National Library of Energy BETA

Sample records for information systems tools

  1. Geographic Information Systems- Tools For Geotherm Exploration...

    Open Energy Info (EERE)

    Information Systems- Tools For Geotherm Exploration, Tracers Data Analysis, And Enhanced Data Distribution, Visualization, And Management Abstract Geographic information...

  2. Photovoltaic Geographical Information System | Open Energy Information

    Open Energy Info (EERE)

    Information System Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Photovoltaic Geographical Information System Focus Area: Renewable Energy Topics: Opportunity...

  3. Web-Based Geographic Information System Tool for Accessing Hanford Site Environmental Data

    SciTech Connect (OSTI)

    Triplett, Mark B.; Seiple, Timothy E.; Watson, David J.; Charboneau, Briant L.; Morse, John G.

    2014-11-15

    Data volume, complexity, and access issues pose severe challenges for analysts, regulators and stakeholders attempting to efficiently use legacy data to support decision making at the U.S. Department of Energy’s (DOE) Hanford Site. DOE has partnered with the Pacific Northwest National Laboratory (PNNL) on the PHOENIX (PNNL-Hanford Online Environmental Information System) project, which seeks to address data access, transparency, and integration challenges at Hanford to provide effective decision support. PHOENIX is a family of spatially-enabled web applications providing quick access to decades of valuable scientific data and insight through intuitive query, visualization, and analysis tools. PHOENIX realizes broad, public accessibility by relying only on ubiquitous web-browsers, eliminating the need for specialized software. It accommodates a wide range of users with intuitive user interfaces that require little or no training to quickly obtain and visualize data. Currently, PHOENIX is actively hosting three applications focused on groundwater monitoring, groundwater clean-up performance reporting, and in-tank monitoring. PHOENIX-based applications are being used to streamline investigative and analytical processes at Hanford, saving time and money. But more importantly, by integrating previously isolated datasets and developing relevant visualization and analysis tools, PHOENIX applications are enabling DOE to discover new correlations hidden in legacy data, allowing them to more effectively address complex issues at Hanford.

  4. Geographic Information System Tools for Management of US DOE Sites - 13489

    SciTech Connect (OSTI)

    Carpenter, Cliff; Pilz, Elaine; Pawel, Steve

    2013-07-01

    The DOE Office of Legacy Management (LM) uses a variety of GIS tools to support long-term surveillance and maintenance (LTS and M) activities at DOE closure sites. These geo-spatial applications provide access to data both for external public viewing and for internal analysis and decision making. LM uses a custom geo-spatial application called geo-spatial Environmental Mapping System (GEMS) that draws validated information from a database of 4.6 million analytical results and 232,000 water level measurements for 58 LTS and M sites. These data were collected from transferred sites over a period of 40 years. The database is used to capture and store historical environmental information such as analytical chemistry data, groundwater depths and elevations, well logs, well construction data, geo-referenced boundaries, site physical features, and sampling locations from LTS and M sites. Stakeholders, regulators, and project personnel can use this Web-based application and data to display information in several forms, such as a tabular report, a graph, and a geo-spatial display, or the data can be labeled or highlighted in a map view. Institutional controls, with their LTS and M requirements and documentation, have recently been incorporated into a prototype GEMS Web page for the Weldon Spring, Missouri, Site. LM uses multiple internal GIS viewers to help ensure the future protection of human health and the environment. For example, at the Rocky Flats, Colorado, Site, LM uses a GIS application to display real property interests on authoritative maps. Another project is used to facilitate discussions at stakeholder meetings for the Rocky Flats site's Original Landfill. The Uranium Leasing Program uses multiple interactive maps that assist in ongoing monitoring and the oversight of lease-holders' activities. (authors)

  5. Tools for Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    including Intellus, an online tool that provides transparency and accessibility to the environmental monitoring data from in and around Los Alamos National Laboratory. August 1,...

  6. Tools for Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Tools for Discovery Offer Potential Hope for Huntington's Tools for Discovery Offer Potential Hope for Huntington's May 25, 2011 - 3:24pm Addthis Flora Meilleur prepares protein solutions for structural investigation with neutrons. | Courtesy of ORNL Flickr / Jason Richards Flora Meilleur prepares protein solutions for structural investigation with neutrons. | Courtesy of ORNL Flickr / Jason Richards Charles Rousseaux Charles Rousseaux Senior Communications Specialist (detailee) What

  7. Information Technology Tools for Multifamily Building Programs...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Technology Tools for Multifamily Building Programs Information Technology Tools for Multifamily Building Programs Better Buildings Neighborhood Program Multifamily ...

  8. Pumping System Assessment Tool

    Broader source: Energy.gov [DOE]

    The Pumping System Assessment Tool (PSAT) is a free online software tool to help industrial users assess the efficiency of pumping system operations. PSAT uses achievable pump performance data from Hydraulic Institute standards and motor performance data from the MotorMaster+ database to calculate potential energy and associated cost savings. The tool also enables users to save and retrieve log files, default values, and system curves for sharing analyses with other users.

  9. Pumping System Assessment Tool User Manual

    Broader source: Energy.gov [DOE]

    The Pumping System Assessment Tool (PSAT) user manual gives basic information about the data entry items, the calculated results, and assorted control button features.

  10. Request for Information on the Electric Grid Resilience Self-Assessment Tool for Distribution Systems: Federal Register Notice, Volume 80, No. 126- Jul. 1, 2015

    Broader source: Energy.gov [DOE]

    The Department of Energy (DOE) Office of Electricity Delivery and Energy Reliability (OE) is seeking comments and information from interested parties to inform the development of a pilot project concerning an interactive self-assessment tool to understand the relative resilience level of national electric grid distribution systems to extreme weather events.

  11. Tool calibration system for micromachining system

    DOE Patents [OSTI]

    Miller, Donald M.

    1979-03-06

    A tool calibration system including a tool calibration fixture and a tool height and offset calibration insert for calibrating the position of a tool bit in a micromachining tool system. The tool calibration fixture comprises a yokelike structure having a triangular head, a cavity in the triangular head, and a port which communicates a side of the triangular head with the cavity. Yoke arms integral with the triangular head extend along each side of a tool bar and a tool head of the micromachining tool system. The yoke arms are secured to the tool bar to place the cavity around a tool bit which may be mounted to the end of the tool head. Three linear variable differential transformer's (LVDT) are adjustably mounted in the triangular head along an X axis, a Y axis, and a Z axis. The calibration insert comprises a main base which can be mounted in the tool head of the micromachining tool system in place of a tool holder and a reference projection extending from a front surface of the main base. Reference surfaces of the calibration insert and a reference surface on a tool bar standard length are used to set the three LVDT's of the calibration fixture to the tool reference position. These positions are transferred permanently to a mastering station. The tool calibration fixture is then used to transfer the tool reference position of the mastering station to the tool bit.

  12. Form:Tool | Open Energy Information

    Open Energy Info (EERE)

    to add to the registry. If the tool is already in the registry, you will be able to edit its existing information. Submit Retrieved from "http:en.openei.orgw...

  13. Rotary fast tool servo system and methods

    DOE Patents [OSTI]

    Montesanti, Richard C.; Trumper, David L.

    2007-10-02

    A high bandwidth rotary fast tool servo provides tool motion in a direction nominally parallel to the surface-normal of a workpiece at the point of contact between the cutting tool and workpiece. Three or more flexure blades having all ends fixed are used to form an axis of rotation for a swing arm that carries a cutting tool at a set radius from the axis of rotation. An actuator rotates a swing arm assembly such that a cutting tool is moved in and away from the lathe-mounted, rotating workpiece in a rapid and controlled manner in order to machine the workpiece. A pair of position sensors provides rotation and position information for a swing arm to a control system. A control system commands and coordinates motion of the fast tool servo with the motion of a spindle, rotating table, cross-feed slide, and in-feed slide of a precision lathe.

  14. Slide system for machine tools

    DOE Patents [OSTI]

    Douglass, S.S.; Green, W.L.

    1980-06-12

    The present invention relates to a machine tool which permits the machining of nonaxisymmetric surfaces on a workpiece while rotating the workpiece about a central axis of rotation. The machine tool comprises a conventional two-slide system (X-Y) with one of these slides being provided with a relatively short travel high-speed auxiliary slide which carries the material-removing tool. The auxiliary slide is synchronized with the spindle speed and the position of the other two slides and provides a high-speed reciprocating motion required for the displacement of the cutting tool for generating a nonaxisymmetric surface at a selected location on the workpiece.

