

Malou Van Greuningen; Ronald S Batenburg



Do shocks always accelerate ions? W.K.M. Rice, G.P. Zank Bartol Research Institute  

E-Print Network (OSTI)

the solar wind density (top panel), flow speed (middle panel), and energetic particle pressure (lower panel by observations of energetic particle enhancements coincident with shock waves (e.g. at 5 AU ­ left panel particle peak arrival time ­ right panel of figure. 5 AU 47 AU 0.52 ­ 1.45 MeV energetic particle

Christian, Eric



E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook THTR 164 Fundamentals of Acting 3 PHIL


Bioinformatics process management: information flow via a computational journal  

E-Print Network (OSTI)

ral Source Code for Biology and ssBioMed CentMedicine Open AcceResearch Bioinformatics process management: information flow via a computational journal Lance Feagan, Justin Rohrer, Alexander Garrett, Heather Amthauer, Ed Komp, David Johnson...@ittc.ku.edu; Alexander Garrett - agarrett@ittc.ku.edu; Heather Amthauer - amthah@ittc.ku.edu; Ed Komp - komp@ittc.ku.edu; David Johnson - habib@ittc.ku.edu; Adam Hock - ahock@ittc.ku.edu; Terry Clark - tclark@ittc.ku.edu; Gerald Lushington - glushington@ku.edu; Gary...

Feagan, Lance; Rohrer, Justin P.; Garrett, Alexander S.; Amthauer, Heather A.; Komp, Ed; Johnson, David; Hock, Adam; Clark, Terry; Lushington, Gerald H.; Minden, Gary J.; Frost, Victor S.



Liquefaction of H2 molecules upon exterior surfaces of carbon nanotube Sang Soo Han, Jeung Ku Kang, and Hyuck Mo Leea  

E-Print Network (OSTI)

of the Department of En- ergy: namely that hydrogen fuel cell cars require a hydrogen capacity of 6.5 wt % to match-range electrostatic interactions of polarized charges on the deformed CNT bundle with hydrogen molecules are observed to induce a high local-ordering of H2 gas that results in hydrogen liquefaction. Our predicted heat

Goddard III, William A.


Comparative Analysis between Grundfos CRE 15-3 Variable Speed Centrifugal Pumps and a Worthington D-824 Constant Speed Centrifugal Pump in a KU Steam Power Plant Application  

E-Print Network (OSTI)

power plant located at The University of Kansas, these two pumps must supply water to a deaerator tank and to a heat exchanger, where the deaerator tank is the tank that provides water to the boilers inside the power plant. The heat exchanger is only...

Schmidt, Fabian Philip



Decoherence of a Josephson qubit due to coupling to two-level systems Li-Chung Ku* and Clare C. Yu  

E-Print Network (OSTI)

obstacles to the implementation of Josephson junction qubits in quantum computing. Recent experiments when Josephson junction qubits are subjected to strong microwave driving. A We consider a Josephson/ f noise in the Josephson junction critical current I0. This in turn leads to fluctuations

Yu, Clare C.


IEEE TRANSACTIONS ON GEOSCIENCE AND REMOTE SENSING, VOL. 41, NO. 8, AUGUST 2003 1821 Large-Scale Inverse Ku-Band Backscatter  

E-Print Network (OSTI)

IEEE TRANSACTIONS ON GEOSCIENCE AND REMOTE SENSING, VOL. 41, NO. 8, AUGUST 2003 1821 Large influences heat exchange, fresh water exchange, and the absorption of solar radiation and is be- lieved to be a sensitive indicator of long-term climate trends [1], [2]. Consequently, the remote sensing community has

Long, David G.


Low Voltage High-SNR Pipeline Data Converters Charles Myers, Jipeng Li, Dong-Young Chang, and Un-Ku Moon  

E-Print Network (OSTI)

Low Voltage High-SNR Pipeline Data Converters Charles Myers, Jipeng Li, Dong-Young Chang, and Un pipeline data converter. This is accomplished with the removal of the S/H input stage and the use of a rail limitations. In pipeline data converters, noise reduction options such as oversampling and noise shaping

Moon, Un-Ku


National Aeronautics and Space Administration  

E-Print Network (OSTI)

as well as conducting mission operations and data analysis. The GP-B Telescope Photo Credit: GP-B Photo


Turbulent Rivers  

E-Print Network (OSTI)

es the estimate |w| ? ?w ess sup [s,s+ 1 ] | | 2|kU o | ?s+ 2kU o ?w | |dr 2 s ? r ?w ess sup [s,s+ 1 ] | | 2|kU o | ?T ?(we ?2?ikU o (T ?r) ) |ds ess sup r?[s,s+ 1 ] | 2kU o ?r

Birnir, Bjorn



Revision of the bee genus Chlerogella (Hymenoptera: Halictidae), Part III: New records and a new species from Peru  

E-Print Network (OSTI)

Museum, and Department of Ecology & Evolution- ary Biology, 1501 Crestline Drive Suite 140, University of Kansas, Lawrence, Kansas 66045, USA (msengel@ku.edu). 2 Department of Bioscience, Aarhus University, Ny Munkegade 114, Bldg. 1540, DK-8000 Aar...KU ScholarWorks | http://kuscholarworks.ku.edu Revision of the bee genus Chlerogella (Hymenoptera: Halictidae), Part III: New records and a new species from Peru by Michael Engel and Claus Rasmussen KU ScholarWorks is a service provided by the KU...

Engel, Michael S.; Rasmussen, Claus


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network Topics: J  

NLE Websites -- All DOE Office Websites (Extended Search)

kuwait malaysia jordan lebanon libyan jordan mexico poland jordan middle east jordan oil shale jordan prevalence pattern jordan river israel jordan syria tunisia jordan valley...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site



Liquid Fuels and Natural Gas in the Americas  

Annual Energy Outlook 2012 (EIA)

Spain Sweden Switzerland Turkey United Kingdom Middle East Bahrain Iran Iraq Israel Jordan Kuwait Lebanon Oman Palestinian Territories Qatar Saudi Arabia Syria United Arab...


--No Title--  

Gasoline and Diesel Fuel Update (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...


Middle East & North Africa  

U.S. Energy Information Administration (EIA) Indexed Site

Eastern Mediterranean brief Iran brief | data Iraq brief | data Israel notes & data Jordan notes & data Kuwait brief | data Lebanon notes & data Oman brief | data Qatar brief |...


Increasing the Competitiveness of Small and Medium-sized Enterprises...  

Open Energy Info (EERE)

informationpublicationsedituploadsdpd-09-5.pdf Country: Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Sudan, Syria, United Arab Emirates, Yemen...


Geothermal Technologies Office: Download GETEM, August 2012 Beta  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Indonesia Irak Iran Ireland Ireland, Northern Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Latvia Lebanon Liberia Liechtenstein Lithuania...


E-Print Network 3.0 - algeria bangladesh egypt Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya Source: Capecchi, Mario R. - Department of Biology, University...


Eia.gov BETA - Data - U.S. Energy Information Administration...  

Annual Energy Outlook 2012 (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...


IEC documents | Department of Energy  

Energy Savers (EERE)

Hungary IADB Iceland IEA IFC India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Latvia Lebanon Lithuania Malaysia Mexico Moldova Mongolia...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site



E-Print Network 3.0 - algeria libya morocco Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

2011 Summary: , Algeria, Bahrain, Bangladesh, Egypt, Eritrea, Indonesia, Iran, Iraq, Jordan, Kuwait, Lebanon, Libya... , Morocco, North Korea, Oman, Pakistan, Qatar, Saudi...


Status of U.S. Nuclear Outages - U.S. Energy Information Administratio...  

Annual Energy Outlook 2012 (EIA)

Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, North Korea, South Kuwait Kyrgyzstan Laos Latvia...


Best Practices and Tools for Large-scale Deployment of Renewable...  

Open Energy Info (EERE)

informationpublicationsedituploadsdpd-09-TP3.pdf Country: Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Sudan, Syria, United Arab Emirates, Yemen...


INSAG-15 Key Practical Issues  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site



The role of aquifer storage and recovery (ASR) in sustainbility.  

E-Print Network (OSTI)

??Kuwait is an arid country situated at the head of the Arabian Gulf and its water resources can be classified into three significant types: (1) (more)

AlRukaibi, Duaij



Volunteer Day Countries Represented  

E-Print Network (OSTI)

Haiti Iran Korea Kuwait Russia Saudi Arabia Spain Taiwan Turkey Venezuela Vietnam Manners and Culture Q's warm-weather fashion, and we have a lot of warm w

Pilyugin, Sergei S.



U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. c Includes Algeria, Angola...



U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. b Includes Algeria, Angola...


International Law and the War in Iraq  

E-Print Network (OSTI)

and sanctions regime against Iraq and Kuwait); SC Res. 662 (Resolution 678, which gave Iraq until January 15, 1991, toto bring charges against Iraq for its violations of

Yoo, John C.


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

No data reported. W Withheld to avoid disclosure of individual company data. 1 Includes Bahrain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates....


--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

to avoid disclosure of individual company data. 3 Free on Board. See Glossary. 1 Includes Bahrain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates....



U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...


Costs of Imported Crude Oil by Selected Country  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...


Table 25. Landed Costs of Imported Crude Oil by Selected Country  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...



U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. b Includes Algeria,...



U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...


--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. 1 Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. 2 Includes Algeria,...



U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...



U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. c Includes Algeria,...



U.S. Energy Information Administration (EIA) Indexed Site

W Withheld to avoid disclosure of individual company data. a Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. b Includes...



U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...



U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. a Free on Board. See Glossary. b Includes Baharain, Iran, Iraq, Kuwait, Neutral Zone, Qatar, Saudi Arabia, and United Arab Emirates. c Includes...


--No Title--  

U.S. Energy Information Administration (EIA) Indexed Site

of individual company data. (1) Free on Board. See Glossary. (2) Includes Bahrain, Iran, Iraq, Kuwait, Qatar, Saudi Arabia, and United Arab Emirates. (3) Includes Algeria,...


E-Print Network 3.0 - agroforest sulawesi indonesia Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

- Aceh, Papua, Central Sulawesi, Maluku Kenya Kuwait Liberia Myanmar (former Burma) Nepal Nigeria... Former USSR - Azerbaijan Kyrgystan Tajikistan Turkmenistan Guatemala Guyana...


Strengthening the Nigerian Sovereign Investment Authority: A Policy Analysis of the Nigerian Excess Crude Account and the Nigerian Sovereign Investment Authority Act  

E-Print Network (OSTI)

Gas Russia National Welfare Pension Fund Reserve Oil QatarQatar Investment Savings Authority Oil Investmentoil prices of that time period, Norway, Qatar and Kuwait had

Ugwuibe, Cynthia



The basis for cooperation in the Gulf Region: an assessment of the Gulf Cooperation Council.  

E-Print Network (OSTI)

??The Gulf Cooperation Council (GCC), a regional alliance grouping the six oil- and gas-rich Arabian states of Saudi Arabia, Kuwait, the United Arab Emirates, Qatar, (more)

Al-Zamat, Khalid Hamed S.



Oil revenue of the Arabian gulf Emirates: patterns of allocation and impact on economic development.  

E-Print Network (OSTI)

??The study aims to analyse the oil revenue, its allocational pattern and impact on economic development in Kuwait, Bahrain, Qatar and the UAE from the (more)

Al-Kuwari, Ali Khalifa



Role of the Ectodomain of the gp41 Transmembrane Envelope Protein of Human Immunodeficiency Virus Type 1 in Late Steps of the Membrane Fusion Process  

Science Journals Connector (OSTI)

...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...human immunodeficiency virus type 1 to fusion inhibitors targeted to the...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...

Sverine Br; Marc Alizon



A Plant Homolog of the Neutrophil NADPH Oxidase gp91phox Subunit Gene Encodes a Plasma Membrane Protein with Ca2+ Binding Motifs  

Science Journals Connector (OSTI)

...16-hr-light/8-hr-dark cycle or in continuous...reaction (PCR) cycles, respectively...mCi/L Amersham Life Science, Arlington...the protein blot analysis of this fraction...R.W. Rain-, wind-, and touch-induced...M. Segal A.W. Analysis of glycosylation...

Thomas Keller; Howard G. Damude; Dietrich Werner; Peter Doerner; Richard A. Dixon; Chris Lamb

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Topological Analysis of HIV-1 Glycoproteins Expressed In Situ on Virus Surfaces Reveals Tighter Packing but Greater Conformational Flexibility than for Soluble gp120  

Science Journals Connector (OSTI)

...Li, Y , S O'Dell, R Wilson, X Wu, SD Schmidt...Roederer, M Connors, JR Mascola, and RT Wyatt...Zhang, SA Migueles, R Wyatt, BF Haynes, PD Kwong, JR Mascola, and M Connors...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...

Tommy Tong; Keiko Osawa; James E. Robinson; Ema T. Crooks; James M. Binley



HIV gp120 H375 Is Unique to HIV-1 Subtype CRF01_AE and Confers Strong Resistance to the Entry Inhibitor BMS-599793, a Candidate Microbicide Drug  

Science Journals Connector (OSTI)

...in silico docking simulations and assisted in...benchmarks for molecular simulation. Comp. Phys...et al. 1995. Rapid turnover of plasma...high accuracy in automated protein docking...silico drug docking simulations identified a drug...serve as a means for rapid identification of...

Susan M. Schader; Susan P. Colby-Germinario; Peter K. Quashie; Maureen Oliveira; Ruxandra-Ilinca Ibanescu; Daniela Moisi; Thibault Mesplde; Mark A. Wainberg



Detection of growth sites in and protomer pools for the sheath of Methanospirillum hungatei GP1 by use of constituent organosulfur and immunogold labeling.  

Science Journals Connector (OSTI)

...the Hg-hoops was evident (data not shown). In negative stains...alterations of the hoops (data not shown). The concentration...Research Council of Canada infrastructure grant. Advice from G. D...Immunoglobulin produc- ing hybrid cell lines, p. 351-371...

G Southam; T J Beveridge



miR200c Attenuates P-gpMediated MDR and Metastasis by Targeting JNK2/c-Jun Signaling Pathway in Colorectal Cancer  

Science Journals Connector (OSTI)

...encoded by the ABCB1 gene and the most characterized member of energy-dependent drug efflux pumps involved in MDR, recently has...Table S7. Quantitative RT-PCR was carried out using SYBR Green PCR Master Mix (Life Technologies). The PCR conditions were...

Hua Sui; Guo-Xiang Cai; Shu-Fang Pan; Wan-Li Deng; Yu-Wei Wang; Zhe-Sheng Chen; San-Jun Cai; Hui-Rong Zhu; and Qi Li



Clinical Evaluation of a GP5+/6+-Based Luminex Assay Having Full High-Risk Human Papillomavirus Genotyping Capability and an Internal Control  

Science Journals Connector (OSTI)

...LMNX using a sample panel and infrastructure provided by the international...HPV66 (class 2B) (1). The Hybrid Capture 2 (HC2; Qiagen...comparison of an automated hybrid capture 2 assay and the consensus...against the performance of hybrid capture 2 for the purpose of...

D. T. Geraets; K. Cuschieri; M. N. C. de Koning; L. J. van Doorn; P. J. F. Snijders; C. J. L. M. Meijer; W. G. V. Quint; M. Arbyn



Cross-Sectional Comparison of an Automated Hybrid Capture 2 Assay and the Consensus GP5+/6+ PCR Method in a Population-Based Cervical Screening Program  

Science Journals Connector (OSTI)

...requires special skills and a more stringent infrastructure to reduce PCR-related contamination...2002. Restricted cross-reactivity of hybrid capture 2 with nononcogenic human papillomavirus...Schiffman, and C. M. Wheeler. 2004. Hybrid capture 2 viral load and the 2-year...