  15. Energy Storage Computational Tool | Open Energy Information

    Open Energy Info (EERE)

    Energy Storage Computational Tool Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Energy Storage Computational Tool AgencyCompany Organization: Navigant Consulting...

  16. LEDSGP/tools | Open Energy Information

    Open Energy Info (EERE)

    Data & Tools Publications Training Knowledge Portals LEDS Benefits Back to top Peer-Learning Tools LEDS Activity and Tool Inventory Our LEDS Activity and Tool Inventory provides...

  17. CDM Sustainable Development Tool | Open Energy Information

    Open Energy Info (EERE)

    fnNI3k2%2Be9hblXIZ7ZPrqk8cV Cost: Free Related Tools Simple Interactive Models for better air quality (SIM-air) Integrated MARKAL-EFOM System (TIMES) Asia-Pacific Integrated Model...

  18. Fan System Assessment Tool | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fan System Assessment Tool Fan System Assessment Tool April 10, 2014 - 3:08pm Addthis Fan System Assessment Tool The Fan System Assessment Tool (FSAT) is a free online software tool that helps industrial users quantify energy use and savings opportunities in industrial fan systems. Use FSAT to understand how well your fan systems are operating, determine the economic benefit of system modifications, and establish which options are most economically viable when multiple opportunities exist for

  19. Cool Farm Tool | Open Energy Information

    Open Energy Info (EERE)

    aboutussuppliersustainablesourcingtools?WT.LHNAV Cost: Free Language: English Cool Farm Tool Screenshot References: Cool Farm Tool 1 Overview "The Cool Farm Tool...

  20. Form:Tool | Open Energy Information

    Open Energy Info (EERE)

    Tool (Redirected from Form:Software Tool) Jump to: navigation, search Input your tool name below to add to the registry. If the tool is already in the registry, you will be able to...

  1. DOD - Preliminary Screening Tool | Open Energy Information

    Open Energy Info (EERE)

    Screening Tool Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: DOD - Preliminary Screening Tool Abstract This webpage contains the DOD...

  2. Crucial Habitat Assessment Tool | Open Energy Information

    Open Energy Info (EERE)

    library Web Site: Crucial Habitat Assessment Tool Abstract The Western Association of Fish and Wildlife Agencies Crucial Habitat Assessment Tool (CHAT) was developed to bring...

  3. Cutting tool form compensation system and method

    DOE Patents [OSTI]

    Barkman, W.E.; Babelay, E.F. Jr.; Klages, E.J.

    1993-10-19

    A compensation system for a computer-controlled machining apparatus having a controller and including a cutting tool and a workpiece holder which are movable relative to one another along a preprogrammed path during a machining operation utilizes a camera and a vision computer for gathering information at a preselected stage of a machining operation relating to the actual shape and size of the cutting edge of the cutting tool and for altering the preprogrammed path in accordance with detected variations between the actual size and shape of the cutting edge and an assumed size and shape of the cutting edge. The camera obtains an image of the cutting tool against a background so that the cutting tool and background possess contrasting light intensities, and the vision computer utilizes the contrasting light intensities of the image to locate points therein which correspond to points along the actual cutting edge. Following a series of computations involving the determining of a tool center from the points identified along the tool edge, the results of the computations are fed to the controller where the preprogrammed path is altered as aforedescribed. 9 figures.

  4. Cutting tool form compensaton system and method

    DOE Patents [OSTI]

    Barkman, William E.; Babelay, Jr., Edwin F.; Klages, Edward J.

    1993-01-01

    A compensation system for a computer-controlled machining apparatus having a controller and including a cutting tool and a workpiece holder which are movable relative to one another along a preprogrammed path during a machining operation utilizes a camera and a vision computer for gathering information at a preselected stage of a machining operation relating to the actual shape and size of the cutting edge of the cutting tool and for altering the preprogrammed path in accordance with detected variations between the actual size and shape of the cutting edge and an assumed size and shape of the cutting edge. The camera obtains an image of the cutting tool against a background so that the cutting tool and background possess contrasting light intensities, and the vision computer utilizes the contrasting light intensities of the image to locate points therein which correspond to points along the actual cutting edge. Following a series of computations involving the determining of a tool center from the points identified along the tool edge, the results of the computations are fed to the controller where the preprogrammed path is altered as aforedescribed.

  5. Vehicle Technologies Office: Transportation System Analytical Tools |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Modeling, Testing, Data & Results » Vehicle Technologies Office: Transportation System Analytical Tools Vehicle Technologies Office: Transportation System Analytical Tools The Vehicle Technologies Office (VTO) has supported the development of a number of software packages and online tools to model individual vehicles and the overall transportation system. Most of these tools are available for free or a nominal charge. Modeling tools that simulate entire vehicles and

  6. Petroleum Reduction Planning Tool | Open Energy Information

    Open Energy Info (EERE)

    Energy Laboratory Sector: Energy Focus Area: Biomass, Energy Efficiency, Fuels & Efficiency, Hydrogen, Transportation Phase: Prepare a Plan Topics: Analysis Tools,...

  7. System analysis: Developing tools for the future

    SciTech Connect (OSTI)

    De Jong, K.; clever, J.; Draper, J.V.; Davies, B.; Lonks, A.

    1996-02-01

    This report introduces and evaluates system analysis tools that were developed, or are under development, for the Robotics Technology Development Program (RTDP). Additionally, it discusses system analysis work completed using these tools aimed at completing a system analysis of the retrieval of waste from underground storage tanks on the Hanford Reservation near Richland, Washington. The tools developed and evaluated include a mixture of commercially available tools adapted to RTDP requirements, and some tools developed in house. The tools that are included in this report include: a Process Diagramming Tool, a Cost Modeling Tool, an Amortization Modeling Tool, a graphical simulation linked to the Cost Modeling Tool, a decision assistance tool, and a system thinking tool. Additionally, the importance of performance testing to the RTDP and the results of such testing executed is discussed. Further, the results of the Tank Waste Retrieval (TWR) System Diagram, the TWR Operations Cost Model, and the TWR Amortization Model are presented, and the implication of the results are discussed. Finally, the RTDP system analysis tools are assessed and some recommendations are made regarding continuing development of the tools and process.

  8. Property:Tool Users | Open Energy Information

    Open Energy Info (EERE)

    "Tool Users" Showing 1 page using this property. N National Residential Efficiency Measures Database + The National Residential Efficiency Measures Database is a publicly...

  9. Property:ToolComplexity | Open Energy Information

    Open Energy Info (EERE)

    Fuel and Advanced Technology Vehicles Pilot Program Emissions Benefit Tool + Simple Alternative Fuels Data Center + Not Available Alternative Fuels and Advanced Vehicles Data...

  10. Smart Grid Computational Tool | Open Energy Information

    Open Energy Info (EERE)

    project benefits. The Smart Grid Computational Tool employs the benefit analysis methodology that DOE uses to evaluate the Recovery Act smart grid projects. How it works: The...

  11. Home Energy Scoring Tool | Open Energy Information

    Open Energy Info (EERE)

    Tool AgencyCompany Organization: Lawrence Berkeley National Laboratory Sector: Energy Focus Area: Buildings - Residential Phase: Evaluate Effectiveness and Revise as Needed...

  12. BCHP Screening Tool | Open Energy Information

    Open Energy Info (EERE)

    Screening Tool AgencyCompany Organization: Oak Ridge National Laboratory Sector: Energy Focus Area: Buildings, Industry Phase: Determine Baseline, Develop Goals Resource...

  13. Climate Compatible Development Tools | Open Energy Information

    Open Energy Info (EERE)

    Development Studies (IDS) Sector: Climate, Energy Website: www.climateplanning.org Language: English References: Tools Directory1 This article is a stub. You can help OpenEI...

  14. Biopower Tool Webinar | Open Energy Information

    Open Energy Info (EERE)

    of Energy, Centro de Energas Renovables (CER) Sector: Energy Focus Area: Biomass, - Biofuels Resource Type: Maps, Training materials, Webinar References: Biopower Tool Webinar1...

  15. Geothermal Properties Measurement Tool | Open Energy Information

    Open Energy Info (EERE)

    Measurement tool was developed at Oak Ridge National Laboratory for geothermal heat pump (GHP) designers and installers to better determine the geothermal properties of a...

  16. Category:EERE Tools | Open Energy Information

    Open Energy Info (EERE)

    including published analyses, energy data and maps, and analysis tools such as models, software, and calculators. While the website provides links to select and important energy...

  17. Screening Tools and Guidelines | Open Energy Information

    Open Energy Info (EERE)

    http:www.undp.orgclimatechangelibrary.shtml. Also available on the Adaptation Learning Mechanism website, under 'Guidance and Tools' or using the search engine:...

  18. Information Technology Tools for Multifamily Building Programs | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Information Technology Tools for Multifamily Building Programs Information Technology Tools for Multifamily Building Programs Better Buildings Neighborhood Program Multifamily / Low-Income Peer Exchange Call: Information Technology Tools for Multifamily Building Programs, Call Slides and Discussion Summary, March 15, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Moving Multifamily Buildings From Assessments to Upgrades Structuring Rebate and

  19. The risk assessment information system

    SciTech Connect (OSTI)

    Kerr, S.B.; Bonczek, R.R.; McGinn, C.W.; Land, M.L.; Bloom, L.D.; Sample, B.E.; Dolislager, F.G.

    1998-06-01

    In an effort to provide service-oriented environmental risk assessment expertise, the Department of Energy (DOE) Center for Risk Excellence (CRE) and DOE Oak Ridge Operations Office (ORO) are sponsoring Oak Ridge National Laboratory (ORNL) to develop a web-based system for disseminating risk tools and information to its users. This system, the Risk Assessment Information System (RAIS), was initially developed to support the site-specific needs of the DOE-ORO Environmental Restoration Risk Assessment Program. With support from the CRE, the system is currently being expanded to benefit all DOE risk information users and can be tailored to meet site-specific needs. Taking advantage of searchable and executable databases, menu-driven queries, and data downloads, using the latest World Wide Web technologies, the RAIS offers essential tools that are used in the risk assessment process or anywhere from project scoping to implementation. The RAIS tools can be located directly at http://risk.lsd.ornl.gov/homepage/rap{_}tool.htm or through the CRE`s homepage at http://www.doe.gov/riskcenter/home.html.

  20. PowerTools | Open Energy Information

    Open Energy Info (EERE)

    User Interface: Website Website: www.sdge.comusing-green-button-connect-my-data Language: English PowerTools Screenshot References: SDG&E1 Use to check recent energy use,...

  1. Management System Verification (MSV) Tool

    Broader source: Energy.gov [DOE]

    The MSV process developed by ACC is a tool (not a requirement) that DOE sites may consider to help determine whether their ES&H program is truly integrated into all work at all levels by all employees.

  2. Information extraction system

    DOE Patents [OSTI]

    Lemmond, Tracy D; Hanley, William G; Guensche, Joseph Wendell; Perry, Nathan C; Nitao, John J; Kidwell, Paul Brandon; Boakye, Kofi Agyeman; Glaser, Ron E; Prenger, Ryan James

    2014-05-13

    An information extraction system and methods of operating the system are provided. In particular, an information extraction system for performing meta-extraction of named entities of people, organizations, and locations as well as relationships and events from text documents are described herein.

  3. Pumping System Assessment Tool Overview | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pumping System Assessment Tool Overview Pumping System Assessment Tool Overview This power point presentation provides an overview of AMO's pumping system assessment tool (PSAT) ...

  4. RAPID/Tools | Open Energy Information

    Open Energy Info (EERE)

    RAPIDTools < RAPID(Redirected from RAPIDResources) Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal...

  5. RAPID/Tools | Open Energy Information

    Open Energy Info (EERE)

    Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History RAPIDTools < RAPID Jump to: navigation, search RAPID Regulatory and Permitting Information...

  6. Environmental geographic information system.

    SciTech Connect (OSTI)

    Peek, Dennis; Helfrich, Donald Alan; Gorman, Susan

    2010-08-01

    This document describes how the Environmental Geographic Information System (EGIS) was used, along with externally received data, to create maps for the Site-Wide Environmental Impact Statement (SWEIS) Source Document project. Data quality among the various classes of geographic information system (GIS) data is addressed. A complete listing of map layers used is provided.

  7. Arizona Online Environmental Review Tool | Open Energy Information

    Open Energy Info (EERE)

    Online Environmental Review ToolInfo GraphicMapChart Abstract The Arizona Game and Fish Department's Heritage Data Management System (HDMS) and Project Evaluation Program...

  8. Information systems definition architecture

    SciTech Connect (OSTI)

    Calapristi, A.J.

    1996-06-20

    The Tank Waste Remediation System (TWRS) Information Systems Definition architecture evaluated information Management (IM) processes in several key organizations. The intent of the study is to identify improvements in TWRS IM processes that will enable better support to the TWRS mission, and accommodate changes in TWRS business environment. The ultimate goals of the study are to reduce IM costs, Manage the configuration of TWRS IM elements, and improve IM-related process performance.

  9. Network Information System

    Energy Science and Technology Software Center (OSTI)

    1996-05-01

    The Network Information System (NWIS) was initially implemented in May 1996 as a system in which computing devices could be recorded so that unique names could be generated for each device. Since then the system has grown to be an enterprise wide information system which is integrated with other systems to provide the seamless flow of data through the enterprise. The system Iracks data for two main entities: people and computing devices. The following aremore » the type of functions performed by NWIS for these two entities: People Provides source information to the enterprise person data repository for select contractors and visitors Generates and tracks unique usernames and Unix user IDs for every individual granted cyber access Tracks accounts for centrally managed computing resources, and monitors and controls the reauthorization of the accounts in accordance with the DOE mandated interval Computing Devices Generates unique names for all computing devices registered in the system Tracks the following information for each computing device: manufacturer, make, model, Sandia property number, vendor serial number, operating system and operating system version, owner, device location, amount of memory, amount of disk space, and level of support provided for the machine Tracks the hardware address for network cards Tracks the P address registered to computing devices along with the canonical and alias names for each address Updates the Dynamic Domain Name Service (DDNS) for canonical and alias names Creates the configuration files for DHCP to control the DHCP ranges and allow access to only properly registered computers Tracks and monitors classified security plans for stand-alone computers Tracks the configuration requirements used to setup the machine Tracks the roles people have on machines (system administrator, administrative access, user, etc...) Allows systems administrators to track changes made on the machine (both hardware and software) Generates an adjustment history of changes on selected fields« less

  10. Gasification Systems Project Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Information Gasifier Optimization Archived Projects Agreement Number Project Title Performer Name Technology Area FE0023497 Alstom's Limestone Chemical Looping Gasification Process for High Hydrogen Syngas Generation Alstom Power, Inc Gasification Systems FE0023577 Advanced Gasifier and Water Gas Shift Technologies for Low Cost Coal Conversion to High Hydrogen Syngas Gas Technology Institute Coal & Coal-Biomass to Liquids, Gasification Systems FE0023915 Pilot Scale Operation and

  11. Fan System Assessment Tool Fact Sheet | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact Sheet Fan System Assessment Tool Fact Sheet Fact sheet describing how industrial plants can improve their fan system performance using AMO's Fan System Assessment Tool (FSAT). PDF icon Fan System Assessment Tool Fact Sheet (August 2010) More Documents & Publications Fan System Assessment Tool Introduction Save Energy Now in Your Motor-Driven Systems Save Energy Now in Your Steam Systems

  12. Marginal Abatement Cost Tool (MACTool) | Open Energy Information

    Open Energy Info (EERE)

    also determines which economic sectors would be likely to respond to a given carbon price, thus assessing the effectiveness of a cap-and-trade system. When to Use This Tool...

  13. Fan System Assessment Tool User Manual | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    User Manual Fan System Assessment Tool User Manual This user manual will help users understand how to use AMO's Fan System Assessment Tool. PDF icon Fan System Assessment Tool User ...

  14. Fan System Assessment Tool Introduction | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fan System Assessment Tool Introduction Fan System Assessment Tool Introduction This presentation provides an introduction to the Fan System Assessment Tool (FSAT). With FSAT, users can calculate the amount of energy used by their fan system; determine system efficiency; and quantify the savings potential of an upgraded system. PDF icon Fan System Assessment Tool Introduction (March 12, 2007) More Documents & Publications Webinars Fan System Assessment Tool Fact Sheet Fan System Assessment

  15. Geographic Information System | Open Energy Information

    Open Energy Info (EERE)

    Exploration, Tracers Data Analysis, And Enhanced Data Distribution, Visualization, And Management Geographic Information System At Brady Hot Springs Area (Laney, 2005) Brady Hot...

  16. Analytical Tool Development for Aftertreatment Sub-Systems Integration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tool Development for Aftertreatment Sub-Systems Integration Analytical Tool Development for Aftertreatment Sub-Systems Integration 2003 DEER Conference Presentation: Detroit Diesel ...

  17. Design tools for complex dynamic security systems.

    SciTech Connect (OSTI)

    Byrne, Raymond Harry; Rigdon, James Brian; Rohrer, Brandon Robinson; Laguna, Glenn A.; Robinett, Rush D. III; Groom, Kenneth Neal; Wilson, David Gerald; Bickerstaff, Robert J.; Harrington, John J.