A. T. Hesselink; N. W. J. Bulkmans; J. Berkhof; A. T. Lorincz; C. J. L. M. Meijer; P. J. F. Snijders



Mascle, J., Lohmann, G.P., and Moullade, M. (Eds.), 1998 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 159  

E-Print Network (OSTI)

basins. Warm surface water flows to the west in the South Equatorial Current system, which piles warm water against Brazil and removes it from the West Afri- can Bight, allowing cold subsurface waters over the western basins (Hay and Brock, 1992; Hisard and Merle, 1980; Peterson and Stramma, 1991


' '& ('0)1"2$3 46587@9BACACDFEHGPIRQS7UTWVYX`AaSbdcefEHGhgpiRGPD!qhrhrhq'st70GPTuA`58A`GP9BA  

E-Print Network (OSTI)

This volume contains the research papers presented at the XML Finland 2002 conference in Helsinki, Finland, October 21-22, 2002 ­ the seventh annual conference organized by the XML Finland Association. The themes before. After the previous XML Finland conference in 2001, the feedback from the XML Finland Association

Hyvönen, Eero


Cholesterol-Dependent Membrane Fusion Induced by the gp41 Membrane-Proximal External RegionTransmembrane Domain Connection Suggests a Mechanism for Broad HIV-1 Neutralization  

Science Journals Connector (OSTI)

...monitored using the resonance energy transfer assay described...pCMV8.91, encoding a green fluorescent protein and...2 (blue), 5 (green), or 10 (orange...the associated elastic energy would relax in the course...1981. Use of resonance energy transfer to monitor membrane...

Beatriz Apellniz; Edurne Rujas; Pablo Carravilla; Jos Requejo-Isidro; Nerea Huarte; Carmen Domene; Jos L. Nieva



Access of Antibody Molecules to the Conserved Coreceptor Binding Site on Glycoprotein gp120 Is Sterically Restricted on Primary Human Immunodeficiency Virus Type 1  

Science Journals Connector (OSTI)

...determined by enzyme-linked immunosorbent assay (ELISA) with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, N.Y.) and purified by affinity chromatography with protein A (Pharmacia, Uppsala...

Aran F. Labrijn; Pascal Poignard; Aarti Raja; Michael B. Zwick; Karla Delgado; Michael Franti; James Binley; Veronique Vivona; Christoph Grundner; Chih-Chin Huang; Miro Venturi; Christos J. Petropoulos; Terri Wrin; Dimiter S. Dimitrov; James Robinson; Peter D. Kwong; Richard T. Wyatt; Joseph Sodroski; Dennis R. Burton



Predicting PVT data for CO2brine mixtures for black-oil simulation of CO2 geological storage  

E-Print Network (OSTI)

trapping mechanism. In the petroleum industry, compositional reservoir simu- lators use EOS thermodynamic Leonenko a a Department of Chemical and Petroleum Engineering, University of Calgary, Canada b Department of Petroleum Engineering, Kuwait University, Kuwait 1. Introduction The sequestration of anthropogenic CO2

Santos, Juan


Research Article Evaluation of changes in the Kuwaiti prawn fishery  

E-Print Network (OSTI)

. Introduction Iraq invaded Kuwait in 1990. The Iraqis released 6­8 million barrels of crude oil into the Arabian and 500 km of coastline were covered by oil (Al-Yamani et al., 1993). The Iraqis also set 604 of Kuwait's oil wells on fire (Al-Awadi, 1992). The oil well fires lasted for eight months, and the conse- quent

Chen, Yong


Record Alewife Harvest Hikes U.S. Great Lakes Commercial Fish Catch 16 Percent  

E-Print Network (OSTI)

School Set for Persian Gulf Kuwait, Saudi Arabia, Qatar, the United Arab Emirates, and Iran signed a draft agreement on 17 June 1975 in Kuwait to establish a Persian Gulf Regional Center to train captains, and mechanics. Training courses will be in English and Arabic. The Persian Gulf Regional



E-Print Network (OSTI)

a finite-energy signal, and ^f is the signal frequency content. If the signal frequency content ^f vanishes, Kuwait University P.O. Box 5969, Safat 13060, Kuwait. Abstract. Finite-energy high frequency signals the bandwidth of the signal. Conversely, if the signal frequency content ^f vanishes a.e. on a band

Tuan, Vu



E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook Fundamentals Of Oral Com 3 SP 176 Public Speaking 3 #12;Colby Community College Liberal Arts Majors Updated


Barton Community College Transfer Program to the University of Kansas  

E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook FUNDAMENTALS OF DEBATE 3 COMM 1212 FUNDAMENTALS OF DEBATE 3 HWC 204 WESTERN CIVILIZATION I 3 HIST 1409 HIST



E-Print Network (OSTI)

below tables. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook COMM 207 Fundamentals Of Speech 3 Goal 3: Breadth of Knowledge (3 Units) -one from each category Arts



E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook To Literature: Poetry 3 ENGL 211 Intro to Drama 3 ENG 2213 Intro To Literature: Drama 3 COMS 230 Fundamentals


In Vivo Role of Phosphorylation of Cryptochrome 2 in the Mouse Circadian Clock  

Science Journals Connector (OSTI)

...u-tokyo.ac.jp . a Department of Biological Sciences, Graduate School of Science, The University of Tokyo, Bunkyo-ku, Tokyo...Genetics Research Laboratory, Graduate School of Science, The University of Tokyo, Bunkyo-ku, Tokyo...

Arisa Hirano; Nobuhiro Kurabayashi; Tomoki Nakagawa; Go Shioi; Takeshi Todo; Tsuyoshi Hirota; Yoshitaka Fukada



Dreaming with One Eye Open: The State of the University Libraries, 1996-1997. A Report to the University Community  

E-Print Network (OSTI)

This report from highlights the KU Libraries' recent principal accomplishments and describes challenges in four areas of vital interest to KU's academic programs. Those areas are: the health of collections; the adequacy ...

Crowe, William J.


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Culture and History Matter: Russia's Search for Identity after the Fall  

E-Print Network (OSTI)

Maria Carlson, professor and associate chair of Slavic Languages and Literatures at KU, presented the lecture Culture and History Matter: Russias Search for Identity After the Fall as the 2007 KU faculty speaker in the Hall Center Humanities...

Carlson, Maria



Abstract 5301: Integrated array CGH and expression profiling revealed candidate biomarkers in gastrointestinal stromal tumors.  

Science Journals Connector (OSTI)

...Presence of meningioma stroma mesenchymal stem-like cells. Eui Hyun Kim Seok Ku Kang Yonsei University College of Medicine...be a source of meningioma microenvironment. Citation Format: Eui Hyun Kim, Seok Ku Kang. Presence of meningioma stroma mesenchymal...

Guhyun Kang; Eui Jin Lee; Shin Woo Kang; Kee-Taek Jang; Jeeyun Lee; Joon Oh Park; Cheol Keun Park; Tae Sung Sohn; Sung Kim; In-Gu Do; Kyoung-Mee Kim; Christopher L. Corless



Induction of apoptosis by extracelluar organic metabolite isolated from actinomycete Streptomyces sp. BIT-64 in human leukemia cells  

Science Journals Connector (OSTI)

...Presence of meningioma stroma mesenchymal stem-like cells. Eui Hyun Kim Seok Ku Kang Yonsei University College of Medicine...be a source of meningioma microenvironment. Citation Format: Eui Hyun Kim, Seok Ku Kang. Presence of meningioma stroma mesenchymal...

Yung Hyun Choi; Min Ho Han; Cheng-Yun Park; Gi-Young Kim; Byung Tae Choi; Won Ho Lee; Seong-Yun Jeong



Response of ?-Irradiated Mouse Salivary Gland Cells to a Proliferative Stimulus  

Science Journals Connector (OSTI)

...Takehito Sasaki Takeo Nogami Department of Radiology, Tokyo Medical and Dental University, School of Dentistry, Bunkyo-ku...Takehito Sasaki and Takeo Nogami Department of Radiology, Tokyo Medical and Dental University, School of Dentistry, Bunkyo-ku...

Takehito Sasaki and Takeo Nogami



26AUTUMN 2014 Kyoto University Newsletter  

E-Print Network (OSTI)

International Offices: The European Center in Heidelberg and the ASEAN Center in Bangkok World-renowned KU

Takada, Shoji


Two-dimensional numerical simulation of radio frequency sputter amorphous InGaZnO thin-film transistors  

E-Print Network (OSTI)

-30-2 Shimomaruko, Ohta-ku, Tokyo 146-8501, Japan 3 Silvaco International, Santa Clara, California 95054, USA

Kanicki, Jerzy



E-Print Network (OSTI)

, Yooseong-ku, Daejeon, 305-348, Korea 3 Plasma Physics Laboratory, Princeton University, Princeton, NJ 08543


Open Access and Responsible Research: Preparing Future Faculty at the University of Kansas  

E-Print Network (OSTI)

The University of Kansas (KU) is planning for open access to ETDs in its institutional repository, KU ScholarWorks. The KU Libraries are working to educate graduate students about copyright, fair use, and open access to research as part of its...

Mercer, Holly



Effects of pacing site on global and regional left ventricular function in the setting of dyssynchronous heart failure  

E-Print Network (OSTI)

Tachampa K, Ait Mou Y, Farman GP, and Irving TC. MyofilamentTachampa K, Ait Mou Y, Farman GP, and Irving TC. Myofilament

Howard, Elliot Jacob



FT-ICR STUDIES OF METAL-CARBON BINARY CLUSTERS, MASAMICHI KOHNO (Eng. Res. Inst., Univ. Tokyo, Bunkyo-ku, Tokyo 113-8656), SHUHEI INOUE (Dept. Mech. Eng., Univ.  

E-Print Network (OSTI)

, no pure carbon clusters were observed, whereas pure carbon clusters with almost the same intensity of MCn encapsulated inside. 50 60 70 Number of Carbon Atoms [Cm + ] Intensity(arb.units) (b) La:0.8% (a) Sc:0.8% LaAbstract FT-ICR STUDIES OF METAL-CARBON BINARY CLUSTERS, MASAMICHI KOHNO (Eng. Res. Inst., Univ

Maruyama, Shigeo


Asymptotic expansions of the regular solutions to the 3D Navier-Stokes equations and applications to the analysis of the helicity  

E-Print Network (OSTI)

, there exists a unique solution u(?) to (2.38) and (2.39) in the domain D def [ t?0 f? = ? + i? ; ? > t;j?j ? ?t(?)g; (3.6) where ?t(?) = c(? ? t)e?(?+t) for ? = 18 and c = 14p2(2c 0)1=4ku0k : (3.7) Moreover, ku(?)k ? ku0k for all ? 2 D: (3.8) Proof. For t0 ? 0... for all t ? t0; (3.17) where currency1 = 1=2 and M = ku0k2 0; t ? t0; cos ? ? ku(t)kc 1 g: (3...

Hoang, Luan Thach



Kuwaiti oil sector shows more signs of recovery  

SciTech Connect

This paper reports that Kuwait's oil sector continues to show signs of recovery from the Persian Gulf war. On Mar. 23 Kuwait Petroleum Co. (KPC) loaded the country's first shipment of liquefied petroleum gas for export since the Iraqi invasion in August 1990. In addition, the first shipment of Kuwaiti crude recovered from giant oil lakes formed by hundreds of wild wells sabotaged in the war was to arrive by tanker in Naples, Italy, late last month. The tanker is carrying 210,000 bbl of crude. However, the project to clean up the lakes and recover more oil, undertaken by Bechtel Corp. with Kuwait Oil Co. (KOC), has reached a stand still.

Not Available



Oil/gas separator for installation at burning wells  

SciTech Connect

An oil/gas separator is disclosed that can be utilized to return the burning wells in Kuwait to production. Advantageously, a crane is used to install the separator at a safe distance from the well. The gas from the well is burned off at the site, and the oil is immediately pumped into Kuwait`s oil gathering system. Diverters inside the separator prevent the oil jet coming out of the well from reaching the top vents where the gas is burned. The oil falls back down, and is pumped from an annular oil catcher at the bottom of the separator, or from the concrete cellar surrounding the well.

Alonso, C.T.; Bender, D.A.; Bowman, B.R. [and others



Robustness of the detection probability for the sign detector  

E-Print Network (OSTI)

). . . theta(151)]; a~1, 1); gp 1 o vera=gammaprime(1/a); gp3 overs=gammaprime(3/a); [dfda, dsdaterm, dadthta(1, 1)] ~t(a, k, fo, gp 1 overs, gp3overa); dfdahtt~umint(a, k, dfda); dpda(1, 1)=dsdaterm+dfdaint; dbdp(1, 1)~dp(a, k, fo); a~(1, 2); gp 1 overs...=gammaprime(1/a); gp3overa=gammaprinx;(3/a); [dfda, dsdaterm, dadthta(1, 2)]=faint(a, k, fo, gp 1 o vera, gp3o vera); dfdaint~umint(a, k, dfda); dpda(1, 2)=dsdaterrn+dfdaint; dbdp(1, 2)=findp(age, fo); a~(1, 31); gp 1 overs=gammaprime(1/a); gp3o vera...

Huse, Elizabeth Ann



105(scaled land 215%)7-22-05  

National Nuclear Security Administration (NNSA)

Guatemala Honduras Hungary India Indonesia Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kuwait Kyrgyzstan Laos Latvia Lebanon C A N A D A U N I T E D S T A T...


E-Print Network 3.0 - arabia syrian arab Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Saudi-Arabia 162 Japan 69 Taiwan 59 Hong-Kong 31 Kuwait 29 Malaysia 28... Thailand 12 Jordan 11 Colombia 10 Iraq 10 Mexico 10 Nigeria 10 Sri-Lanka 10 Libyan-Arab-Jamahiriya 9...


E-Print Network 3.0 - arab jamahirya malaysia Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Saudi-Arabia 162 Japan 69 Taiwan 59 Hong-Kong 31 Kuwait 29 Malaysia 28... Thailand 12 Jordan 11 Colombia 10 Iraq 10 Mexico 10 Nigeria 10 Sri-Lanka 10 Libyan-Arab-Jamahiriya 9......


Improving the Water Efficiency of Cooling Production System  

E-Print Network (OSTI)

For most of the time, cooling towers (CTs) of cooling systems operate under partial load conditions and by regulating the air circulation with a variable frequency drive (VFD), significant reduction in the fan power can be achieved. In Kuwait...

Maheshwari, G.; Al-Hadban, Y.; Al-Taqi, H. H.; Alasseri, R.



Cooling Tower Operation in the Hot and Humid Climates of Arid Zones  

E-Print Network (OSTI)

the performance of the A/C system, increases the fan power and water consumption. The latter is of special concern to Kuwait and other countries in the region where the soft water is produced through seawater desalination....

Al-Bassam, E.; Maheshwari, G. P.; Sebzali, M.



Fact #664: February 28, 2011 2010 U.S. Petroleum Imports by Country...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

366 Iraq 429 Mexico 1,263 Kuwait 207 Netherlands 117 Libya 76 Norway 97 Nigeria 1,037 Russia 626 Saudi Arabia 1,090 U.S. Virgin Islands 263 Venezuela 998 United Kingdom 265 Other...

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Applications of COSMIC to Meteorology and Climate Richard A. Anthes  

E-Print Network (OSTI)

the response of the global atmosphere to regional events such as volcanic eruptions, the Kuwait oil fires and physical adjustment mechanisms, the wind fields as well. These improved analyses and forecasts will provide


THE HUMAN ANIMAL Unlearning what nature  

E-Print Network (OSTI)

on the Iraqi border in 1991 precisely because Kuwait had oil that Iraq coveted. But knowing that war common triggers are the desires or needs for territory, resources, or mates. Ants are a well

Starks, Philip


9 0 A S T R O N O M Y N O W / J U N 2 0 0 2 he current debate over missile defence  

E-Print Network (OSTI)

Saddam Hussein, who set fire to the oil wells in Kuwait and caused an environmental disaster hazardous for peaceful as well as military purposes. Every bit of debris in orbit higher than about 800 km

California at Santa Cruz, University of


Glenda Romn Geographic Mapping Technologies, Corp.  

E-Print Network (OSTI)

California Solar Energy Potential Washington Tropical Cyclones National Hurricane Center Weather Monitoring U Conservation Social Conflicts Energy Education Agriculture Economic Recovery Pollution Water Resources & Pipelines Mexico Oil & Gas Leases Gulf of Mexico Well Production Canada Petroleum Resources Kuwait Forest

Gilbes, Fernando


Uranium extremophily is an adaptive, rather than intrinsic, feature for extremely thermoacidophilic Metallosphaera species  

Science Journals Connector (OSTI)

...2005 ) Oxidation states of uranium in depleted uranium particles from Kuwait . J Environ...HDTR-09-0300 and National Institutes of Health Grant R01 GM090209-01. The...Supporting Information (PDF) Uranium extremophily is an adaptive...