    2007-01-01

    The development of tools for complex dynamic security systems is not a straight forward engineering task but, rather, a scientific task where discovery of new scientific principles and math is necessary. For years, scientists have observed complex behavior but have had difficulty understanding it. Prominent examples include: insect colony organization, the stock market, molecular interactions, fractals, and emergent behavior. Engineering such systems will be an even greater challenge. This report explores four tools for engineered complex dynamic security systems: Partially Observable Markov Decision Process, Percolation Theory, Graph Theory, and Exergy/Entropy Theory. Additionally, enabling hardware technology for next generation security systems are described: a 100 node wireless sensor network, unmanned ground vehicle and unmanned aerial vehicle.

  18. Library Tools, Office of Scientific and Technical Information, USDOE

    Office of Scientific and Technical Information (OSTI)

    Library Tools Department of Energy library tools are provided as a free service to librarians and the library community to expand access to and use of DOE scientific research results: DOE MARC Records System provides Machine-Readable Cataloging (MARC) records for full-text research reports for downloading directly into library catalogs. Open Archives Initiative (OAI) Server allows harvesting of XML format metadata for DOE's full-text research reports. XML Data Services are available to search

  19. Carbon Value Analysis Tool (CVAT) | Open Energy Information

    Open Energy Info (EERE)

    Value Analysis Tool (CVAT) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Carbon Value Analysis Tool (CVAT) AgencyCompany Organization: World Resources Institute...

  20. Water Energy Load Profiling (WELP) Tool | Open Energy Information

    Open Energy Info (EERE)

    Load Profiling (WELP) Tool Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Water Energy Load Profiling (WELP) Tool AgencyCompany Organization: California Public...

  1. Hydrogen Demand and Resource Assessment Tool | Open Energy Information

    Open Energy Info (EERE)

    Resource Assessment Tool Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Hydrogen Demand and Resource Assessment Tool AgencyCompany Organization: National Renewable...

  2. Climate Analysis Indicators Tool (CAIT) | Open Energy Information

    Open Energy Info (EERE)

    Climate Analysis Indicators Tool (CAIT) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: WRI Climate Analysis Indicators Tool AgencyCompany Organization: World...

  3. Climate Analysis Indicators Tool (CAIT) | Open Energy Information

    Open Energy Info (EERE)

    Climate Analysis Indicators Tool (CAIT) (Redirected from WRI Climate Analysis Indicators Tool) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: WRI Climate Analysis...

  4. Climate Analysis Indicators Tool (CAIT) | Open Energy Information

    Open Energy Info (EERE)

    Climate Analysis Indicators Tool (CAIT) (Redirected from Climate Analysis Indicators Tool) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: WRI Climate Analysis...

  5. Information Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Systems Information Systems Condition Assessment Information System (CAIS) Inspection or assessment data is loaded into the Condition Assessment Information System (CAIS) Web database where it is costed using various RS Means Construction Cost Book data. RS Means is the predominant national cost estimating system. Currently CAIS Web contains over 53,000 line items dealing with building elements, components, and types and other structure and facilities, and infrastructure systems.

  6. Dynamic Information Architecture System

    Energy Science and Technology Software Center (OSTI)

    1997-02-12

    The Dynamic Information System (DIAS) is a flexible object-based software framework for concurrent, multidiscplinary modeling of arbitrary (but related) processes. These processes are modeled as interrelated actions caused by and affecting the collection of diverse real-world objects represented in a simulation. The DIAS architecture allows independent process models to work together harmoniously in the same frame of reference and provides a wide range of data ingestion and output capabilities, including Geographic Information System (GIS) typemore » map-based displays and photorealistic visualization of simulations in progress. In the DIAS implementation of the object-based approach, software objects carry within them not only the data which describe their static characteristics, but also the methods, or functions, which describe their dynamic behaviors. There are two categories of objects: (1) Entity objects which have real-world counterparts and are the actors in a simulation, and (2) Software infrastructure objects which make it possible to carry out the simulations. The Entity objects contain lists of Aspect objects, each of which addresses a single aspect of the Entity''s behavior. For example, a DIAS Stream Entity representing a section of a river can have many aspects correspondimg to its behavior in terms of hydrology (as a drainage system component), navigation (as a link in a waterborne transportation system), meteorology (in terms of moisture, heat, and momentum exchange with the atmospheric boundary layer), and visualization (for photorealistic visualization or map type displays), etc. This makes it possible for each real-world object to exhibit any or all of its unique behaviors within the context of a single simulation.« less

  7. Pumping System Assessment Tool Overview | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    tool (PSAT) that is used during energy savings assessments at large industrial facilities. ... Pumping System Assessment Tool Fact Sheet Energy Savings Opportunities in Control Valves

  8. Evaluation of System Level Modeling and Simulation Tools in Support...

    Energy Savers [EERE]

    Tools in Support of Savannah River Site Liquid Waste Process Evaluation of System Level Modeling and Simulation Tools in Support of Savannah River Site Liquid Waste ...

  9. The Integrated Waste Tracking System - A Flexible Waste Management Tool

    SciTech Connect (OSTI)

    Anderson, Robert Stephen

    2001-02-01

    The US Department of Energy (DOE) Idaho National Engineering and Environmental Laboratory (INEEL) has fully embraced a flexible, computer-based tool to help increase waste management efficiency and integrate multiple operational functions from waste generation through waste disposition while reducing cost. The Integrated Waste Tracking System (IWTS)provides comprehensive information management for containerized waste during generation,storage, treatment, transport, and disposal. The IWTS provides all information necessary for facilities to properly manage and demonstrate regulatory compliance. As a platformindependent, client-server and Web-based inventory and compliance system, the IWTS has proven to be a successful tracking, characterization, compliance, and reporting tool that meets the needs of both operations and management while providing a high level of management flexibility.

  10. Category:Geographic Information System | Open Energy Information

    Open Energy Info (EERE)

    Geographic Information System Jump to: navigation, search Geothermalpower.jpg Looking for the Geographic Information System page? For detailed information on Geographic Information...

  11. European Commission Impact Assessment Tools | Open Energy Information

    Open Energy Info (EERE)

    Publications, Softwaremodeling tools User Interface: Other Website: iatools.jrc.ec.europa.eubinviewIQToolWebHome.html IPTS-IA Tools Screenshot References: IPTS-IA Tools1...

  12. Facilities Information Management System (FIMS)

    Broader source: Energy.gov [DOE]

     FIMS is DOE’s corporate database for real property as required by DOE Order 430.1B, Real Property Asset Management. The system provides DOE with an accurate inventory and management tool that...

  13. EcoDog Green Button Tool | Open Energy Information

    Open Energy Info (EERE)

    Green Button Tool Jump to: navigation, search Tool Summary LAUNCH TOOL Name: EcoDog Green Button Tool AgencyCompany Organization: EcoDog Sector: Energy Focus Area: Energy...

  14. Project Management Information Systems (PMIS) | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Project Management Information Systems (PMIS) Project Management Information Systems (PMIS) Project Management Information Systems (PMIS) In today's day and age, Information ...

  15. Pumping System Assessment Tool Fact Sheet | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact Sheet Pumping System Assessment Tool Fact Sheet This fact sheet describes how industrial plants can improve their pumping system efficiency using AMO's Pumping System ...

  16. Tool and Calculator (Transit, Fuel) | Open Energy Information

    Open Energy Info (EERE)

    Transit & Infrastructure Topics: Analysis Tools Resource Type: Reports, Journal Articles, & Tools Website: www.publictransportation.orgtoolsPagesdefault.aspx This webside...

  17. Co-benefits Evaluation Tools | Open Energy Information

    Open Energy Info (EERE)

    Interface: Spreadsheet ComplexityEase of Use: Simple Website: tools.ias.unu.edu Cost: Free Related Tools Simplified Approach for Estimating Impacts of Electricity Generation...

  18. Mid States Tool and Machine Inc | Open Energy Information

    Open Energy Info (EERE)

    Tool and Machine Inc Jump to: navigation, search Name: Mid States Tool and Machine Inc Place: decatur, Indiana Zip: 46733 Sector: Services Product: Provides engineering and...

  19. Jiangsu Yawei Machine Tool Co | Open Energy Information

    Open Energy Info (EERE)

    Yawei Machine Tool Co Jump to: navigation, search Name: Jiangsu Yawei Machine Tool Co Place: Jiangsu Province, China Product: Chinese sheet matal fabrication industry manufacturer....

  20. LEDSGP/Agriculture Work Space/Tools | Open Energy Information

    Open Energy Info (EERE)

    LEDSGPAgriculture Work SpaceTools < LEDSGP(Redirected from Agriculture Work SpaceTools) Jump to: navigation, search Low Emission Development Strategies Global Partnership...

  1. SEAD Street Lighting Evaluation Tool | Open Energy Information

    Open Energy Info (EERE)

    Name: SEAD Street Lighting Evaluation Tool AgencyCompany Organization: SEAD Sector: Energy Focus Area: Energy Efficiency Resource Type: Softwaremodeling tools User Interface:...

  2. Illustrative Scenarios Tool (European Union) | Open Energy Information

    Open Energy Info (EERE)

    Summary LAUNCH TOOL Name: Illustrative Scenarios Tool (European Union) Focus Area: Propane Topics: Opportunity Assessment & Screening Website: www.eutransportghg2050.eucms...

  3. OpenStudio Policy Analysis Tool | Open Energy Information

    Open Energy Info (EERE)

    OpenEI Keyword(s): Energy Efficiency and Renewable Energy (EERE) Tools Language: English References: Policy Analysis Tool1 Perform simple modeling and analysis by...

  4. LEDSGP/Transportation Toolkit/Tools | Open Energy Information

    Open Energy Info (EERE)

    Toolkit Jump to: navigation, search LEDSGP Logo.png Transportation Toolkit Home Tools Training Request Assistance Tools for Low Emission Development Strategies in Transportation...

  5. NREL-Decision-Support Tools Demonstration | Open Energy Information

    Open Energy Info (EERE)

    TOOL Name: Decision-Support Tools AgencyCompany Organization: National Renewable Energy Laboratory Sector: Energy Topics: Policiesdeployment programs, Pathways analysis,...

  6. Condition Assessment Information System

    Energy Science and Technology Software Center (OSTI)

    2002-09-16

    CAIS2000 records, tracks and cost maintenance deficiencies associated with condition assessments of real property assets. Cost information is available for 39,000 items in the currenht RS Means, Facilities Construction Manual. These costs can, in turn, be rolled by by asset to produce the summary condition of an asset or site.

  7. Project Records Information System (PRIS)

    SciTech Connect (OSTI)

    Smith, P.S.; Schwarz, R.K.

    1990-11-01

    The Project Records Information System (PRIS) is an interactive system developed for the Information Services Division (ISD) of Martin Marietta Energy Systems, Inc., to perform indexing, maintenance, and retrieval of information about Engineering project record documents for which they are responsible. This PRIS User's Manual provides instruction on the use of this system. This manual presents an overview of PRIS, describing the system's purpose; the data that it handles; functions it performs; hardware, software, and access; and help and error functions. This manual describes the interactive menu-driven operation of PRIS. Appendixes A, B, C, and D contain the data dictionary, help screens, report descriptions, and a primary menu structure diagram, respectively.

  8. Tools to Boost Steam System Efficiency, Software Tools for Industry, Industrial Technologies Program (ITP) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-12-01

    This fact sheet describes how the Industrial Technologies Program steam software tools can help industrial plants identify steam system improvements to save energy and money.

  9. Information Systems Engineering

    Broader source: Energy.gov [DOE]

    The OCIO is dedicated to supporting the development and maintenance of DOE Department wide and site-specific software and IT systems engineering initiatives.  This webpage contains resources,...

  10. Information technology equipment cooling system

    DOE Patents [OSTI]

    Schultz, Mark D.

    2014-06-10

    According to one embodiment, a system for removing heat from a rack of information technology equipment may include a sidecar indoor air to liquid heat exchanger that cools warm air generated by the rack of information technology equipment. The system may also include a liquid to liquid heat exchanger and an outdoor heat exchanger. The system may further include configurable pathways to connect and control fluid flow through the sidecar heat exchanger, the liquid to liquid heat exchanger, the rack of information technology equipment, and the outdoor heat exchanger based upon ambient temperature and/or ambient humidity to remove heat from the rack of information technology equipment.

  11. Monitoring and Benchmarking for Energy Information Systems |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Monitoring and Benchmarking for Energy Information Systems Monitoring and Benchmarking for Energy Information Systems Figure 1: Features of a sample CBERD energy information system ...

  12. D and D Knowledge Management Information Tool - 2012 - 12106

    SciTech Connect (OSTI)

    Upadhyay, H.; Lagos, L.; Quintero, W.; Shoffner, P.; DeGregory, J.

    2012-07-01

    Deactivation and decommissioning (D and D) work is a high priority activity across the Department of Energy (DOE) complex. Subject matter specialists (SMS) associated with the different ALARA (As-Low-As-Reasonably-Achievable) Centers, DOE sites, Energy Facility Contractors Group (EFCOG) and the D and D community have gained extensive knowledge and experience over the years in the cleanup of the legacy waste from the Manhattan Project. To prevent the D and D knowledge and expertise from being lost over time from the evolving and aging workforce, DOE and the Applied Research Center (ARC) at Florida International University (FIU) proposed to capture and maintain this valuable information in a universally available and easily usable system. D and D KM-IT provides single point access to all D and D related activities through its knowledge base. It is a community driven system. D and D KM-IT makes D and D knowledge available to the people who need it at the time they need it and in a readily usable format. It uses the World Wide Web as the primary source for content in addition to information collected from subject matter specialists and the D and D community. It brings information in real time through web based custom search processes and its dynamic knowledge repository. Future developments include developing a document library, providing D and D information access on mobile devices for the Technology module and Hotline, and coordinating multiple subject matter specialists to support the Hotline. The goal is to deploy a high-end sophisticated and secured system to serve as a single large knowledge base for all the D and D activities. The system consolidates a large amount of information available on the web and presents it to users in the simplest way possible. (authors)

  13. Chip breaking system for automated machine tool

    DOE Patents [OSTI]

    Arehart, Theodore A.; Carey, Donald O.

    1987-01-01

    The invention is a rotary selectively directional valve assembly for use in an automated turret lathe for directing a stream of high pressure liquid machining coolant to the interface of a machine tool and workpiece for breaking up ribbon-shaped chips during the formation thereof so as to inhibit scratching or other marring of the machined surfaces by these ribbon-shaped chips. The valve assembly is provided by a manifold arrangement having a plurality of circumferentially spaced apart ports each coupled to a machine tool. The manifold is rotatable with the turret when the turret is positioned for alignment of a machine tool in a machining relationship with the workpiece. The manifold is connected to a non-rotational header having a single passageway therethrough which conveys the high pressure coolant to only the port in the manifold which is in registry with the tool disposed in a working relationship with the workpiece. To position the machine tools the turret is rotated and one of the tools is placed in a material-removing relationship of the workpiece. The passageway in the header and one of the ports in the manifold arrangement are then automatically aligned to supply the machining coolant to the machine tool workpiece interface for breaking up of the chips as well as cooling the tool and workpiece during the machining operation.

  14. Integrated risk information system (IRIS)

    SciTech Connect (OSTI)

    Tuxen, L.

    1990-12-31

    The Integrated Risk Information System (IRIS) is an electronic information system developed by the US Environmental Protection Agency (EPA) containing information related to health risk assessment. IRIS is the Agency`s primary vehicle for communication of chronic health hazard information that represents Agency consensus following comprehensive review by intra-Agency work groups. The original purpose for developing IRIS was to provide guidance to EPA personnel in making risk management decisions. This original purpose for developing IRIS was to guidance to EPA personnel in making risk management decisions. This role has expanded and evolved with wider access and use of the system. IRIS contains chemical-specific information in summary format for approximately 500 chemicals. IRIS is available to the general public on the National Library of Medicine`s Toxicology Data Network (TOXNET) and on diskettes through the National Technical Information Service (NTIS).