Arpan Mukherjee; Garrett H. Wheaton; Paul H. Blum; Robert M. Kelly



An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...geochemical studies of Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of...Middle East models of Jurassic/Cretaceous carbonate systems. SEPM...Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau


An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of Petroleum...Mauddud Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...examples from Abu Dhabi and the Amu Darya Basin. Marine and Petroleum Geology...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau


Importance of Design Conditions for Sizing Air-Conditioning Plant  

E-Print Network (OSTI)

Design conditions based on the meteorological data collected at two weather stations located less than 10 km away from each other within Kuwait City are presented for dry-bulb temperature (DBT) and web-bulb temperature (WBT) prioritization...

Shaban, N.; Maheshwari, G. P.; Suri, R. K.




E-Print Network (OSTI)

): Bahrain, Kuwait, Oman, Qatar, Saudi Arabia, and the United Arab Emirates (UAE), using three robust and highly regarded nonlinearity tests. In addition, the Efficient Market Hypothesis (EMH) was tested in this dissertation for the GCC stock markets using...

Alharbi, Abdullah M. H.



Positive pressure induced channeled suction cups  

E-Print Network (OSTI)

Leaking in water pipe is a critical issue in Middle Eastern countries such as Kuwait where water is scarce. In-pipe robots can be dispatched to discover the network and inspect the inner surface of the pipe. This thesis ...

Yang, Shannon X. (Shannon Xuan)




Gasoline and Diesel Fuel Update (EIA)

II-Imports of Crude Oil and Petroleum Products by Country of Origin, a January 1998 Arab OPEC ... 6,219 0 0 0 0 0 0 0 0 0 Kuwait...


Oil and gas developments in Middle East in 1983  

SciTech Connect

Petroleum production in Middle East countries during 1983 totaled 4,275,054,000 bbl (an average rate of 11,712,476 BOPD), down 3.7% from the revised total of 4,440,841,000 bbl produced in 1982. Iran, Kuwait, the Kuwait-Saudi Arabia Divided Neutral Zone, and Oman had significant increases. Saudi Arabia, Qatar, and Abu Dhabi had significant decreases. 8 figures, 9 tables.

Hemer, D.O.; Pickford, P.J.



Middle Cretaceous (Cenomanian Ostracoda from the Wasia Formation of Saudi Arabia  

E-Print Network (OSTI)

producers of oil in of wells from which ostracodes were recovered. Fig. 1. Location 38 39 2 The University of Kansas Paleontological ContributionsPaper 108 Bahrain, Kuwait, and Iraq. (For more strat- igraphic details see Powers and other, 1966; Powers... producers of oil in of wells from which ostracodes were recovered. Fig. 1. Location 38 39 2 The University of Kansas Paleontological ContributionsPaper 108 Bahrain, Kuwait, and Iraq. (For more strat- igraphic details see Powers and other, 1966; Powers...

Al-Furiah, A. A. F.



Technical and Energy Assessment of Building Integrated Photovoltaic Systems applied to the UAE Office Buildings  

E-Print Network (OSTI)

-33586 Page 936. Available at: http://www.nrel.gov/docs/fy03osti/35645.pdf . ESL-IC-10-10-40 Proceedings of the Tenth International Conference for Enhanced Building Operations, Kuwait, October 26-28, 2010 ... of the Tenth International Conference for Enhanced Building Operations, Kuwait, October 26-28, 2010 References [1] Abu Dhabi Water & Electricity Company (ADWEC). 2009. See: http://www.adwec.ae/maps_graphs/ [2] Kumar K, Sharma SD, Jain L, 2007. Stand...

Radhi, H.



First mideast capacity planned  

SciTech Connect

Kuwait catalyst Co.`s (KCC) plans to build a hydrodesulfurization (HDS) catalysts plant in Kuwait will mark the startup of the first refining catalysts production in the Persian Gulf region. KCC, owned by a conglomerate of Kuwait companies and governmental agencies, has licensed catalyst manufacturing technology from Japan Energy in a deal estimated at more than 7 billion ($62 million). Plant design will be based on technology from Orient Catalyst, Japan Energy`s catalysts division. Construction is expected to begin in January 1997 for production startup by January 1998. A source close to the deal says the new plant will eventually reach a capacity of 5,000 m.t./year of HDS catalysts to supply most of Kuwait`s estimated 3,500-m.t./year demand, driven primarily by Kuwait National Petroleum refineries. KCC also expects to supply demand from other catalyst consumers in the region. Alumina supply will be acquired on the open market. KCC will take all production from the plant and will be responsible for marketing.

Fattah, H.



N-Substituted Pyrrole Derivatives as Novel Human Immunodeficiency Virus Type 1 Entry Inhibitors That Interfere with the gp41 Six-Helix Bundle Formation and Block Virus Fusion  

Science Journals Connector (OSTI)

...approved peptidic human immunodeficiency virus type 1 (HIV-1) fusion inhibitor, T-20 (Fuzeon; Trimeris Inc...NB-2 and NB-64 on HIV-1-mediated cell-cell fusion Fusion type Mean inhibitory activity SD a of: NB-2 NB-64...

Shibo Jiang; Hong Lu; Shuwen Liu; Qian Zhao; Yuxian He; Asim K. Debnath



A Novel Human Cytomegalovirus Glycoprotein, gpUS9, Which Promotes Cell-to-Cell Spread in Polarized Epithelial Cells, Colocalizes with the Cytoskeletal Proteins E-Cadherin and F-Actin  

Science Journals Connector (OSTI)

...solubility. Immunofluorescence laser scanning confocal microscopy...of human fibroblasts (HF) in culture (reviewed...ARPE-19) cells by fusion of the virion envelope...Immunofluorescence laser scanning confocal microscopy...cultures of nonpolarized HF (, , ). Since a substantial...

Ekaterina Maidji; Sharof Tugizov; Gerardo Abenes; Thomas Jones; Lenore Pereira



Antibodies with High Avidity to the gp120 Envelope Protein in Protection from Simian Immunodeficiency Virus SIVmac251 Acquisition in an Immunization Regimen That Mimics the RV-144 Thai Trial  

Science Journals Connector (OSTI)

...Winkelstein, W, Jr , DM Lyman, N Padian, R Grant, M Samuel...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...Li, M , F Gao, JR Mascola, L Stamatatos...E Martinelli, JP McNally, DJ Goode, R Gopaul, J Hiatt...

Poonam Pegu; Monica Vaccari; Shari Gordon; Brandon F. Keele; Melvin Doster; Yongjun Guan; Guido Ferrari; Ranajit Pal; Maria Grazia Ferrari; Stephen Whitney; Lauren Hudacik; Erik Billings; Mangala Rao; David Montefiori; Georgia Tomaras; S. Munir Alam; Claudio Fenizia; Jeffrey D. Lifson; Donald Stablein; Jim Tartaglia; Nelson Michael; Jerome Kim; David Venzon; Genoveffa Franchini


The Cytotoxic T-Lymphocyte Response against a Poorly Immunogenic Mammary Adenocarcinoma Is Focused on a Single Immunodominant Class I Epitope Derived from the gp70 Env Product of an Endogenous Retrovirus  

Science Journals Connector (OSTI)

...Kikutani H., Dranoff G., Noelle R. J., Barth R. J., Jr. Protective immunity induced by...H., Pasternack G., Cotter R., Hunt D., Pardoll D. M...Balmain A., Hickman J. A., McNally N. J., Rohas A. M., Mitchison...

Antonio Rosato; Silvia Dalla Santa; Alessia Zoso; Sofia Giacomelli; Gabriella Milan; Beatrice Macino; Valeria Tosello; Paolo Dellabona; Pier-Luigi Lollini; Carla De Giovanni; and Paola Zanovello



The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...leads to a higher viral susceptibility to plasma antibodies (11). Griffithsin (Grft...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...as a microbicide. Published ahead of print 10 June 2013 Supplemental material for...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang



An Affinity-Enhanced Neutralizing Antibody against the Membrane-Proximal External Region of Human Immunodeficiency Virus Type 1 gp41 Recognizes an Epitope between Those of 2F5 and 4E10  

Science Journals Connector (OSTI)

...highest production of IgG1 Z13e1, as determined using ELISA with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, NY) and purified by affinity chromatography with protein A (Pharmacia, Uppsala, Sweden...

Josh D. Nelson; Florence M. Brunel; Richard Jensen; Emma T. Crooks; Rosa M. F. Cardoso; Meng Wang; Ann Hessell; Ian A. Wilson; James M. Binley; Philip E. Dawson; Dennis R. Burton; Michael B. Zwick



Mesh independent convergence of modified inexact Newton methods for second order nonlinear problems  

E-Print Network (OSTI)

L2( ), Qhu in Vh is the unique function satisfying (Qhu;v) = (u;v); for all v 2 Vh: 11 Here ( ; ) is the L2{inner{product on . It is easy to see that kQhuk0 kuk0 and ku Qhuk0 = inf 2Vh ku k0: By Theorem B.2 and interpolation, we have ku Qhuk0...; v 2 H10 ( ) (u;v)1 = Z uv dx + Z ru rv dx: (B.3) The projection Ph satis es kPhuk1 kuk1 and ku Phuk1 = inf 2Vh ku k1: Furthermore, for 0 r ku Phuk1 Ch juj +1: (B.4) Note that the L2 projection and the elliptic projection...

Kim, Taejong



University Calendar, October 10, 2012  

E-Print Network (OSTI)

Center for the Humanities. Call (785) 864-4798. Public Event. Nerd Nite. Comanche and Other Unusual Taxidermy. 8 p.m., Pachamama's, 800 New Hampshire. Sponsored by Natural History Museum. Call (785) 864-4450. Entertainment. KU Cash Bus. 11 p...Calendar of Events from the University of Kansas From KU News Service, Office of Public Affairs | http://www.calendar.ku.edu Events for Oct. 10-20, 2012 ----------------------------------------------- 10 Wednesday Seminar. Green Tips...



Effects of tone on the three-way laryngeal distinction in Korean: An acoustic and aerodynamic comparison of the Seoul and South Kyungsang dialects  

E-Print Network (OSTI)

KU ScholarWorks | http://kuscholarworks.ku.edu Effects of tone on the three-way laryngeal distinction in Korean: An acoustic and aerodynamic comparison of the Seoul and South Kyungsang dialects by Hyunjung Lee and Allard Jongman KU Scholar... below. Lee, H., and Jongman, A. (2012). Effects of tone on the three-way laryngeal distinction in Korean: An acoustic and aerodynamic comparison of the Seoul and South Kyungsang dialects. Journal of the International Phonetic Association 42, 145...

Lee, Hyunjung; Jongman, Allard



Arthur Kopit: Inveterate Analyst of Frail Human Minds  

E-Print Network (OSTI)

and his family, as well as press clippings, memorabilia and books. http://kuscholarworks.ku.edu Presented at the William Inge Theater Festival. Arthur Kopit: Inveterate Analyst of Frail Human Minds By Jeff Loomis Presented at the William...KU ScholarWorks | The Inge Digital Collection Arthur Kopit: Inveterate Analyst of Frail Human Minds March 29, 2014 by Jeff Loomis The Inge Digital collection in KU ScholarWorks contains scholarly conference papers presented at the annual...

Loomis, Jeff



Anschutz Library receives plaque recognizing outstanding efforts in energy conservation and sustainability  

E-Print Network (OSTI)

to recognize outstanding efforts in energy conservation and sustainability. Building operations manager Robert Szabo and Libraries sustainability ambassador Amalia Monroe will accept on behalf of KU Libraries. The presentation will take place at 10 am in Watson...12/5/13 Anschutz Library recognized for outstanding efforts in conservation and sustainability www.lib.ku.edu/news/anschutz.conservation.plaque.shtml 1/1 Contact Us KU Libraries Lawrence, Kansas 66045 (785) 864-8983 AT THE CROSSROADS OF PEOPLE...



Gasoline Engine Economy as Affected by the Time of Ignition  

E-Print Network (OSTI)

KU ScholarWorks | The University of Kansas Pre-1923 Dissertations and Theses Collection Gasoline Engine Economy as Affected by the Time of Ignition 1907 by George Jay Hopkins This work was digitized by the Scholarly Communications program staff... in the KU Libraries Center for Digital Scholarship. http://kuscholarworks.ku.edu Submitted to the University of Kansas in partial fulfillment of the requirements for the Degree of Bachelor of Science GASOLINE ENCUNE ECONOMY as Affected W the Time...

Hopkins, George Jay



Task Force on Digital Directions in the Humanities  

E-Print Network (OSTI)

partner with researchers in creating and sustaining scholarship through its development of KU ScholarWorks, Journals@KU, Luna Insight image collections, and digital publishing services. The Libraries are committed to serving KU to advance humanistic.... Libraries Isidro Rivera, Spanish and Portuguese Jon Giullian, Libraries Jonathan Perkins, EGARC Mark Reaney, Theatre Marsha Haufler, History of Art Maryemma Graham, English Nancy Baym, Communication Studies Rick McMullen, Research and Graduate...

Hanson, F. Allan; Ludwig, Deborah



E-Print Network 3.0 - active metal-based corrosion Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

rates. Activated carbon also increased the corrosion... High temperature corrosion of water wall tube in coalfired combustion gases K. akagawa('),M. i... -Ku Nagoya 459,...


Making It Easier To Be Green: A Single Case Demonstration of the Effects of Computer Defaults To Conserve Energy in a University Computer Lab  

E-Print Network (OSTI)

KU ScholarWorks | http://kuscholarworks.ku.edu Making It Easier To Be Green: A Single Case Demonstration of the Effects of Computer Defaults To Conserve Energy in a University Computer Lab by Jason M. Hirst et al. KU ScholarWorks is a service... provided by the KU Libraries Office of Scholarly Communication & Copyright. This is the published version of the article, made available with the permission of the publisher. The original published version can be found at the link below. Jason M. Hirst...

Hirst, Jason M.; Reed, Derek D.; Kaplan, Brent A.; Miller, Jonathan R.



Was Valerius Maxumus a Hack?  

E-Print Network (OSTI)

KU ScholarWorks | http://kuscholarworks.ku.edu Was Valerius Maximus a Hack? by Tara Welch KU ScholarWorks is a service provided by the KU Libraries Office of Scholarly Communication & Copyright. This is the published version of the article, made... available with the permission of the publisher. The original published version can be found at the link below. Tara Welch. (2013). Was Valerius Maximus a Hack? American Journal of Philology 134:67-82. Published version: http://www.dx.doi.org/10.1353/ajp...

Welch, Tara




Science Journals Connector (OSTI)

... Tokyo University of Fisheries, 4-5-7 Konan, Minato-ku, Tokyo 108, Japan ... thetically active radiation (PAR) that is influenced by random cloud cover and that


WOLANSKI, ERIC. Some evidence for boundary mixing near coral ...  

Science Journals Connector (OSTI)

Mar 31, 1986 ... Meguro-ku, Tokyo 153, Japan. Kitao Fujiwara2 ... Nakaku, Hiroshima 730, Japan. Keiichiro ... oxidation with ultraviolet radiation. Analyst 95:.



Open Access Week Celebration Announcement, Handouts, Poster  

E-Print Network (OSTI)

Announcement, posters, handouts with information on events hosted by KU Libraries' Center for Digital Scholarship in celebration of International Open Access Week, Oct. 18-22, 2010....

KU Libraries



Ionic-passivated FeS2 photocapacitors for energy conversion and storage  

E-Print Network (OSTI)

KU ScholarWorks | http://kuscholarworks.ku.edu Ionic-passivated FeS2 photocapicitors for energy conversion and storage by Maogang Gong et al. KU ScholarWorks is a service provided by the KU Libraries Office of Scholarly Communication & Copyright.... This is the published version of the article, made available with the permission of the publisher. The original published version can be found at the link below. Maogang Gong et al. (2013). Ionic-Passivated FeS2 Photocapacitors for Energy Conversion and Storage...