  15. Property Information System

    Energy Science and Technology Software Center (OSTI)

    1998-01-28

    Provides cradle to grave tracking of DOE property (capital, accountable, etc.). Major functional areas include Acquisitions, Management, Inventory, Accounting, Agreements, Excessing, Dispositions, and Reporting. The Accounting module is not used at this time and may not be operational. A major enhancement added here at Lockheed Martin Energy Systems is the Web-based portion of the system, which allows custodians of property to record location and custodial changes, and to provide inventory confirmations. PLEASE NOTE: Customer mustmore » contact Ben McMurry, (865) 576-5906, Lockheed Martin Energy Ssytems, for help with installation of package. The fee for this installation help will be coordinated by customer and Lockheed Martin and is in addition to the cost of the package from ESTSC. Customer should contact Cheri Cross, (865) 574-6046, for user help.« less

  16. Tool - Vehicle System Simulation (Autonomie) | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tool - Vehicle System Simulation (Autonomie) Tool - Vehicle System Simulation (Autonomie) Autonomie s a most powerful and robust system simulation tool for vehicle energy consumption and performance analysis. Developed in collaboration with General Motors, Autonomie is a MATLAB©-based software environment and framework for automotive control-system design, simulation, and analysis. Its application covers energy consumption, performance analysis throughout the entire vehicle development process

  17. Procurement IT Tools - John Makepeace, Systems Division, OAPM | Department

    Energy Savers [EERE]

    of Energy Procurement IT Tools - John Makepeace, Systems Division, OAPM Procurement IT Tools - John Makepeace, Systems Division, OAPM Topics Discussed: Procurement Systems at the Department of Energy Improving Systems & Processes M&O Subcontract Reporting Capability (MOSRC) Enhancing Reporting Capabilities Promoting Data Quality More... PDF icon Workshop 2015 - Makepeace_Procurement IT Tools.pdf More Documents & Publications Acquisition Letters No. AL 2015-08 POLICY FLASH 2015-35

  18. Information survey for microcomputer systems integration

    SciTech Connect (OSTI)

    Hake, K.A.

    1991-12-01

    One goal of the PM-AIM is to provide US Army Project Managers (PMs) and Project Executive Officers (PEOs) with a fundamental microcomputing resource to help perform acquisition information management and its concomitant reporting requirements. Providing key application software represents one means of accomplishing this goal. This workstation would furnish a broad range of capabilities needed in the PM and PEO office settings as well as software tools for specific project management and acquisition information. Although still in the conceptual phase, the practical result of this exercise in systems integration will likely be a system called the Project Manager's Information System (PMIS) or the AIM workstation. It would include such software as, Project Manager's System Software (PMSS), Defense Acquisition Executive Summary (DAES), and Consolidated Acquisition Reporting System (CARS) and would conform to open systems architecture as accepted by the Department of Defense. ORNL has assisted PM-AIM in the development of technology ideas for the PMIS workstation concept. This paper represents the compilation of information gained during this process. This information is presented as a body of knowledge (or knowledge domain) defining the complex technology of microcomputing. The concept of systems integration or tying together all hardware and software components reflects the nature of PM-AIM's task in attempting to field a PMIS or AIM workstation.

  19. Information survey for microcomputer systems integration

    SciTech Connect (OSTI)

    Hake, K.A.

    1991-12-01

    One goal of the PM-AIM is to provide US Army Project Managers (PMs) and Project Executive Officers (PEOs) with a fundamental microcomputing resource to help perform acquisition information management and its concomitant reporting requirements. Providing key application software represents one means of accomplishing this goal. This workstation would furnish a broad range of capabilities needed in the PM and PEO office settings as well as software tools for specific project management and acquisition information. Although still in the conceptual phase, the practical result of this exercise in systems integration will likely be a system called the Project Manager`s Information System (PMIS) or the AIM workstation. It would include such software as, Project Manager`s System Software (PMSS), Defense Acquisition Executive Summary (DAES), and Consolidated Acquisition Reporting System (CARS) and would conform to open systems architecture as accepted by the Department of Defense. ORNL has assisted PM-AIM in the development of technology ideas for the PMIS workstation concept. This paper represents the compilation of information gained during this process. This information is presented as a body of knowledge (or knowledge domain) defining the complex technology of microcomputing. The concept of systems integration or tying together all hardware and software components reflects the nature of PM-AIM`s task in attempting to field a PMIS or AIM workstation.

  20. System for Information Discovery

    Energy Science and Technology Software Center (OSTI)

    1998-09-25

    SID characterizes natural language based documents so that they may be related and retrieved based on content similarity. This technology processes textual documents, autonoumsly identifies the major topics of the document set, and constructs an interpretable, high dimensional representation of each document. SID also provides the ability to interactively reweight representations based on user need, so users may analyze the dataset from multiple points of view. The particular advantages SID offers are speed, data compression,more » flexibility in representation, and incremental processing. SPIRE consists of software for visual analysis of text-based information sources. This technology enables users to make discoveries about the content of very large sets of textual documents without requiring the user to read or presort the documents. It employs algorithms for text and word proximity analysis to identify the key themes within the documents. The results of this analysis are projected onto a visual spatial proximity display (Galaxies or Themescape) where document proximity represents the degree of relatedness of theme.« less

  1. Help:Add a Tool or Program | Open Energy Information

    Open Energy Info (EERE)

    it is best practice to include the organization's acronym that created the tool. (e.g., NREL-Sample Tool) Note: If you are adding a program that is country specific, it is...

  2. CHAT: Crucial Habitat Assessment Tools | Open Energy Information

    Open Energy Info (EERE)

    CHAT: Crucial Habitat Assessment Tools Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: CHAT: Crucial Habitat Assessment ToolsInfo GraphicMapChart Abstract...

  3. Form:Community Energy Tools | Open Energy Information

    Open Energy Info (EERE)

    Form Edit History Form:Community Energy Tools Jump to: navigation, search This is the 'Community Energy Tools' form. To add a page with this form, enter the page name below; if a...

  4. UNEP-Bioenergy Decision Support Tool | Open Energy Information

    Open Energy Info (EERE)

    Free Equivalent URI: cleanenergysolutions.orgcontentbioenergy-decision-support-tool Language: English DeploymentPrograms: Public-Private Partnerships Regulations: Mandates...

  5. Distributed Wind Site Analysis Tool (DSAT) | Open Energy Information

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentdistributed-wind-site-analysis-tool-d Language: English Policies: Deployment Programs DeploymentPrograms: Technical Assistance The...

  6. Tools

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tools Jon Dugan (acting) ESnet Director 
 Scientific Networking Division Director Inder Monga (Interim) Division Deputy for Technology Department Head for Research and Development Inder Monga Infrastructure Systems Brooklin Gore Office of the CTO Inder Monga Network Engineering and Operations TBD Advanced Network Technologies Brian Tierney Department Head for Networking and Systems Patty Giuntoli Division Deputy for Operations Susan Lucas Cybersecurity Denise Sumikawa Science Engagement Lauren

  7. Western Renewable Energy Generation Information System | Open...

    Open Energy Info (EERE)

    Renewable Energy Generation Information System Jump to: navigation, search Name: Western Renewable Energy Generation Information System Place: Sacramento, California Zip:...

  8. Information system revives materials management

    SciTech Connect (OSTI)

    Hansen, T.

    1995-12-01

    Through a change in philosophy and the development of a new, more efficient information management system, Arizona Public Service Co. (APSW) has, in less than two years, reduced material and service costs by 10 percent. The utility plans to cut these costs form 1993 figures by 25 percent before 2000. The utility is breaking new ground with ongoing implementation of new business processes and the new Materials Logistics Information System (MLIS), which has been co-developed with Texas Instruments Software Division (TISD).

  9. Modulated Tool-Path (MTP) Chip Breaking System - Energy Innovation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Technologies Industrial Technologies Find More Like This Return to Search Modulated Tool-Path (MTP) Chip Breaking System Y-12 National Security Complex Contact Y12 About...

  10. Pantex Develops Tooling System To Save Time, Money | National...

    National Nuclear Security Administration (NNSA)

    WASHINGTON, D.C. - The National Nuclear Security Administration (NNSA) today announced that its Pantex Plant in Amarillo, Texas, has created a special tooling system designed to ...

  11. Wireline system for multiple direct push tool usage

    DOE Patents [OSTI]

    Bratton, Wesley L.; Farrington, Stephen P.; Shinn, II, James D.; Nolet, Darren C.

    2003-11-11

    A tool latching and retrieval system allows the deployment and retrieval of a variety of direct push subsurface characterization tools through an embedded rod string during a single penetration without requiring withdrawal of the string from the ground. This enables the in situ interchange of different tools, as well as the rapid retrieval of soil core samples from multiple depths during a single direct push penetration. The system includes specialized rods that make up the rod string, a tool housing which is integral to the rod string, a lock assembly, and several tools which mate to the lock assembly.

  12. TWRS systems engineering process and information model report

    SciTech Connect (OSTI)

    Gneiting, B.C., Westinghouse Hanford

    1996-05-22

    The TWRS System Engineering (SE) process and information flows are described using a process modeling methodology. The results of this activity, and the next phase of developing a normalized data model, will be used in training and implemented in SE information systems and support tools.

  13. Property:CommunityEnergyToolType | Open Energy Information

    Open Energy Info (EERE)

    Showing 1 page using this property. N National Residential Efficiency Measures Database + Modeling Tool + Retrieved from "http:en.openei.orgw...