Gong, Maogang; Kirkeminde, Alec; Kumar, Nardeep; Zhao, Hui; Ren, Shenqiang



E-Print Network 3.0 - airworthiness directives pilatus Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Topic List Advanced Search Sample search results for: airworthiness directives pilatus Page: << < 1 2 3 4 5 > >> 1 DALLAS FORT WORTH aeroshortcourses.ku.eduair Summary: of The...


Gyrodynamics Corporation | Open Energy Information  

Open Energy Info (EERE)

Corporation Address: Imon Kobe Bldg 95 Edomachi Place: Chuo ku Zip: 650-0033 Region: Japan Sector: Marine and Hydrokinetic Year Founded: 2008 Phone Number: -4729 Website: http:...


Computationally efficient Gaussian Process changepoint detection and regression  

E-Print Network (OSTI)

Most existing GP regression algorithms assume a single generative model, leading to poor performance when data are nonstationary, i.e. generated from multiple switching processes. Existing methods for GP regression over ...

Grande, Robert Conlin



I-66 I-67 I-66. Identifying the neural initiation of a movement  

E-Print Network (OSTI)

of the BG. Recordings from acute brain slices demonstrate that GP neurons expressing the calcium binding loops between the GP and striatum "closed" or "open"? COSYNE 2012 83 #12;

Shenoy, Krishna V.

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Lean transformation and relocation of jet engine assembly operations  

E-Print Network (OSTI)

As part of continuing lean transformation efforts at Pratt & Whitney, the Middletown Engine Center has turned its focus on the GP7000 turbofan engine as a target for lean implementation. Projected increases in GP7000 ...

Hale, Stephen Andrew



$1,000-$9,999 --Individuals David A. Agger '87  

E-Print Network (OSTI)

'11GP Eleanor Grosz and Lawrence J. Zweifach '69 '11P M. Loraine and Ronald P. Guritzky '85 Michael M

Napier, Terrence


Animal Studies 4.1 Introduction  

E-Print Network (OSTI)

evoked potential optimization using a GP-BUCB- like algorithm is thus a necessary condition for success

Winfree, Erik


Genomic Analysis of Burkholderia And Rhodococcus equi Bacteriophages  

E-Print Network (OSTI)

Bcep1 and the other Bcep781 phages, we can conclude that BcepNY3 is part of the Bcep781 family. 27 TABLE 8. Coding regions of BcepNY3 Gene F/R Function Homology Amino Acid BcepNY3 gp01 R Hyp. conserved Similar... to Bcep1 gp2 MPLIEGKSDKSRSENIRTEVEAGKSPKQAEAI GYAVQRRAQHGADFARDCDMNLRHVMDV AKDYKR BcepNY3 gp02 R Hyp. conserved Similar to Bcep1 gp3 MAGTLTTANSTMYCTTEALFPTAQRIQGYA ADDAFDPDAVENGEYSMGIDGTLSAGFVFN EVPLTITLQADSPSLAQFEQIWMYEFQNRTKL...

Orchard II, Robert C.




E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook SOCI 101 Sociology 3 COMS 230 Fundamentals of Debate 3 COMM 120 & 121 Debate 3 PHIL 140 Intro English Composition 3 Outcome 2 GE22 COMS 130 Speaker-Audience Communication 3 COMM 101 Fundamentals



E-Print Network (OSTI)

/Painting Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook Fundamentals Of Oral Com 3 #12;Colby Community College ~ Department of Visual Art Updated August 30, 2013-2 SP



E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook ENGL 102 Critical Reading and Writing 3 ENGL 102 English 2 3 COMS 230 Fundamentals of Debate 3 SPCH 123 Precalculus Math 5 MATH 120 Precalculus 5 MATH 115 Calculus 3 MATH 121 Fundamentals Of Calculus 5 MATH 122



E-Print Network (OSTI)

. Number to call at KU for advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook Narrative Film 3 COMS 230 Fundamentals of Debate 3 SP 100 Discussion and Debate A,B & C 3 PHIL 140 Intro


Strategic Plan The School of Engineering  

E-Print Network (OSTI)

of knowledge of the field of engineering, and assist in the economic development of the state and nation; and 310-Year Strategic Plan 2003-2013 The School of Engineering at the University of Kansas KU School of Engineering 1 Eaton Hall (785) 864-2930 (voice) (785) 864-5445 (fax) sbell@ku.edu #12;Executive Summary


Division Of Labor Between Grammar And Pragmatics Concerning Anaphora  

E-Print Network (OSTI)

This paper addresses the problem of the distribution and interpretation of the Korean long-distance anaphor caki and its pronominal counterpart ku. The first part of this paper reviews previous analyses and shows that the distribution of caki and ku...

Kim, Sun-Hee



Living Rev. Solar Phys., 6, (2009), 2 http://www.livingreviews.org/lrsp-2009-2 in solar physics  

E-Print Network (OSTI)

Living Rev. Solar Phys., 6, (2009), 2 http://www.livingreviews.org/lrsp-2009-2 in solar physics L I V I N G REVIEWS Solar Surface Convection °Ake Nordlund JILA, University of Colorado, and Niels Bohr@astro.ku.dk http://www.astro.ku.dk/~aake Robert F. Stein Physics and Astronomy Department, Michigan State

Stein, Robert


Acute Adverse Effects of Radiation Therapy on HIV-positive Patients in Japan: Study of 31 Cases at Tokyo Metropolitan Komagome Hospital  

Science Journals Connector (OSTI)

......Cases at Tokyo Metropolitan Komagome Hospital Takuya Kaminuma 1 Katsuyuki Karasawa...and Infectious diseases Center Komagome Hospital, 3-18-22 Hon-komagome, Bunkyo-ku...and Infectious diseases Center Komagome Hospital, 3-18-22 Hon-komagome, Bunkyo-ku......

Takuya Kaminuma; Katsuyuki Karasawa; Nahoko Hanyu; Ta-Chen Chang; Gencho Kuga; Naoko Okano; Nobuteru Kubo; Yusuke Okuma; Yasunobu Nagata; Yoshiharu Maeda; Atsushi Ajisawa




E-Print Network (OSTI)

with similar kT e and N e values or using similar etching chemistries. 5 1.3. Plasma Chemistry?Reactive, Inert, and Inhibiting Species Previous work in the University of Kansas Plasma Research Laboratory (KU PRL or KU Plasma Research Lab) has focused...

Pathak, Bogdan Amaru



Pacific ethnomathematics: pedagogy and practices in mathematics education  

Science Journals Connector (OSTI)

......et al., 1986). Ho ku le`a is a vehicle to bridge indi- genous models of mathematics...October 2013). Ho ku le`a is a powerful vehicle to explore real-world applications...Professional develop- ment through a socio-ecological and cultural approach is necessary to......

Linda H. L. Furuto



Dose-effect Relationship of Dicentric and Ring Chromosomes in Lymphocytes of Individuals Living in the High Background Radiation Areas in China  

Science Journals Connector (OSTI)

......Inage-ku, Chiba 2638555, Japan 3 Health Research Foundation...Sakyo-ku, Kyoto 6068225, Japan 4 Labor Hygiene Institute...two members were from 8 households living in HBRA, and 17 members were from 5 households in the control area (CA......

Tao Jiang; Isamu Hayata; Chunyan Wang; Sayaka Nakai; Suyan Yao; Yongling Yuan; Lianlian Dai; Qingjie Liu; Deqing Chen; Luxin Wei; Tsutomu Sugahara



Flipping of cloned d(pCpG)n.d(pCpG)n DNA sequences from right- to left-handed helical structure by salt, Co(III), or negative supercoiling  

Science Journals Connector (OSTI)

...MATERIALS AND METHODS Plasmid Construction. The octamer d(CpGpCpGpCpGpCpG...after inactivation of ligase by heating at 650C, digested with BamHI...Spinco AnG rotor) in double-sector cells. Absorption scans at...the National Aeronautics and Space Administration. A.N. was...

L J Peck; A Nordheim; A Rich; J C Wang



Improving the Anti-HIV Potency of Different Compounds through Synergy and Covalent Linkage: Dimerization Studies of CXCL8  

E-Print Network (OSTI)

In the first part of my dissertation we focused on the development of covalently linking compounds that bind gp120 with those that bind gp41 in order to block HIV fusion. We used griffithsin or CD4M33, that both bind to gp120, covalently linked...

Kagiampakis, Ioannis



Vaccine 29 (2011) 56115622 Contents lists available at ScienceDirect  

E-Print Network (OSTI)

antiviral immunity, the RM were immunized with multimeric HIV clade C (HIV-C) gp160 and HIV Tat. SIV Gag.elsevier.com/locate/vaccine Prime­boost vaccination with heterologous live vectors encoding SIV gag and multimeric HIV-1 gp160 Replication-competent adenovirus Live oral vaccine HIV/AIDS vaccine Multimeric HIV clade C gp160 Prime

Lieberman, Judy


Comparative Analysis of Human Src-Family Kinase Substrate Specificity in Vitro  

Science Journals Connector (OSTI)

Japan Biological Informatics Consortium, TIME24 Building 10F 2-4-32 Aomi, Koto-ku, Tokyo 135-8073, Japan, Graduate School of Pharmaceutical Sciences, The University of Tokyo, Hongo, Bunkyo-ku, Tokyo 113-0033, Japan, Reverse Proteomics Research Institute, 1-9-11 Kaji, Chiyoda-ku, Tokyo 101-0044, Japan, Medical Institute of Bioregulation, Kyushu University, Maidashi, Higashi-ku, Fukuoka 812-8582, Japan, and National Institute of Advanced Industrial Science and Technology, 2-4-7 Aomi, Koto-ku, Tokyo 135-0064, Japan ... We categorize these 11 kinases into one family according to Manning et al.,(18) although some reports regard these kinases as two distinct families. ... Detection was performed using ECL-Plus and Fluor-S Multi Imager Max (Bio-Rad). ...

Hiroyuki Takeda; Yoshifumi Kawamura; Aya Miura; Masatoshi Mori; Ai Wakamatsu; Jun-ichi Yamamoto; Takao Isogai; Masaki Matsumoto; Keiichi I. Nakayama; Tohru Natsume; Nobuo Nomura; Naoki Goshima



Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

31 - 18040 of 31,917 results. 31 - 18040 of 31,917 results. Article Secretary of Energy Samuel W. Bodman Meets with U.S. Troops in Kuwait ARIFJAN, KUWAIT - U.S. Secretary of Energy Samuel Bodman and his wife Diane Bodman had dinner and conversed with Pfc. James Clark, Logistics Task Force 28, Capt. Zachary Lange, Headquarters and... http://energy.gov/articles/secretary-energy-samuel-w-bodman-meets-us-troops-kuwait Article Statement from DOE's Chief Spokesperson Andrew Beck Regarding Strategic Petroleum Reserve Oil Deliveries WASHINGTON - Today, September 11, 2008, the U.S. Department of Energy will deliver 130,000 barrels of oil from the Strategic Petroleum Reserve to Placid Oil's Port Allen refinery along a Shell... http://energy.gov/articles/statement-does-chief-spokesperson-andrew-beck-regarding-strategic-petroleum-reserve-oil

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Oil and Gas Company Oil and Gas Company Address Place Zip Website  

Open Energy Info (EERE)

Company Oil and Gas Company Address Place Zip Website Company Oil and Gas Company Address Place Zip Website Abu Dhabi National Oil Company Abu Dhabi National Oil Company Abu http www adnoc ae default aspx Al Furat Petroleum Company Al Furat Petroleum Company Damascus Syria http www afpc sy com new history htm Dolphin Energy Dolphin Energy Abu Dhabi Trade Center Building Abu Dhabi United Arab Emirates http www dolphinenergy com Public default index htm ExxonMobil ExxonMobil Las Colinas Boulevard Irving Texas http www exxonmobil com Corporate Gazprom Gazprom Nametkina St Moscow Russia http www gazprom com Gulfsands Petroleum Gulfsands Petroleum Cork Street London United Kingdom W1S LG http www gulfsands com s Home asp Kuwait Petroleum Corporation Kuwait Petroleum Corporation Safat Kuwait http www kpc com kw default aspx


Oil/gas separator for installation at burning wells  

DOE Patents (OSTI)

An oil/gas separator is disclosed that can be utilized to return the burning wells in Kuwait to production. Advantageously, a crane is used to install the separator at a safe distance from the well. The gas from the well is burned off at the site, and the oil is immediately pumped into Kuwait's oil gathering system. Diverters inside the separator prevent the oil jet coming out of the well from reaching the top vents where the gas is burned. The oil falls back down, and is pumped from an annular oil catcher at the bottom of the separator, or from the concrete cellar surrounding the well.

Alonso, C.T.; Bender, D.A.; Bowman, B.R.; Burnham, A.K.; Chesnut, D.A.; Comfort, W.J. III; Guymon, L.G.; Henning, C.D.; Pedersen, K.B.; Sefcik, J.A.; Smith, J.A.; Strauch, M.S.



Essays on Forecasting and Hedging Models in the Oil Market and Causality Analysis in the Korean Stock Market  

E-Print Network (OSTI)

(Angola), Oriente (Ecuador), Iran Heavy (Islamic Republic of Iran), Basra Light (Iraq), Kuwait Export (Kuwait), Es Sider (Libya), Bonny Light (Nigeria), Qatar Marine (Qatar), Arab Light (Saudi Arabia), Murban (UAE) and Merey (Venezuela). OPEC collects...-1 and 5-3-2, may also be utilized for crack spread margins. Especially, the 2-1-1 crack spread, signifying that two barrels of crude yield a barrel each of gasoline and heating oil, is a better description of the case of heavy crude oils like OPEC basket...

Choi, Hankyeung



Oil flow resumes in war torn onshore Neutral Zone  

SciTech Connect

Oil production has resumed in the war ravaged onshore fields of the Neutral Zone between Saudi Arabia and Kuwait 1 year after the end of Persian Gulf War. Initial production of about 40,000 b/d is expected to rise to 60,000 b/d by year end. This paper reports that prior to the January-February 1991 war to oust occupying Iraqi military forces from Kuwait, the Neutral Zone's Wafra, South Umm Gudair, and South Fuwaris onshore fields produced about 135,000 b/d.

Not Available



Oil and gas developments in Middle East in 1985  

SciTech Connect

Petroleum production in Middle East countries during 1985 totaled 3,837,580,000 bbl (an average rate of 10,513,917 BOPD), down 2.2% from the revised 1984 total of 3,924,034,000 bbl. Iran, Iraq, Dubai, Oman, and Syria had significant increases; Kuwait, Kuwait-Saudi Arabia Divided Neutral Zone, Saudi Arabia, and Qatar had significant decreases. New fields went on production in Iraq, Abu Dhabi, Oman, and Syria. In North Yemen, the first ever oil production in that country was nearing the start-up stage at year end. 9 figures, 9 tables.

Hemer, D.O.; Gohrbandt, K.H.A.




U.S. Energy Information Administration (EIA) Indexed Site

GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP118","=Part3!$D$23","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP125","=Part3!$D$16","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP127","=Part3!$D$17","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP130","=Part3!$D$21","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP138","=Part3!$D$26","Whole number: 0 - 100,000","Value must be between 0 and 100,000."


Topics In Primitive Roots  

E-Print Network (OSTI)

This monograph considers a few topics in the theory of primitive roots g(p) modulo a prime p>=2. A few estimates of the least primitive roots g(p) and the least prime primitive roots g^*(p) modulo p, a large prime, are determined. One of the estimate here seems to sharpen the Burgess estimate g(p) 0, to the smaller estimate g(p) 2. The expected order of magnitude is g(p) 1 constant. The corresponding estimates for least prime primitive roots g^*(p) are slightly higher. Anotrher topic deals with an effective lower bound #{p > x/log x for the number of primes p 1. The current results in the literature claim the lower bound #{p > x/(log x)^2, and have restrictions on the minimal number of fixed integers to three or more.