  14. High-Temperature Downhole Tools | Open Energy Information

    Open Energy Info (EERE)

    and Analysis of Geothermal Technologies Albuquerque, NM 941,000 941,000 Feasibility and Design for a High-Temperature Downhole Tool Tennessee Oak Ridge National...

  15. Category:EERE Analysis Tools | Open Energy Information

    Open Energy Info (EERE)

    policymakers can access energy analysis products related to renewable energy and energy efficiency, including published analyses, energy data and maps, and analysis tools such as...

  16. Category:Community Energy Tools | Open Energy Information

    Open Energy Info (EERE)

    Finance H Hara Environmental and Energy Management Solution HOMER Hybrid Car Calculator Hydrogen Demand and Resource Assessment Tool I ICLEI and REN21 Local Renewables Web Portal...

  17. CRiSTAL Project Management Tool | Open Energy Information

    Open Energy Info (EERE)

    modeling tools User Interface: Spreadsheet Website: www.iisd.orgcristaltool Cost: Free Language: "English, French, Portuguese, Spanish; Castilian" is not in the list of...

  18. LEDSGP/Agriculture Work Space/Tools | Open Energy Information

    Open Energy Info (EERE)

    LEDSGPAgriculture Work SpaceTools < LEDSGP Jump to: navigation, search Low Emission Development Strategies Global Partnership Advancing climate-resilient, low-emission...

  19. Property:OpenEI/Tool/Keyword | Open Energy Information

    Open Energy Info (EERE)

    +, Green Button Apps + Badema + Cleanweb Hackathon +, Boston +, Community Generated + Bioenergy KDF + Energy Efficiency and Renewable Energy (EERE) Tools + Biofuels Techno-Economic...

  20. Benchmarking and Energy Saving Tool | Open Energy Information

    Open Energy Info (EERE)

    User Interface: Spreadsheet Website: industrial-energy.lbl.govnode100 Cost: Free Language: English References: Benchmarking and Energy Saving Tool 1 Logo: Benchmarking and...

  1. Toole County, Montana: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Toole County, Montana: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.6974247, -111.6408212 Show Map Loading map... "minzoom":false,"mappin...

  2. Harmonized Emissions Analysis Tool (HEAT) | Open Energy Information

    Open Energy Info (EERE)

    to support local governments in planning, implementing and monitoring greenhouse gas and air pollution emission reduction programs. LEDSGP green logo.png This tool is included in...

  3. UNDP-Energy Costing Tool | Open Energy Information

    Open Energy Info (EERE)

    Resource Type: Softwaremodeling tools User Interface: Spreadsheet Website: www.undp.orgenergymdg-serv.htm Cost: Free Equivalent URI: cleanenergysolutions.orgcontent...

  4. User:Nlangle/TransportTools | Open Energy Information

    Open Energy Info (EERE)

    Transportation Toolkits & LEDS Global Partnership Tools 49 A Report on Worldwide Hydrogen Bus Demonstrations, 2002-2007 A Review of HOV Lane Performance and Policy Options in...

  5. Project Management Information Systems (PMIS) | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Project Management Information Systems (PMIS) Project Management Information Systems (PMIS) Project Assessment & Reporting System (PARS IIe) Office of Project Management Oversight...

  6. Evolution of toxicology information systems

    SciTech Connect (OSTI)

    Wassom, J.S.; Lu, P.Y.

    1990-12-31

    Society today is faced with new health risk situations that have been brought about by recent scientific and technical advances. Federal and state governments are required to assess the many potential health risks to exposed populations from the products (chemicals) and by-products (pollutants) of these advances. Because a sound analysis of any potential health risk should be based on the use of relevant information, it behooves those individuals responsible for making the risk assessments to know where to obtain needed information. This paper reviews the origins of toxicology information systems and explores the specialized information center concept that was proposed in 1963 as a means of providing ready access to scientific and technical information. As a means of illustrating this concept, the operation of one specialized information center (the Environmental Mutagen Information Center at Oak Ridge National Laboratory) will be discussed. Insights into how toxicological information resources came into being, their design and makeup, will be of value to those seeking to acquire information for risk assessment purposes. 7 refs., 1 fig., 4 tabs.

  7. information systems | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    information systems NNSA's G2 Management Information System Wins Association for Enterprise Information's (AFEI) "Excellence in Enterprise Information Award" The G2 team and the 2015 Association for Enterprise Information's (AFEI) Excellence in Enterprise Information Award. (WASHINGTON, D.C) - The National Nuclear Security Administration (NNSA) has received the 2015 Association for Enterprise Information's (AFEI) Excellence in Enterprise Information

  8. Classified Information Systems Security Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1999-08-03

    This Manual provides requirements and implementation instructions for the graded protection of the confidentiality, integrity, and availability of information processed on all automated information systems used to collect, create, process, transmit, store, and disseminate classified information by, or on behalf of, the Department of Energy (DOE). DOE N 205.4 cancels Chapter III section 8, Incident Reporting, and DOE N 205.3 cancels Chapter VI, paragraph 4j(2), 4j(6); and Chapter VII, paragraph 12a(2)(a). Cancels: DOE M 5639.6A-1. Canceled by DOE M 205.1-4.

  9. Deactivation & Decommissioning Knowledge Management Information Tool (D&D

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    KM-IT) | Department of Energy Knowledge Management Information Tool (D&D KM-IT) Deactivation & Decommissioning Knowledge Management Information Tool (D&D KM-IT) Deactivation & Decommissioning Knowledge Management Information Tool (D&D KM-IT) The Deactivation and Decommissioning Knowledge Management Information Tool (D&D KM-IT) serves as a centralized repository providing a common interface for all D&D related activities. It assists users in gathering, analyzing,

  10. Save Energy at Home Tool | Open Energy Information

    Open Energy Info (EERE)

    how the energy can be reduced through the use of energy efficient products, particularly Energy Star labeled products. This tool helps to analyse the benefits of using Energy Star...

  11. Widget:SolarToolsNavigator | Open Energy Information

    Open Energy Info (EERE)

    should open in (default: bottom-right) acceptable values: bottom-right, bottom-left, top-right, top-left Usage Widget:SolarToolsNavigator|directiontop-right Example...

  12. System for exchanging tools and end effectors on a robot

    DOE Patents [OSTI]

    Burry, D.B.; Williams, P.M.

    1991-02-19

    A system and method for exchanging tools and end effectors on a robot permits exchange during a programmed task. The exchange mechanism is located off the robot, thus reducing the mass of the robot arm and permitting smaller robots to perform designated tasks. A simple spring/collet mechanism mounted on the robot is used which permits the engagement and disengagement of the tool or end effector without the need for a rotational orientation of the tool to the end effector/collet interface. As the tool changing system is not located on the robot arm no umbilical cords are located on robot. 12 figures.

  13. System for exchanging tools and end effectors on a robot

    DOE Patents [OSTI]

    Burry, David B.; Williams, Paul M.

    1991-02-19

    A system and method for exchanging tools and end effectors on a robot permits exchange during a programmed task. The exchange mechanism is located off the robot, thus reducing the mass of the robot arm and permitting smaller robots to perform designated tasks. A simple spring/collet mechanism mounted on the robot is used which permits the engagement and disengagement of the tool or end effector without the need for a rotational orientation of the tool to the end effector/collet interface. As the tool changing system is not located on the robot arm no umbilical cords are located on robot.

  14. Policy Analysis System (Polysys) | Open Energy Information

    Open Energy Info (EERE)

    polysys.html OpenEI Keyword(s): EERE tool, Policy Analysis System, Polysys Language: English References: Agricultural Policy Analysis Center Research Tools1 Model U.S....

  15. High power laser perforating tools and systems

    DOE Patents [OSTI]

    Zediker, Mark S; Rinzler, Charles C; Faircloth, Brian O; Koblick, Yeshaya; Moxley, Joel F

    2014-04-22

    ystems devices and methods for the transmission of 1 kW or more of laser energy deep into the earth and for the suppression of associated nonlinear phenomena. Systems, devices and methods for the laser perforation of a borehole in the earth. These systems can deliver high power laser energy down a deep borehole, while maintaining the high power to perforate such boreholes.

  16. Engineering Design Information System (EDIS)

    SciTech Connect (OSTI)

    Smith, P.S.; Short, R.D.; Schwarz, R.K.