N. A. Carella



But, what about all those Little Brothers? Geofencing in the Land of the Free  

E-Print Network (OSTI)

is defined as a practice in which one entity, the master, coercively or surreptitiously monitors and exerts control over the physical location of another individual, the slave. 14 University of Kansas dobson@ku.edu Dobson, J. E., and Peter F. Fisher...@ku.edu Panopticon II 1984 George Orwell Visual vs. Digital Government vs. Individual CCTV 10 University of Kansas dobson@ku.edu + Radio Receiver allows someone else to monitor your location and instruct you in real time. + Transponder that stings or burns you...

Dobson, Jerome



PANS turbulence model: investigation of computational and physical closure issues in flow past a circular cylinder  

E-Print Network (OSTI)

p = P +pu (2.4) The cut-o can be arbitrary but the lter must commute with temporal and spatial di erentiation (Germano 1992). When the lter is applied, we get hVii = Ui and 7 hpi= P. However, this decomposition is unlike that of the statistical one... of the unresolved kinetic energy equation emerges. @ku @t +Uj @ku @xj = Pu u +Tku (2.19) This is the generalized form of the unresolved kinetic energy evolution equation with ku = 12 (Vi;Vj) where Pu = 12 (Vi;Vj) @Ui@xj . In PANS closure at the two-equation level...

Reyes, Dasia Ann



Ionophore-Based Lithium Ion Film Optode Realizing Multiple Color Variations Utilizing Digital Color Analysis  

Science Journals Connector (OSTI)

Department of Applied Chemistry, Keio University, 3-14-1 Hiyoshi, Kohoku-ku, Yokohama 223-8522, Japan, Kanagawa Academy of Science and Technology, 3-2-1 Sakado, Takatsu-ku, Kawasaki 213-0012, Japan, and Japan Society for the Promotion of Science, 1-6 Chiyoda-ku, Tokyo 102-8471, Japan ... This simple and easily handled membrane optode based on DCA is suitable for easy measurements such as visual colorimetry, which is expected to be applicable for field assays of environmental samples and clinical examinations in private households. ...

Koji Suzuki; Etsuko Hirayama; Tsunemi Sugiyama; Keiko Yasuda; Hiroaki Okabe; Daniel Citterio



Structure of the Ebola Virus Glycoprotein Bound to An Antibody From a Human Survivor  

SciTech Connect

Ebola virus (EBOV) entry requires the surface glycoprotein (GP) to initiate attachment and fusion of viral and host membranes. Here we report the crystal structure of EBOV GP in its trimeric, pre-fusion conformation (GP1+GP2) bound to a neutralizing antibody, KZ52, derived from a human survivor of the 1995 Kikwit outbreak. Three GP1 viral attachment subunits assemble to form a chalice, cradled by the GP2 fusion subunits, while a novel glycan cap and projected mucin-like domain restrict access to the conserved receptor-binding site sequestered in the chalice bowl. The glycocalyx surrounding GP is likely central to immune evasion and may explain why survivors have insignificant neutralizing antibody titres. KZ52 recognizes a protein epitope at the chalice base where it clamps several regions of the pre-fusion GP2 to the amino terminus of GP1. This structure provides a template for unraveling the mechanism of EBOV GP-mediated fusion and for future immunotherapeutic development.

Lee, J.E.; Fusco, M.L.; Hessell, A.J.; Oswald, W.B.; Burton, D.R.; Saphire, E.O.



Technical matters The practice and politics of geo-referencing  

E-Print Network (OSTI)

, Energy & Resources Group 2010 Association of American Geographers Annual Meeting #12;Laos? China Google, China, South Korea, Japan, Saudi Arabia Kuwait and other nations have been buying and leasing huge version of the 19th-century scramble for Africa."1 "A new geopolitics of hunger" 2 1. The Guardian UK, 22

Wright, Dawn Jeannine


Conceptual Framework for the Use of Fish Parasites as Bioindicators of Acute and Chronic  

E-Print Network (OSTI)

Environmental Perturbation After the 2010 Deepwater Horizon Oil Spill in the Gulf of Mexico 1Auburn University: Yucatan, Gulf of Mexico- exploratory oil well Ixtoc explodes, sinks (10.8, 5%) March 24th, 1989: Prince: Gulf of Mexico- oil tanker Megaborg fire (378, 189%) January 21st, 1991: Kuwait- Gulf War I, Iraqi

Kane, Andrew S.


Word Pro - S11  

Annual Energy Outlook 2012 (EIA)

2.825 2.650 0.360 2.420 1.553 10.140 2.820 2.300 Canada China Egypt Mexico Norway Russia United Kingdom United States Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria...


INAMO #47 GolfStaaten-Gulf countries (Artikel * 2006) Beaugrand, Claire Nationalitt und Migration in den Golfstaaten  

E-Print Network (OSTI)

started to flock first to Bahrain where oil export began as early as in 1934, then Saudi Arabia, Kuwait, published in "INAMO 47 (2006) 10-14" #12;2 issue of oil revenues' distribution, affected the forms of movement control that were opted for, as well as the types of nationality issues that derived from it

Paris-Sud XI, Université de


A Concept from a Concern: THE ARCTIC EMERGENCY  

E-Print Network (OSTI)

oil well fires in Kuwait) WHAT IS THE ISSUE? #12;0000 - 4 MANY RELEVANT AND RECENT NEWS STORIES (particularly if oil is involved) What happens in (or near) one country could well generate a response from well fill that role in several countries, not just his own (recall `Red' Adair, the Texan, who put out

Kuligowski, Bob


Transcript of Wilkerson interview Col Lawrence Wilkerson, the chief of staff to former US Secretary of State Colin  

E-Print Network (OSTI)

to sit in Kuwait until the military forces had moved into Baghdad, and then going to Baghdad and other with some oil-field fires, put Ahmed Chalabi or some other similar Iraqi in charge and leave correct in assuming that? Well in the two decision-making processes into which I had the most insight

Colquhoun, David


Drilling continues upward momentum  

SciTech Connect

This paper discusses how the drilling recovery that began during the second half of 1989 is continuing into 1990. On top of this, the Iraqi invasion of Kuwait has caused disarray in oil markets, driving up oil prices, and disrupting access to oil supplies. Potentially, this upheaval could lead to an upward spike in worldwide drilling activity.

Moritis, G.




E-Print Network (OSTI)

California shrub rhizospheres, as well as two tree-colonizing Rhizobium strains (ATCC 10320 and ATCC 35645 aromatic hydrocarbons (4) and 2,5-dichloro- benzoate (5). In Kuwait, many crop species have been shown to grow in soil containing up to 10% crude oil by weight and to cleanse the rhizosphere of the crude oil

Wood, Thomas K.


Smart Operations of Air-Conditioning and Lighting Systems in Government Buildings for Peak Power Reduction  

E-Print Network (OSTI)

During the summer 2007 smart operation strategies for air-conditioning (A/C) and lighting systems were developed and tested in a number of governmental buildings in Kuwait as one of the solutions to reduce the national peak demand for electrical...

Al-Hadban, Y.; Maheshwari, G. P.; Al-Nakib, D.; Al-Mulla, A.; Alasseri, R.

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


A study on the temporal and spatial variability of absorbing aerosols using Total Ozone Mapping Spectrometer and  

E-Print Network (OSTI)

, individual events, such as the Kuwait oil fire and Australian smoke plum, are isolated in individual higher cycle in the two data sets shows that the cycles agree very well both globally and regionally dust and biomass burning source regions, as well as dust transport. Finally, we find that large


Preliminary report on: The coastal ecosystems 10 years after the 1991 Gulf War  

E-Print Network (OSTI)

from southern Kuwait to Abu Ali Island were smothered with oil and tar, erasing most of the local plant with solutes, where well degraded oil residues are also extracted and might indicate a high degree of oilPreliminary report on: The coastal ecosystems 10 years after the 1991 Gulf War oil spill by Dr

Damm, Bodo


National Center for Atmospheric Research annual report, fiscal year 1991. Report for 1 October 1990-30 September 1991  

SciTech Connect

The National Center for Atmospheric Research (NCAR) annual report for fiscal year 1991 is presented. NCAR's projects for the period included investigations of air pollution from the oil well fires in Kuwait, a solar eclipse, thunderstorms in central Florida, the El Nino current, greenhouse processes, and upper atmosphere phenomena.

Warner, L.



Second International Conference on Sustainable Construction Materials and Technologies  

E-Print Network (OSTI)

, 2010 Ancona, Italy Sustainable Use of Resources ­ Recycling of Sewage Treatment Plant Water in Concrete trend; leading to water recycling and conservation #12;INTRODUCTION · Freshwater accounts for only 2 · The suitability of using treated wastewater for mixing concrete was evaluated in Kuwait (Al-Ghusain and Terro

Saldin, Dilano


Paintball Summer Weather  

E-Print Network (OSTI)

Highlights · Paintball · Summer Weather · Birthdays · Manners TheELIWeekly Paintball! Come out France Iraq Japan Korea Kuwait Libya Netherlands Niger Peru Qatar Saudi Arabia Spain Taiwan Thailand Turkey United States Venezuela Summer Weather Safety We've come to realize in the past that not all

Pilyugin, Sergei S.


2011 Korean Government Scholarship Program Guideline for International Students  

E-Print Network (OSTI)

, Egypt, Ethiopia, Fiji, France, Gabon, Georgia, Ghana, Greece, Guatemala, Guinea, Honduras, Hungary, Iran, Bangladesh, Democratic Republic of the Congo, Egypt, Fiji, Gabon, Greece, Guatemala, Kenya, Kuwait, Malaysia-Leste, Ecuador, El Salvador, Egypt, Ethiopia, Fiji, France, Gabon, Germany, Greece, Hungary, Iran, Jamaica

Auckland, University of


The unstable Gulf, Threats from within  

SciTech Connect

Martin offers an analysis of disputes along the borders of countries in the Persian Gulf region and a description of the religious, ethnic, and ideological tensions among the peoples. The pros and cons of various options for protecting American interests are outlined. The discussion covers Iran, Iraq, Kuwait, North and South Yemen, Oman, Soudi Arabia, U.A.E., Bahrain, and Qatar.

Martin, L.G.



York research doubles  

SciTech Connect

This article addresses the performance of independent energy company stocks for the first quarter of 1991. Some factors discussed include the successful campaign in the Persian Gulf region, anticipation of contracts for rebuilding of Kuwait, successful bidding by companies for future work and product sales, and analysts recommendation of companies as good investments.

Gadomski, C.



The Oil Market Caught between Economics and Politics: The Persian Gulf Crisis  

Science Journals Connector (OSTI)

The Gulf crisis began on the night of Wednesday 1st1990 with the invasion of Kuwait by Iraqi military forces. It ended at dawn on February 28th 1991 with U.S. President George Bushs announcement of the order f...

Alberto Cl



OPEC's Dr. Subroto examines the market after Gulf war  

SciTech Connect

This paper reports on a relatively strong oil market emerging from the Persian Gulf war according to an Opec spokesperson. Opec is expected to remain a viable force, perhaps more cohesive than before, no matter what happens to Kuwait and Iraq.

Not Available



Iraq cracks a few heads in the Gulf  

SciTech Connect

Last month Saddam Hussein charged that oil overproduction by his neighbors was costing Iraq dearly. When an OPEC meeting collapsed last week, he sent 100,000 troops to seize Kuwait, which he had accused of stealing oil. The US is scrambling to organize a Western boycott, but some analysts question just how effective such a more would be.

Bernstein, J.



Gravity of world crude barrel to rise by 1995  

SciTech Connect

This paper reports on the loss of crude exports from Iraq and Kuwait in 1990-91 and their gradual reentry into oil markets which will have a profound effect on world crude quality. Accordingly, the proportion of heavy crude in world markets will decline the next 5 years.

Not Available



Dar al-Handasah Article for the in progress Dictionnary of Transnational History, A. Iriye& P.Y  

E-Print Network (OSTI)

in oil price led to weakening in the oil states' economy. The recent trend towards liberalizationDar al-Handasah Article for the in progress Dictionnary of Transnational History, A. Iriye& P familial businesses. It grew on commissions in Kuwait and later, Saudi Arabia. There, oil was providing

Paris-Sud XI, Université de


The Genetic Structure of the Kuwaiti Population: Mitochondrial DNA Markers  

E-Print Network (OSTI)

Families Migration: .......................................................................................... 20 Oil Discovery & its Impact:....................................................................................... 22 Genetic Structure... populations of the Arabian Peninsula (Abu-Amero et al. 2008; Alshamali et al. 2009; Beyin 2006; Carter 2006; Rose 2007). The Arabian Peninsula consists of seven countries: Yemen, Saudi Arabia, United Arab Emirates, Qatar, Bahrain, Kuwait, and Jordan (Rose...

Theyab, Jasem



Metropolitan Community College (Missouri-all locations)  

E-Print Network (OSTI)

& Sciences are listed below tables. Main Campus Advising: (785) 864-3500 Website: http://www.collegesas.ku.edu/advising/Handbook Modern Western Civilization 3 COMS 230 Fundamentals of Debate 3 SPDR 110 Argumentation and Debate 3 PHIL


Induction of heat shock protein 70 (Hsp70) prevents neuregulin-induced demyelination by enhancing the proteasomal clearance of c-Jun  

E-Print Network (OSTI)

Modulating molecular chaperones is emerging as an attractive approach to treat neurodegenerative diseases associated with protein aggregation, DPN (diabetic peripheral neuropathy) and possibly, demyelinating neuropathies. KU-32 [N-(7-((2R,3R,4S,5R...

Li, Chengyuan; Ma, Jiacheng; Zhao, Huiping; Blagg, Brian S. J.; Dobrowsky, Rick T.



On powers of Stieltjes moment sequences, II Christian Berg  

E-Print Network (OSTI)

On powers of Stieltjes moment sequences, II Christian Berg Department of Mathematics, University measure µ on [0, [ such that (1) holds; Email address: berg@math.ku.dk (Christian Berg). Preprint

Berg, Christian



Science Journals Connector (OSTI)

......Kazumi MAEDA (Dept. of Ophth., Osaka Univ. Medical School, Fukushima-ku, Osaka) Folia Ophthalmologica Japonica, 16 (10...Yakuho 166 (3), 28~36 (1965) (in Japanese). Hairy aerial mycelia of certain fungi (Aspergilli and Tricophyton are difficult......




Helical nanotubes of hexagonal boron nitride  

Science Journals Connector (OSTI)

......Physical: Full-length Papers Helical nanotubes of hexagonal boron nitride Masami Terauchi...Hongo, Bunkyo-ku, Tokyo 113, Japan Nanotubes of hexagonal boron nitride (h-BN...discovered. hexagonal boron nitride,|nanotube,|nanoball,|amorphous boron| C......

Masami Terauchi; Michiyoshi Tanaka; Hirofumi Matsuda; Masatoshi Takeda; Kaoru Kimura



Improvement of Kalai-Kleitman bound for the diameter of a polyhedron  

E-Print Network (OSTI)

Nov 18, 2014 ... Graduate School of Decision Science and Technology, Tokyo Institute of Tech- nology, 2-12-1-W9-58, Oo-Okayama, Meguro-ku, Tokyo,...


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Ectopic Lignification in the Flax lignified bast fiber1 Mutant Stem Is Associated with Tissue-Specific Modifications in Gene Expression and Cell Wall Composition  

Science Journals Connector (OSTI)

...Phytotechnologie, F-80037 Amiens Cedex 1, France f Laboratory of Tree Cell Biology, Division of Forest and Biomaterials Science, Graduate School of Agriculture, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan g Department of Plant Systems Biology...

Maxime Chantreau; Antoine Portelette; Rebecca Dauwe; Shingo Kiyoto; David Crônier; Kris Morreel; Sandrine Arribat; Godfrey Neutelings; Malika Chabi; Wout Boerjan; Arata Yoshinaga; François Mesnard; Sebastien Grec; Brigitte Chabbert; Simon Hawkins



EEC funds 10 new solar energy projects  

Science Journals Connector (OSTI)

... include an award of 53,000 EUA to K.U. Leuven of Belgium for an electric car using solar energy and nine awards to solar heating projects which include block central heating ...



Schiefelbusch Hearing Clinic  

E-Print Network (OSTI)

_______ Zip_____________ E-Mail Cell Phone (____)_____________ Day Phone (____)_______________ Evening Phone to Jane Wegner by email at jwegner@ku.edu or by phone at 864-4690. Camper Information Camper Name


Mechanism Based Anticancer Drugs that Degrade Sp Transcription Factors  

E-Print Network (OSTI)

Curcumin is the active component of tumeric, and this polyphenolic compound has been extensively investigated as an anticancer drug that modulates multiple pathways and genes. We demonstrated that curcumin inhibited 253JB-V and KU7 bladder cancer...

Chadalapaka, Gayathri



Characterization of modified silica aerogel using sodium silicate precursor and its application as adsorbent of Cu2+, Cd2+, and Pb2+ ions  

Science Journals Connector (OSTI)

The N2...adsorption-desorption isotherms were measured by the BET method using nitrogen as an adsorption gas at 77?K using Belsorp Mini II instrument (BEL Japan, Inc., Sumida-ku, Tokyo, Japan). Samples were out g...

HR Pouretedal; M Kazemi



MEASUREMENT OF ION BEAM FROM LASER ION SOURCE FOR RHIC Takeshi Kanesue, Kyushu University, Fukuoka 819-0395, Japan  

E-Print Network (OSTI)

, Fukuoka 819-0395, Japan Jun Tamura, Tokyo Institute of Technology, Meguro-ku, Tokyo 152-8550, Japan Radiation Laboratory [1]. The low charge state, low emittance and high ion yield laser ion source (LIS


Extension of applicable neutron energy of DARWIN up to 1 GEV  

Science Journals Connector (OSTI)

......2007 research-article POSTER Presentations Extension...Institute of Radiological Sciences, Anagawa, Inage-ku...supported by the Ministry of Education, Science, Sports and Culture...2005 IEEE Nuclear Science Symposium Conference......

D. Satoh; T. Sato; A. Endo; N. Matsufuji; M. Takada



Intercultural Competence Development through the Global Awareness Program at the University of Kansas  

E-Print Network (OSTI)

abroad and earned the Global Awareness Program (GAP) certificate at the University of Kansas (KU). Byram's 1997 definition of intercultural competence provided the conceptual framework for this study. Informed by this definition, my working definition...

McEnaney, Lauren E



27.03.20071 Grain size distributions of fault rocks: a comparison between experimentally and3  

E-Print Network (OSTI)

Exploration, Japan Agency for Marine-Earth Science and Technology11 3173-25 Showa-machi, Kanazawa-ku, Yokohama; further displacement of fragments causes further comminution by wear and attrition.56 Cracked grains have

Paris-Sud XI, Université de


An Extension of Sums of Squares Relaxations to Polynomial ...  

E-Print Network (OSTI)

2-12-1 Oh-Okayama, Meguro-ku, Tokyo 152-8552 Japan. An Extension ...... Also, denote by ur the vector of all monomials x? (? ? Gr), and let Mr = uruT r . Using.



Time-lapse observation of cell alignment on nanogrooved patterns  

Science Journals Connector (OSTI)

...Shogoin, Sakyo-ku, Kyoto 606-8507, Japan 2 Regenerative Medicine Research Center, Itabashi Chuo Medical Center, 2-17-18...Leading Project: Development of Artificial Organs Utilizing Nanotechnology and Materials Science. References Adams, J.C. 2002Regulation...




Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

KU FE FE0002056 Strategic Center for Coal 2010-2012 Justin Glier 2009-2012 Lawrence, KS Modeling CO2 Sequestration in Saline Aquifer and Depleted Oil Reservoir to Evaluate Regional...


Size quantization effects in atomic level broadening near thin metallic films Macdonald Laboratory, Department of Physics, Kansas State University, Manhattan, Kansas 66506-2601  

E-Print Network (OSTI)

.R. ¡ Macdonald Laboratory, Department of Physics, Kansas State University, Manhattan, Kansas 66506-2601 and Garden Street, Cambridge, Massachusetts 02138 P. Ku¨rpick* J.R. ¡ Macdonald Laboratory, Department

Thumm, Uwe


12C Cross Section  

NLE Websites -- All DOE Office Websites (Extended Search)

, X) (Current as of 05142012) NSR Reaction E (MeV) Cross Section File X4 Dataset Date Added 2009MA70 12C(, 0): 0 - 2.27 X4 05012012 1997KU18 12C(, ): analyzed...


Using GIS Tainted Glasses to Help Subdivide the Ogallala/High Plains Aquifer in Kansas  

E-Print Network (OSTI)

Using GIS Tainted Glasses to Help Subdivide the Ogallala/High Plains Aquifer Brownie Wilson Geohydrology Section Kansas Geological Survey University of Kansas 12th Annual GIS Day @ KU November 20, 2013 The High Plains Aquifer Kansas Geological...

Wilson, Brownie



Development and Construction of Low-Cracking High-Performance Concrete (LC-HPC) Bridge Decks: Free Shrinkage, Mixture Optimization, and Concrete Production  

E-Print Network (OSTI)

parts covering (1) the development of an aggregate optimization and concrete mixture design program entitled KU Mix, (2) free-shrinkage tests to evaluate potential LC-HPC mixtures developed for use in bridge decks, and (3) the construction...

Lindquist, Will David



Page 1 of 1 Radiogram No. 9198u Form 24 for 05/13/2012  

E-Print Network (OSTI)

Family Conference (S+Ku-band) 13:00-14:00 . LUNCH 14:00-14:40 CDR Maintenance. Water Supply System (), Sanitary and Hygienic Equipment (), Flush Counter (), and POTOK Air Purification System Data Calldowns 14


ccsd-00002967,version1-29Sep2004 On osp(M|2n) integrable open spin chains  

E-Print Network (OSTI)

form: K(u) = diag 1 , 1 + c2u 1 - c2u , 1 + c3u 1 - c3u , 1 + c2u 1 - c2u 1 + c3u 1 - c3u This solution

Paris-Sud XI, Université de


A Little Can of Sunshine: Don Hillebrand and Jeff Chamberlain...  

NLE Websites -- All DOE Office Websites (Extended Search)

Energy Energy efficiency Vehicles Alternative fuels Energy sources Renewable energy Energy usage Energy storage Batteries Smart Grid Video ID http:youtu.be88BPZrZoKU4...


Electron-beam-induced absorption in quartz glasses  

Science Journals Connector (OSTI)

Electron-beam-induced absorption in quartz glasses of types KS-4V, KU-1, and Corning 7940 has been experimentally investigated in the 150-1000-nm region. Samples of optical materials...

Sergeev, P B; Zvorykin, V D; Sergeev, A P; Ermolenko, T A; Popov, S A; Pronina, M S; Turoverov, P K; Cheremisin, I I; Evlampiev, I K


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Generated on 04/07/13 by the Office of Institutional Research and Planning. Doctoral Program Profile: Spanish and Portuguese  

E-Print Network (OSTI)

in the College of Liberal Arts & Sciences. Additional information available at http://www2.ku.edu/~spanport/graduate/index. Doctoral Degrees Completed % of Degrees Completed Year of Completion Count Median Elapsed Years to Degree


Generated on 04/07/13 by the Office of Institutional Research and Planning. Doctoral Program Profile: Political Science  

E-Print Network (OSTI)

of Liberal Arts & Sciences. Additional information available at http://kups.ku.edu/graduate/index type of support. Doctoral Degrees Completed % of Degrees Completed Year of Completion Count Median


Generated on 04/07/13 by the Office of Institutional Research and Planning. Doctoral Program Profile: Communication Studies  

E-Print Network (OSTI)

in the College of Liberal Arts & Sciences. Additional information available at http://www2.ku.edu/~coms/graduate/index. Doctoral Degrees Completed % of Degrees Completed Year of Completion Count Median Elapsed Years to Degree


Generated on 04/07/13 by the Office of Institutional Research and Planning. Doctoral Program Profile: Women, Gender and Sexuality Studies  

E-Print Network (OSTI)

and Sexuality Studies in the College of Liberal Arts & Sciences. Additional information available at http://wgss.ku.edu/graduate/phd/index. Doctoral Degrees Completed % of Degrees Completed Year of Completion Count Median Elapsed Years to Degree


Arabidopsis DPB3-1, a DREB2A Interactor, Specifically Enhances Heat Stress-Induced Gene Expression by Forming a Heat Stress-Specific Transcriptional Complex with NF-Y Subunits  

Science Journals Connector (OSTI)

...Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657...International Research Center for Agricultural Sciences, Tsukuba 305-8686, Japan c RIKEN Center for Sustainable Resource Science, Tsurumi-ku, Yokohama 230-0045...

Hikaru Sato; Junya Mizoi; Hidenori Tanaka; Kyonosin Maruyama; Feng Qin; Yuriko Osakabe; Kyoko Morimoto; Teppei Ohori; Kazuya Kusakabe; Maika Nagata; Kazuo Shinozaki; Kazuko Yamaguchi-Shinozaki



The Scholarly Communication Problem: Why Open Access is Necessary A Transatlantic Perspective  

E-Print Network (OSTI)

Communication Problem Why Open Access is Necessary A Transatlantic Perspective The following piece was written to raise awareness among researchers in the Open Access movement and share KUs experience as a leader in Open Access policy. First published...

Greenberg, Marc L.; Emmett, Ada



E-Print Network 3.0 - advanced pressurized heavy Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

suppZ6ment au noll, Tome 41, novembre 1980, page C9-423 EXPERIMENTAL STUDY OF A FREE-VORTEX AERODYNAMIC WINDOW Summary: -Harima Heavy Industries, 1-15, Toyosu 3 chome, Koto-Ku,...


E-Print Network 3.0 - african tertiary teaching Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 2 GRADUATE STUDY IN AFRICAN AND AFRICAN-AMERICAN STUDIES "...We are where Africa, Summary: :www.ku.eduafs. MeganMcAteeKUUniversityRelations Professor Elizabeth...


The Imminent Healthcare and Emergency Care Crisis in Japan  

E-Print Network (OSTI)

ku, Tokyo 170-8445 Japan. Email: cpr119@coral.ocn.ne.jpEmergency Care Crisis in Japan 2. Organization for EconomicAccessed March 11, 2008. 3. Japan Medical Association .

Suzuki, Tetsuji; Nishida, Masamichi; Suzuki, Yuriko; Kobayashi, Kunio




NLE Websites -- All DOE Office Websites (Extended Search)

M. Washio, S. Kashiwagi, T. Oshima, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo, Japan J. Urakawa, H. Hayano, KEK, 1-1 Oho, Tsukuba, Ibaraki, Japan X. J. Wang, BNL, Upton,...


GS Yuasa Mitsubishi JV | Open Energy Information  

Open Energy Info (EERE)

JV Jump to: navigation, search Name: GS Yuasa & Mitsubishi JV Place: Minami-ku, Kyoto, Japan Sector: Vehicles Product: Japan-based JV and manufacturer of batteries for use in...


Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution in Mega Cities Sundar A. Christopher 1; J.Wang1; P. Gupta 1; M.A. Box2; and G.P. Box2  

E-Print Network (OSTI)

Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution, consistent, and cost-effective way for monitoring air pollution. Using Terra/Aqua data, we demonstrate matter, or aerosols, reduce visibility, affect human health, and also cause several ecological effects

Wang, Jun


4/25/11 12:32 PMThe Canadian Press: Scientists searching for 'soot-print' in the Arctic; black carbon coating seen as causing melt Page 1 of 2http://www.google.com/hostednews/canadianpress/article/ALeqM5gpZC2HL9mLKe_nwaOPhaSQPdnuUg?docId=6621785  

E-Print Network (OSTI)

the atmosphere by absorbing heat from the sun, explained Quinn, who works in NOAA's Pacific Marine Environmental with Quinn, likened the process to wearing a black shirt on a sunny day. "If you want to be cooler, you would wear a light-colored shirt that would reflect t

Rigor, Ignatius G.


Induction of Antimicrobial Pathways during Early-Phase Immune Response to Salmonella spp. in Murine Macrophages: Gamma Interferon (IFN-?) and Upregulation of IFN-? Receptor Alpha Expression Are Required for NADPH Phagocytic Oxidase gp91-Stimulated Oxidative Burst and Control of Virulent Salmonella spp.  

Science Journals Connector (OSTI)

...in our J774.2 model system agrees with previous...with IFN- (E) high-power image of 14028 phoP mutant-infected...with IFN- (H) high-power image of wild-type...the reticuloendothelial system. Infect. Immun. 62...Newburger. 1990. Restoration of phagocyte function...

N. Foster; S. D. Hulme; P. A. Barrow



The Effect of Altered Plasma on Tissue Proliferation  

E-Print Network (OSTI)

KU ScholarWorks | The University of Kansas Pre-1923 Dissertations and Theses Collection The Effect of Altered Plasma on Tissue Proliferation 1913 by Robert Lee Hoffman This work was digitized by the Scholarly Communications program staff in the KU... of Altered Plasma on Tissue Proliferation Thesis prepared and presented for a Masters Degree by Robert Lee Hoffmann Fellow in Anatomy. Kansas State University* I9JI3. The Effect of Altered Plasma on Tissue Proliferations. Tissue proliferation...

Hoffman, Robert Lee



Test Comparability  

E-Print Network (OSTI)

KU ScholarWorks | http://kuscholarworks.ku.edu Test Comparability 2010 by Christine Keller and David Shulenburger This work has been made available by the University of Kansas Libraries Office of Scholarly Communication and Copyright. Please... and Shulenburger, David. Test comparability, with Christine Keller in the Letters section of Change, September/October 2010, p. 6. Published version: http://www.changemag.org/Archives/Back%20 Issues/September-October%202010/letters-to-editor.html Terms of Use...

Keller, Christine; Shulenburger, David E.



Spotlight, August 2012  

E-Print Network (OSTI)

to attend conferences and events that promote sustainability on campus. Click here for a complete list of funded projects. Galileo Pavilion Studio 804, a class of KU architecture students, was finishing up construction of the Galileo Pavilion at JCCC...August 2012 Page 1 KU Center for Sustainability Hertz on Demand also helps save the environment while saving its members money, by lessening harmful emissions and reducing congestion. Fewer cars on the road means lower CO2 emissions...



Spotlight, March 2013  

E-Print Network (OSTI)

family size" to a choice system that (continued on page 2) By Thelma Simons, Project Coordinator for Information Technology and KU Advocate for Just Food 2 Page 2 KU Center for Sustainability March 2013 Kansas Dialogue Focuses Discussion at a...-4 PM Downtown Lawrence & South Park 4/23 Sustainability Leadership Award & Green Office Recognition Event, 3:30 PM Kansas Union 4/23 The Environment & Energy: The Role of Free Enterprise and the Government, 7:30 PM Dole Institute...



The Effects of Firm Size, Corporate Governance Quality, and Bad News on Disclosure Compliance  

E-Print Network (OSTI)

://link.springer.com/article/10.1007%2Fs11142-011-9153-8>. Open Access Version: http://kuscholarworks.ku.edu/dspace/. Electronic copy available at: http://ssrn.com/abstract=955922 The effects of firm size, corporate governance quality, and bad news on disclosure compliance... Governance Quality, and Bad News on Disclosure Compliance. Review of Accounting Studies. Publisher's Official Version: Fs11142-011-9153-8>. Open Access Version: http://kuscholarworks.ku.edu/dspace/. Electronic...

Ettredge, Michael L.; Johnstone, Karla; Stone, Mary S.; Wang, Qian



Monday Musings, December 10, 2012  

E-Print Network (OSTI)

Goodwin Thiel, outlines the complex and collaborative nature of the digitization process. You can view the collection online at http://luna.ku.edu:8180/luna/servlet/kuluna01kui~16~16, and see the online exhibition African-American Life in Wichita..., visit www.alert.ku.edu, or listen to local broadcast media. -- Thats all for this very busy week of finals. I hope everything is going as smoothly as possible! Thank you, Lorraine ...


Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Social Structure and Process of a Banana Plantation on the Pacific Coast of Costa Rica  

E-Print Network (OSTI)

KU ScholarWorks | The University of Kansas Central American Theses and Dissertations Collection Social Structure and Process of a Banana Plantation on the Pacific Coast of Costa Rica Professor in Charge Cesar X. Hernndez Cela Committee Members E... Communications program at the University of Kansas Libraries Center for Digital Scholarship. http://kuscholarworks.ku.edu SOCIAL STRUCTURE AND PROCESS OF A BANANA PLANTATION ON THE PACIFIC COAST OF COSTA RICA by Francisco .Escobar A.B., University of...

Escobar, Francisco



Spotlight, March 2012  

E-Print Network (OSTI)

, Assessment & Rating System, measures and encourages sustainability in all aspects of higher education. This is KUs first year completing the STARS self ?assessment. Building Sustainable Traditions, introduced last fall, is framed around the principles of... STARS and is guiding our path towards making sustainability an inherent part of everything we do at KU, said Chancellor Bernadette Gray?Little. We are proud of achieving a Bronze rating, but more importantly STARS helps us identify opportunities to build...



New study lounge for faculty, graduate students to open in Watson Library  

E-Print Network (OSTI)

12/5/13 New study lounge for faculty, graduate students to open in Watson Library www.lib.ku.edu/news/watson.fac.grad.study.lounge.shtml 1/1 Contact Us Rebecca Smith Director of Communications & Advancement KU Libraries Lawrence, Kansas 66045... Digital Collections Hours My Account Request Articles, Books, Friends & Benefactors Suggestions Watson room 425, also known as the "sun room," will be converted into a faculty/graduate student study lounge this fall. New study lounge for faculty, graduate...



Sabaapathikku Ragam: Abogi  

E-Print Network (OSTI)

: Krupaanidhi Ivarapolai Kidaikumoo Indha Bhoomi Thannil D D ; S S ; || Kru paa ni dhi D D ; S R ; || ; s r G ­ g r R S || s r G G g r R s s || D ; M - M g r S || Kru paa ni dhi Iva rai po- - la Ki dai ku moo - M g r S || Kru paa ni dhi Iva rai po- - la Ki dai ku moo - Indha Bhoo- mi Than nil -- S g r s S d

Kalyanaraman, Shivkumar


A dyadic protocol for training complex skills: a replication using female participants  

E-Print Network (OSTI)

A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

Sanchez-Ku, Maria Luisa



In...nite combinatorics and the foundations of regular variation N. H. Bingham and A. J. Ostaszewski  

E-Print Network (OSTI)

; > 0: (CFE) Subject to a mild regularity condition, (CFE) forces g to be a power: g( ) = 8 > 0 not hold. Similarly, if f is measurable or has the Baire property, (CFE) implies ( ), but not in general(u) (x ! 1) 8u 2 R; (RV+) h(x + u) h(x) ! 0 (x ! 1) 8u 2 R; (SV+) k(u + v) = k(u) + k(v) 8u; v 2 R: (CFE

Haase, Markus


Hauptmann's Relation To Christianity  

E-Print Network (OSTI)

KU ScholarWorks | The University of Kansas Pre-1923 Dissertations and Theses Collection Hauptmanns Relation To Christianity 1914 by Irene May Garrett This work was digitized by the Scholarly Communications program staff in the KU Libraries... S T I A N I T Y . y Irene May Garrett, A thesis submitted to the department of German of the University of Kansas in partial fullfilment of the requirements for the Master's Degree. May 15, 1914. Bibliography. Biography. Schlenther, Paul...

Garrett, Irene May



Rate-decline Relations for Unconventional Reservoirs and Development of Parametric Correlations for Estimation of Reservoir Properties  

E-Print Network (OSTI)

? flow rate (qg) and cumulative production (Gp) versus production time (East Tx tight gas well numerical simulation model). ...................................................................................................... 4 1.2 (Log-log Plot): q/Gp... versus production time. Duong model and Modified Duong Model (MDNG ? 2) matches for numerical simulation case (East Tx tight gas well). ........................... 6 1.3 (Log-log Plot): K/Gp ? 1 versus production time. Modified Logistic Growth Model...

Askabe, Yohanes 1985-



On the well-posedness and scattering for the Gross-Pitaevskii hierarchy via quantum de Finetti  

E-Print Network (OSTI)

We prove the existence of scattering states for the defocusing cubic Gross-Pitaevskii (GP) hierarchy in ${\\mathbb R}^3$. Moreover, we show that an energy growth condition commonly used in the well-posedness theory of the GP hierarchy is, in a specific sense, necessary. In fact, we prove that without the latter, there exist initial data for the focusing cubic GP hierarchy for which instantaneous blowup occurs.

Thomas Chen; Christian Hainzl; Natasa Pavlovic; Robert Seiringer



QER Public Meeting in Denver, CO: Gas-Electricity Interdependencies...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force - Written Statement Joe M. Holmes,...


Quadrennial Energy Review  

Energy Savers (EERE)

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force * Joe M. Holmes, Lead Energy Trader,...


Interaction of lopinavir with MDR1, MRP1 and MRP2 efflux proteins  

E-Print Network (OSTI)

either by decreasing the total intracellular retention of drugs or redistributing intracellular accumulation of drugs away from target organelles. INHIBITORS USED ? MRP family transporters were selectively inhibited with MK-571, a specific... leukotriene D4 (LTD4) receptor antagonist. MK-571 specifically inhibits at least MRP1 and MRP2, but not P-gp. ? P-gp transporter was selectively inhibited with P-gp 4008, a specific inhibitor of MDR1/P-gp mediated efflux. ? Fumitremorgin-C (FC) is a...

Agarwal, Shankar; Pal, D.; Mitra, A. K.



unknown title  

E-Print Network (OSTI)

Transcription of the gene encoding melanomaassociated antigen gp100 in tissues and cell lines other than those of the melanocytic lineage

unknown authors


HIV Infection and the Central Nervous System: A Primer  

E-Print Network (OSTI)

NMDA receptor inhibition by memantine. Cell Death andopen-channel blocker memantine are ef- fective withoutand gp120: protection by memantine. Annals of Neurology, 47(

Ellis, Ronald J.; Calero, Patricia; Stockin, Michael D.



Protein, grain and sources of methionine in the nutrition of the laying hen and broiler chick  

E-Print Network (OSTI)

) supplementation (Gp. 7) produced the largest body weight gain while the diet containing only milo (Gp. 1) showed the smallest body weight gain. Hen-da Production: Birds receiving the diet with milo only (Gp, 1) laid significantly less eggs than any other.... When both FM and MHA were added to the milo and corn diets (Gps. 4 & 8) there was a significant improvement only in the group fed the milo diet (Gp. 4) when com- pared to the diets containing only corn and milo (Gps. 1 6 5). ~EW ' ht: MHA and FM...

Ernst, Herbert Lloyd



Autonomous robotic wheelchair with collision-avoidance navigation  

E-Print Network (OSTI)

range of the two GP2D12 infrared sensors as 70 cm. In Figure 5.1, we can see that the circle is the turning trajectory of the wheelchair turning at an original point. The detecting range of two GP2D12 and three GP2D15 infrared 28 sensors... signal. From some experiments and testing, we set the reaction of the robotic wheelchair in Table 5.1. There are five infrared sensors assembled on the sensor bracket. Two Sharp GP2D12 infrared sensors assembled on the right and left sides as Figure...

Hsieh, Pin-Chun



Quantitative evaluation of the effect of p-glycoprotein on oral drug absorption  

E-Print Network (OSTI)

Concentration P-gp Expression Level Affinity to P-gp Passive Membrane Permeability Cellular Accumulation Transport Experiments by using P-gp Expressing Cell Monolayers Apical Basal Caco-2 cell? MDR1-MDCK cell ? Permeability ratio Transport Rate = f ( Km, Vmax..., Ppassive ) ?Impact of P-gp on in vivo Oral Drug Absorption? Development of kinetic model that can predict the in vivo absorption of P-glycoprotein substrate drugs from in vitro data. PURPOSE 0 1.0 2.0 3.0 P e r m e a b i l i t y r a t i o ( B L t o A P...

Shirasaka, Yoshiyuki



E-Print Network 3.0 - african aids vaccine Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

with recombinant gp120 from the MN strain of HIV-1. NIAID AIDS ... Source: Gilbert, Peter - Fred Hutchinson Cancer Research Center & Department of Biostatistics,...


E-Print Network 3.0 - anti-myelin-associated glycoprotein peripheral...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 7 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...


E-Print Network 3.0 - arenavirus envelope glycoprotein Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 22 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network 3.0 - axonal membrane glycoprotein Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 15 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...


A label-free differential quantitative mass spectrometry method for the characterization and identification of protein changes during citrus fruit development.  

E-Print Network (OSTI)

Like RANBP1 RANBP1b RAN3 Rho GDI GP3/ROP4 GDI1 GDI2-likeshowed that two RAB GDI (GDP-RAB dissociation inhibitors),



E-Print Network 3.0 - abc multidrug efflux Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Oak Ridge National Laboratory Fossil Energy Program Collection: Fossil Fuels 76 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...


Children and adolescents deaths from trauma-related causes in a Brazilian City  

E-Print Network (OSTI)

S, Fraga GP: Fatal motorcycle crashes: a serious publicassociated with severity of motorcycle injuries among youngor train, bicycles, or motorcycles), asphyxia/ suffocation,



Monitoring-based HVAC Commissioning of an Existing Office Building for Energy Efficiciency  

E-Print Network (OSTI)

GP-21, and GP-23) and three boilers (BR3, BR4 and BR5); thefan BL1 during unoccupied hours 4.2 Boiler performance Thereare three main boilers, labeled as BR3, BR4, and BR5, in the

Wang, Liping



Antibody-mediated neutralization of Ebola virus can occur by two distinct mechanisms  

SciTech Connect

Human Ebola virus causes severe hemorrhagic fever disease with high mortality and there is no vaccine or treatment. Antibodies in survivors occur early, are sustained, and can delay infection when transferred into nonhuman primates. Monoclonal antibodies (mAbs) from survivors exhibit potent neutralizing activity in vitro and are protective in rodents. To better understand targets and mechanisms of neutralization, we investigated a panel of mAbs shown previously to react with the envelope glycoprotein (GP). While one non-neutralizing mAb recognized a GP epitope in the nonessential mucin-like domain, the rest were specific for GP1, were neutralizing, and could be further distinguished by reactivity with secreted GP. We show that survivor antibodies, human KZ52 and monkey JP3K11, were specific for conformation-dependent epitopes comprising residues in GP1 and GP2 and that neutralization occurred by two distinct mechanisms; KZ52 inhibited cathepsin cleavage of GP whereas JP3K11 recognized the cleaved, fusion-active form of GP.

Shedlock, Devon J., E-mail: shedlock@mail.med.upenn.ed [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Bailey, Michael A., E-mail: mike.bailey@taurigroup.co [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Popernack, Paul M. [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Cunningham, James M. [Department of Medicine, Brigham and Women's Hospital and Harvard Medical School, Boston, MA 02115 (United States); Burton, Dennis R. [Department of Immunology, Scripps Research Institute, La Jolla, CA 92037 (United States); Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037 (United States); Sullivan, Nancy J., E-mail: nsullivan@nih.go [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States)



Ebola virus-like particles produced in insect cells exhibit dendritic cell stimulating activity and induce neutralizing antibodies  

SciTech Connect

Recombinant baculoviruses (rBV) expressing Ebola virus VP40 (rBV-VP40) or GP (rBV-GP) proteins were generated. Infection of Sf9 insect cells by rBV-VP40 led to assembly and budding of filamentous particles from the cell surface as shown by electron microscopy. Ebola virus-like particles (VLPs) were produced by coinfection of Sf9 cells with rBV-VP40 and rBV-GP, and incorporation of Ebola GP into VLPs was demonstrated by SDS-PAGE and Western blot analysis. Recombinant baculovirus infection of insect cells yielded high levels of VLPs, which were shown to stimulate cytokine secretion from human dendritic cells similar to VLPs produced in mammalian cells. The immunogenicity of Ebola VLPs produced in insect cells was evaluated by immunization of mice. Analysis of antibody responses showed that most of the GP-specific antibodies were of the IgG2a subtype, while no significant level of IgG1 subtype antibodies specific for GP was induced, indicating the induction of a Th1-biased immune response. Furthermore, sera from Ebola VLP immunized mice were able to block infection by Ebola GP pseudotyped HIV virus in a single round infection assay, indicating that a neutralizing antibody against the Ebola GP protein was induced. These results show that production of Ebola VLPs in insect cells using recombinant baculoviruses represents a promising approach for vaccine development against Ebola virus infection.

Ye Ling [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lin Jianguo [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Sun Yuliang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bennouna, Soumaya [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lo, Michael [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Wu Qingyang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bu Zhigao [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Pulendran, Bali [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Compans, Richard W. [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: compans@microbio.emory.edu; Yang Chinglai [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: chyang@emory.edu



A replication-deficient rabies virus vaccine expressing Ebola virus glycoprotein is highly attenuated for neurovirulence  

SciTech Connect

We are developing inactivated and live-attenuated rabies virus (RABV) vaccines expressing Ebola virus (EBOV) glycoprotein for use in humans and endangered wildlife, respectively. Here, we further characterize the pathogenesis of the live-attenuated RABV/EBOV vaccine candidates in mice in an effort to define their growth properties and potential for safety. RABV vaccines expressing GP (RV-GP) or a replication-deficient derivative with a deletion of the RABV G gene (RV{Delta}G-GP) are both avirulent after intracerebral inoculation of adult mice. Furthermore, RV{Delta}G-GP is completely avirulent upon intracerebral inoculation of suckling mice unlike parental RABV vaccine or RV-GP. Analysis of RV{Delta}G-GP in the brain by quantitative PCR, determination of virus titer, and immunohistochemistry indicated greatly restricted virus replication. In summary, our findings indicate that RV-GP retains the attenuation phenotype of the live-attenuated RABV vaccine, and RV{Delta}G-GP would appear to be an even safer alternative for use in wildlife or consideration for human use.

Papaneri, Amy B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)] [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Wirblich, Christoph [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States)] [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Cann, Jennifer A.; Cooper, Kurt [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States)] [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Jahrling, Peter B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States) [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Schnell, Matthias J., E-mail: matthias.schnell@jefferson.edu [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Jefferson Vaccine Center, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Blaney, Joseph E., E-mail: jblaney@niaid.nih.gov [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)



Ebola Virus Glycoproteins Induce Global Surface Protein Down-Modulation and Loss of Cell Adherence  

Science Journals Connector (OSTI)

ARTICLE PATHOGENESIS AND IMMUNITY Ebola Virus Glycoproteins Induce Global Surface...Philadelphia, Pennsylvania 19104-6076 The Ebola virus envelope glycoprotein (GP) derived...rounding and detachment in 293T cells, Ebola virus GP did not cause an increase in cell...

Graham Simmons; Rouven J. Wool-Lewis; Frdric Baribaud; Robert C. Netter; Paul Bates



A simple approach to lifetime learning in genetic programming-based symbolic regression  

Science Journals Connector (OSTI)

Genetic programming GP coarsely models natural evolution to evolve computer programs. Unlike in nature, where individuals can often improve their fitness through lifetime experience, the fitness of GP individuals generally does not change during their ... Keywords: Genetic programming, hybrid genetic algorithms, lifetime learning, local search, memetic algorithms, symbolic regression

Raja Muhammad Atif Azad; Conor Ryan



Characterization and Optimization of the Glucan Particle-Based Vaccine Platform  

Science Journals Connector (OSTI)

...GPs, suggesting that the GP platform acts as both an adjuvant and...make an effective vaccine platform that combines adjuvanticity...particle (GP)-based vaccine platform (2). GPs are derived from...Administration. MATERIALS AND METHODS Chemicals and cell culture media. Chemical...

Haibin Huang; Gary R. Ostroff; Chrono K. Lee; Charles A. Specht; Stuart M. Levitz




E-Print Network (OSTI)

small-scale heterogeneity. This research develops an upscaling method based on genetic programming (GP), which facilitates both the GP search and the implementation of the resulting models, and demonstrates and control (QA/QC), focused data collection, and event detection. The second portion of this dissertation

Fernandez, Thomas


Phenethyl Isothiocyanate (PEITC) Decreases Specficity Protein (SP) Tanscription Factors through an ROS-dependent Mechanism  

E-Print Network (OSTI)

.................................................................. 8 Gp|{ocvke"ogejcpkuou0............................................................... 8 Pqp/gp|{ocvke"ogejcpkuou....................................................... 10 Positive roles of ROS... rise to ROS involves the addition of two more electrons following the decay of peroxycytochrome P450 resulting in the release of the second oxygen atom in the form of water [20]. A schematic representation of ROS production by CYPs is illustrated...

Guthrie, Aaron S 1987-



Responding to symptoms suggestive of lung cancer: a qualitative interview study  

E-Print Network (OSTI)

the GP two or more times before referral, during this period they reinterpreted initial symptoms and appraised new symptoms. The meaning given to symptoms changed over time and many became increasingly concerned they may have lung cancer. The GP played a...

Birt, Linda; Hall, Nicky; Emery, Jon; Banks, Jon; Mills, Katie; Johnson, Margaret; Hamilton, Willie; Walter, Fiona M.



Radiative corrections to lepton-lepton scattering Physik-Department T39, Technische Universitat Munchen, D-85747 Garching, Germany  

E-Print Network (OSTI)

the tree diagrams and the one-loop diagrams. Infrared finiteness of these virtual radiative corrections is achieved (in the standard way) by including soft photon radiation below an energy cut-off . We evaluate discrepancies for the ratio of the proton electric and magnetic form factors Gp E/Gp M as determined

Weise, Wolfram


Direct estimation of gas reserves using production data  

E-Print Network (OSTI)

Virginia Well A (Fetkovich, et al.8): qg versus t ............................................................ 36 4.2 West Virginia Well A (Fetkovich, et al.8): qg versus t and pwf versus t ? Production History Plot... ................................................................................... 36 4.3 West Virginia Well A (Fetkovich, et al.8): Gp versus t ........................................................... 37 4.4 West Virginia Well A (Fetkovich, et al.8): qg versus Gp ......................................................... 38...

Buba, Ibrahim Muhammad



Experimental infection with Treponema hyodysenteriae in guinea pigs.  

Science Journals Connector (OSTI)

...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...odysenteriae, except in GP inoculated with iso- late B282 and in 16-week-old GP inoculated...

L A Joens; J G Songer; D L Harris; R D Glock



Regional Drinking Water Security Action research, policy and analysis  

E-Print Network (OSTI)

/ 21 #12;Mograj/Tembhre GP level study and data analysis The Question : Why do stressed villages GP level study and data analysis () December 18, 2012 13 / 21 #12;North Karjat rural regional scheme for Technology Alternatives for Rural Areas, GISE (CSE) IIT-Bombay www.ctara.iitb.ac.in () December 18, 2012 1

Sohoni, Milind


Turing Completeness in the Language of Genetic Programming with Indexed Memory  

E-Print Network (OSTI)

Turing Completeness in the Language of Genetic Programming with Indexed Memory Astro Teller GP is combined with the technique of indexed memory, the resulting system is Turing complete little familiarity with either GP or indexed memory. A complete introduction to the topic of traditional

Fernandez, Thomas



U.S. Energy Information Administration (EIA) Indexed Site

BS220","='Parts1-3'!$P$40" BS220","='Parts1-3'!$P$40" "_BS243","='Parts1-3'!$P$36" "_BS247","='Parts1-3'!$P$39" "_BS248","='Parts1-3'!$P$37" "_BS249","='Parts1-3'!$P$38" "_ES220","='Parts1-3'!$X$40" "_ES243","='Parts1-3'!$X$36" "_ES247","='Parts1-3'!$X$39" "_ES248","='Parts1-3'!$X$37" "_ES249","='Parts1-3'!$X$38" "_GP220","='Parts1-3'!$U$40" "_GP243","='Parts1-3'!$U$36" "_GP247","='Parts1-3'!$U$39" "_GP248","='Parts1-3'!$U$37" "_GP249","='Parts1-3'!$U$38" "_GR220","='Parts1-3'!$S$40"

Note: This page contains sample records for the topic "ku kuwait gp" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Phenylalanines at positions 88 and 159 of Ebolavirus envelope glycoprotein differentially impact envelope function  

SciTech Connect

The envelope glycoprotein (GP) of Ebolavirus (EBOV) mediates viral entry into host cells. Through mutagenesis, we and other groups reported that two phenylalanines at positions 88 and 159 of GP are critical for viral entry. However, it remains elusive which steps of viral entry are impaired by F88 or F159 mutations and how. In this study, we further characterized these two phenylalanines through mutagenesis and examined the impact on GP expression, function, and structure. Our data suggest that F159 plays an indirect role in viral entry by maintaining EBOV GP's overall structure. In contrast, we did not detect any evidence for conformational differences in GP with F88 mutations. The data suggest that F88 influences viral entry during a step after cathepsin processing, presumably impacting viral fusion.

Ou Wu; King, Harlan; Delisle, Josie [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States); Shi Dashuang [Research Center for Genetic Medicine, Children's National Medical Center, George Washington University, Washington, D. C. 20010 (United States); Wilson, Carolyn A., E-mail: carolyn.wilson@fda.hhs.go [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States)



Neutral zone: World Oil Report 1991  

SciTech Connect

This paper reports on the Neutral Zone between Kuwait and Saudi Arabia, much in the news during the Gulf war, that returned to production in June when offshore output resumed at a rate of 100,000 bpd. By this month, offshore production should have attained near its pre-war level of 250,000 bpd. Because of war damage onshore, production will not be restarted onshore for some time. Neutral Zone oil is jointly owned by Kuwait and Saudi Arabia. Texaco's Getty unit operates some 900 mostly pumping wells in South Umm Gudair, Wafra and South Fawaris onshore fields. However, only about 50 were producing 130,000 bpd last August when Iraqis invaded. Japan's Arabian Oil Co. operates 165 wells-all flowing-in offshore Khafji, Hout and Lulu fields that have a maximum productive capacity of about 300,000 bpd.

Not Available



Inflatable kill packers used in working over Kuwaiti wells  

SciTech Connect

This paper reports on inflatable packers which are being used with great success in post-well capping workover operations in Kuwait oil fields. In mid-January, about one kill packer was being run per day. Use is expected to increase in March when a second post-capping crew arrives. Of several thousand unconventional ideas submitted to Kuwait Oil Co. (KOC) for controlling the well fires left in the aftermath of lst year's Gulf War, only about a dozen were actually used. Inflatable kill packers, designed and manufactured by Baker Service Tools and marketed by Baker Oil Tools, were one of the ideas that proved effective. The kill packers are modifications of Baker's inflatable packers that have successfully been used in capping producers on many blowouts throughout the world, including the Piper Alpha disaster in the North Sea and the Saga blowout offshore Norway.

Miller, D. (Baker Oil Tools, Houston, TX (US)); Conover, G. (Baker Service Tools, Houston, TX (US))



The Gulf War and the environment  

SciTech Connect

The Gulf War inflicted dramatic environmental damage upon the fragile desert and shore environments of Kuwait and northeastern Saudi Arabia. Coastal and marine environments experienced oil spills of more than 8 million barrels, which killed wildlife and damaged the fishing industry. In inland Kuwait, hundreds of oil lakes are scattered across the desert surface: these lakes emit noxious gases, drown insects and birds, and may seep to pollute groundwater. Exploding and burning oil wells released soot particles, oil droplets, and noxious chemicals into the atmosphere, spreading air pollution, acid rain, and respiratory problems. Military diggings, constructions, and vehicles have destroyed much of the desert pavement, resulting in increased dust storms and large, moving dunes.

El-Baz, F. (ed.) (Boston Univ., MA (United States). Center for Remote Sensing); Makharita, R.M. (ed.) (World Bank, Washington, DC (United States))



Nuclear winter from gulf war discounted  

SciTech Connect

Would a major conflagration in Kuwait's oil fields trigger a climate catastrophe akin to the 'nuclear winter' that got so much attention in the 1980s This question prompted a variety of opinions. The British Meteorological Office and researchers at Lawrence Livermore National Laboratory concluded that the effect of smoke from major oil fires in Kuwait on global temperatures is likely to be small; however, the obscuration of sunlight might significantly reduce surface temperatures locally. Michael MacCracken, leader of the researchers at Livermore, predicts that the worst plausible oil fires in the Gulf would produce a cloud of pollution about as severe as that found on a bad day at the Los Angeles airport. The results of some mathematical modeling by the Livermore research group are reported.

Marshall, E.



Oil spills - increasing US dependence on oil imports heightens risks to environment  

SciTech Connect

Calamitous oil spills in recent years have focused attention on the devastation the world`s leading energy source can wreak on the environment. In Alaska, the 1989 grounding of the supertanker Exxon Valdez in Prince William Sound caused the worst U.S. oil spill ever and promoted Congress to pass stringent oil-pollution legislation. In the Persian Gulf, {open_quotes}eco-terroism{close_quotes} committed by Iraqi forces during the gulf war left hundreds of wells burning and oil free-flowing out of Kuwait`s refineries and oil-shipping terminals. With the United States and much of the global community increasingly dependent on petroleum moved by supertankers, oil spills will continue to threaten the environment for the foreseeable future.




Global arms proliferation  

SciTech Connect

This paper reports that the United States delivered some US $11 billion of military hardware to Iran between 1969 and 1979, in the hopes of helping stabilize a volatile situation in the Middle East. That did not work. When Iran used the weapons against Iraq, the USSR, France, and a number of developing countries helped arm Iraq. It was this vast arsenal that Iraq deployed in its Kuwait-Persian Gulf War venture. Granted, those weapons were augmented by some U.S.-made equipment like TOW antitank missiles and Hawk antiaircraft missiles that were captured in the Iraqi attack on Kuwait. A report issued by the U.S. Office of Technology Assessment (OTA) in June cited that chain of events to demonstrate that the U.S. and other major exporters are gradually losing control of the weapons transferred (to other countries) as well as the technology and industry necessary to produce and support them.

Christiansen, D.



Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

2 2 September 2013 Table 42. PAD District 2 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 1,083 - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - - - - - - - - - Nigeria ................................


Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

8 8 September 2013 Table 46. PAD District 2 - Year-to-Date Imports of Crude Oil and Petroleum Products by Country of Origin, January-September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 11,451 - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. 949 - - - - - - - - - Libya ...................................


Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

58 58 September 2013 Table 41. PAD District 1 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total OPEC ..................................... 12,102 - - - - - - - 2,112 2,112 Algeria ................................ - - - - - - - - - - Angola ................................ 3,271 - - - - - - - - - Ecuador .............................. - - - - - - - - 160 160 Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... 1,046


Petroleum Supply Monthly  

U.S. Energy Information Administration (EIA) Indexed Site

0 0 September 2013 Table 44. PAD District 4 and 5 - Imports of Crude Oil and Petroleum Products by Country of Origin, September 2013 (Thousand Barrels) Country of Origin Crude Oil 1,2 Pentanes Plus Liquefied Petroleum Gases Unfinished Oils 1 Finished Motor Gasoline Motor Gasoline Blending Components Reform- ulated Conven- tional Total Reform- ulated Conven- tional Total PAD District 4 OPEC ..................................... - - - - - - - - - - Algeria ................................ - - - - - - - - - - Angola ................................ - - - - - - - - - - Ecuador .............................. - - - - - - - - - - Iran ..................................... - - - - - - - - - - Iraq ..................................... - - - - - - - - - - Kuwait ................................. - - - - - - - - - - Libya ................................... - - -


Validating the unified theory of acceptance and use of technology in Kuwaiti ministries: a structural equation modelling approach  

Science Journals Connector (OSTI)

The purpose of this article is to describe a test of the validity of the unified theory of acceptance and use of technology (UTAUT) model by applying it to Kuwaiti ministries. Structural equation modelling methods were used to test the relationships ... Keywords: ISU acceptance, Kuwait, UTAUT, developing countries, information systems usage, structural equation modelling, technology acceptance, technology use, unified theory of acceptance and use of technology

Helaiel Almutairi



Middle East  

SciTech Connect

Petroleum production in Middle East countries during 1980 totaled 6,747,719,000 bbl or an average rate of 18,436,390,000 bbl/d, down 13.9% from 1979. Increases were in Saudi Arabia and Syria. Significant decreases occurred in Iraq, Iran, Kuwait, and Turkey. New discoveries were made in Abu Dhabi, Iran, Saudi Arabia, Sharjah, and Oman. New areas were explored in Bahrain, Oman, Syria, and Yemen. 9 figures, 16 tables.

Hemer, D.O. (Mobil Oil Corp., New York, NY); Mason, J.F.; Hatch, G.C.



NASA technology applications team. Applications of aerospace technology. Annual Report, Oct. 1990 - Sep. 1991  

SciTech Connect

Discussed here are the activities of the Research Triangle Institute (RTI) Technology Applications Team for the period 1 October 1990 through 30 September 1991. Topics researched include automated data acquisition and analysis of highway pavement cracking, thermal insulation for refrigerators, the containment of paint removed from steel structures, improved technologies for Kuwait oil well control, sprayed zinc coatings for corrosion control of reinforcing steel in bridges, and the monitoring and life support of medically fragile children in the educational setting.

Not Available



Oil production triggered by crisis stays on stream throughout '91  

SciTech Connect

This paper reports on worldwide production of crude oil and lease condensate that declined slightly in 1991 due to sagging demand. With Kuwait and Iraq still producing negligible volumes, there was little spare production capacity. But the replacement capacity pressed into use during the Persian Gulf crisis proved its durability by remaining on stream throughout the year. Reserves declined marginally. Most reserves changes reflected estimates by governments of some producing countries.

Not Available



Methods of monitoring the Persian Gulf oil spill using digital and hardcopy multiband data. Technical report, January-July 1991  

SciTech Connect

A quick response demonstration was performed during the Persian Gulf War that showed a capability to monitor the path of oil dumped into the bay near Kuwait City using commercial satellite imagery. Both manual and semi-automated methods of image analysis were performed on AVHRR and Landsat TM imagery. Estimates of the oil area coverage were obtained using conventional classification methods. A hardcopy generation and reproduction capability was also demonstrated.

Rand, R.S.; Satterwhite, M.B.; Davis, D.A.; Anderson, J.E.



Iraq and the utilities  

SciTech Connect

This article discusses the possible impact on the public utilities of the invasion of Kuwait by Iraq. The author feels the industry is in better shape to weather this than the energy crisis of 1973 and 1974. However regulatory policies that prohibit some utilities from recovering fuel costs through rate adjustments may cause distress for some. The author feels that a revision of regulatory policies is needed.

Studness, C.M.



Essays in Empirical Macroeconomics: Applications to the GCC Monetary Union  

E-Print Network (OSTI)

.............................................................................................................50 Figure 3.1: Impulse Response Functions to an Oil Price Shock........................................84 Figure 3.2: Impulse Response Functions to an Oil Production Shock..............................85 Figure 3.3: Impulse Response Functions to a... of the GCC area. I then outline the essential motivations and research objectives of this dissertation. 1 Characteristics of the GCC Area 1.1 Historical Background In May 1981, the six Head of States of Bahrain, Kuwait, Oman, Qatar, Saudi Arabia...

Al-Hassan, Abdullah Mohammed



US Government Outsourcing, the Private Military Industry, and Operation Iraqi Freedom: A Case Study in Conflict Contracting  

E-Print Network (OSTI)

prosperous decade for Iraq. Living standards rose for most Iraqis, in large part due to rapidly increasing oil revenues. Saddam Hussein officially assumed the presidency of Iraq in 1979 under the Baath Party, and in 1980 Iraq invaded Iran, waging a war... Iran would cost Iraq more than its oil revenues totaled during those eight years of conflict.55 Hussein then led the country into another unsuccessful war, this time against Kuwait, in 1990. The invasion was considered an attempt to augment state...

Halpin, Allison Ann



Economy key to 1992 U. S. oil, gas demand  

SciTech Connect

This paper provides a forecast US oil and gas markets and industry in 1992. An end to economic recession in the U.S. will boost petroleum demand modestly in 1992 after 2 years of decline. U.S. production will resume its slide after a fractional increase in 1991. Drilling in the U.S. will set a record low. Worldwide, the key questions are economic growth and export volumes from Iraq, Kuwait, and former Soviet republics.

Beck, R.J.