    1990-11-01

    This manual is a guide to the use of the Engineering Design Information System (EDIS) Phase I. The system runs on the Martin Marietta Energy Systems, Inc., IBM 3081 unclassified computer. This is the first phase in the implementation of EDIS, which is an index, storage, and retrieval system for engineering documents produced at various plants and laboratories operated by Energy Systems for the Department of Energy. This manual presents on overview of EDIS, describing the system's purpose; the functions it performs; hardware, software, and security requirements; and help and error functions. This manual describes how to access EDIS and how to operate system functions using Database 2 (DB2), Time Sharing Option (TSO), Interactive System Productivity Facility (ISPF), and Soft Master viewing features employed by this system. Appendix A contains a description of the Soft Master viewing capabilities provided through the EDIS View function. Appendix B provides examples of the system error screens and help screens for valid codes used for screen entry. Appendix C contains a dictionary of data elements and descriptions.

  17. Appropriate Technology Management Information System

    SciTech Connect (OSTI)

    Not Available

    1984-02-01

    From 1978 to 1981, the Department of Energy (DOE) awarded more than 2200 small grants worth more than $25 million to individuals, organizations and small businesses across the nation for the purposes of researching, developing and demonstrating appropriate technologies. Grants were given in the full range of technology areas, including conservation, solar, biomass, wind, geothermal, and hydro power. The final report from each DOE grantee was reviewed in an effort to extract information about new ideas and proven concepts that could be of value to the public. To manage the growing wealth of information from the grant reports, and to monitor the report review process, the Appropriate Technology Management Information System (ATMIS), a computer data base, was developed. The ATMIS can classify data into numerous categories (technology area, geographic location, project status, etc.). This manual was generated directly from the data base.

  18. Energy Signal Tool for Decision Support in Building Energy Systems...

    Office of Scientific and Technical Information (OSTI)

    Signal Tool for Decision Support in Building Energy Systems Henze, G. P.; Pavlak, G. S.; Florita, A. R.; Dodier, R. H.; Hirsch, A. I. 32 ENERGY CONSERVATION, CONSUMPTION, AND...

  19. Natural System Evaluation and Tool Development FY11 Progress Report

    Broader source: Energy.gov [DOE]

    The report describes selected aspects of progress for four major tasks: (1) development of a detailed R&D plan for natural system evaluation and tool development; (2) in-depth analsis of key attributes and new concepts identified in the R&D plan; (3) preliminary demonstration of new modeling and experimental tools; and (4) conceptual design of a databse for natural system evaluation.

  20. Information System Owner (ISO) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Owner (ISO) Information System Owner (ISO) startup-849805_960_720.jpg The Information System Owner (ISO) is responsible for every stage in the lifecycle of an information system, including: procurement development integration modification operation maintenance retirement The ISO is a key contributor in: developing system design specifications testing implementation PDF icon Information System Owner Core Competency Training Worksheet More Documents & Publications Information System Security

  1. Large-Scale Information Systems

    SciTech Connect (OSTI)

    D. M. Nicol; H. R. Ammerlahn; M. E. Goldsby; M. M. Johnson; D. E. Rhodes; A. S. Yoshimura

    2000-12-01

    Large enterprises are ever more dependent on their Large-Scale Information Systems (LSLS), computer systems that are distinguished architecturally by distributed components--data sources, networks, computing engines, simulations, human-in-the-loop control and remote access stations. These systems provide such capabilities as workflow, data fusion and distributed database access. The Nuclear Weapons Complex (NWC) contains many examples of LSIS components, a fact that motivates this research. However, most LSIS in use grew up from collections of separate subsystems that were not designed to be components of an integrated system. For this reason, they are often difficult to analyze and control. The problem is made more difficult by the size of a typical system, its diversity of information sources, and the institutional complexities associated with its geographic distribution across the enterprise. Moreover, there is no integrated approach for analyzing or managing such systems. Indeed, integrated development of LSIS is an active area of academic research. This work developed such an approach by simulating the various components of the LSIS and allowing the simulated components to interact with real LSIS subsystems. This research demonstrated two benefits. First, applying it to a particular LSIS provided a thorough understanding of the interfaces between the system's components. Second, it demonstrated how more rapid and detailed answers could be obtained to questions significant to the enterprise by interacting with the relevant LSIS subsystems through simulated components designed with those questions in mind. In a final, added phase of the project, investigations were made on extending this research to wireless communication networks in support of telemetry applications.

  2. Transmission/Resource Library/GIS Tools | Open Energy Information

    Open Energy Info (EERE)

    wildlife connectivity areas in Montana. The aim of the mapping system is to consider fish, wildlife, and recreational resources earlier on when planning for future development....

  3. Improve Chilled Water System Peformance: Chilled Water System Analysis Tool (CWSAT) Improves Efficiency

    SciTech Connect (OSTI)

    2010-06-25

    This fact sheet describes how the Industrial Technologies Program Chilled Water System Analysis Tool (CWSAT) can help optimize the performance of of industrial chilled water systems.

  4. Peak Treatment Systems | Open Energy Information

    Open Energy Info (EERE)

    Treatment Systems Jump to: navigation, search Name: Peak Treatment Systems Place: Golden, CO Website: www.peaktreatmentsystems.com References: Peak Treatment Systems1 Information...

  5. Technology Assessment Tool - An Application of Systems Engineering to USDOE Technology Proposals

    SciTech Connect (OSTI)

    Rynearson, Michael Ardel

    1999-06-01

    This paper discusses the system design for a Technology Assessment (TA) tool that can be used to quantitatively evaluate new and advanced technologies, products, or processes. Key features of the tool include organization of information in an indentured hierarchy; questions and categories derived from the decomposition of technology performance; segregation of life-cycle issues into six assessment categories; and scoring, relative impact, and sensitivity analysis capability. An advantage of the tool's use is its ability to provide decision analysis data, based on incomplete or complete data.

  6. Data Tools & Models - Data Tools - U.S. Energy Information Administration

    Gasoline and Diesel Fuel Update (EIA)

    (EIA) Developer Announcing EIA's Application Programming Interface (API) The US Energy Information Administration is committed to making its data available through an Application Programming Interface (API) to better serve our customers. APIs allows computers to more easily access our public data. By making EIA data available is this machine readable format, the creativity in the private, the non-profit, and the public sectors can be harnessed to find new ways to analyze and create

  7. Knowledge Discovery, Knowledge Management and Enterprise-Wide Information Technology Tools Final Report

    SciTech Connect (OSTI)

    Patton, Robert M; Symons, Christopher T; Gorman, Bryan L; Treadwell, Jim N

    2012-04-01

    A final report on an ORNL task to establish a knowledge discovery and management tool to retrieve and recommend information from existing S&T documents for the Office of Naval Research Global.

  8. MC&A System Effectiveness Tool (MSET) (Presentation 2)

    SciTech Connect (OSTI)

    Powell, Danny H; Elwood Jr, Robert H

    2011-01-01

    MSET is a self-assessment or inspection tool utilizing probabilistic risk assessment (PRA) methodology to calculate the system effectiveness of a nuclear facility's material control and accountability (MC&A) system. MSET analyzes the effectiveness of an MC&A system based on defined performance metrics for MC&A functions defined based on U.S. and international best practices and regulations. MSET analysis is based on performance of the entire MC&A system including defense-in-depth attributes and sensitivity analysis of changes in the system, both positive and negative. MSET analysis considers: accounting; containment; access control; surveillance capabilities of the system; and other interfaces with the physical protection systems that provide detection of an unauthorized action. MSET performs a system effectiveness calculation evaluation against a defined performance metric. MSET uses PRA techniques to analyze the MC&A system. MSET is a tool for evaluating the system effectiveness of MC&A systems during self-assessment or external inspection. MSET has been developed, tested, and benchmarked by the U.S. DOE. In collaboration with the U.S. DOE, Rosatom is developing a Russian version (MSET-R) planned for pilot implementation at select material balance areas in 2011. MSET has been shown to be an effective training and communication tool for MC&A.

  9. System and method for integrating hazard-based decision making tools and processes

    DOE Patents [OSTI]

    Hodgin, C. Reed

    2012-03-20

    A system and method for inputting, analyzing, and disseminating information necessary for identified decision-makers to respond to emergency situations. This system and method provides consistency and integration among multiple groups, and may be used for both initial consequence-based decisions and follow-on consequence-based decisions. The system and method in a preferred embodiment also provides tools for accessing and manipulating information that are appropriate for each decision-maker, in order to achieve more reasoned and timely consequence-based decisions. The invention includes processes for designing and implementing a system or method for responding to emergency situations.

  10. Geographic Information System At International Geothermal Area...

    Open Energy Info (EERE)

    search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At International Geothermal Area, Indonesia (Nash, Et Al., 2002) Exploration Activity...

  11. Geographic Information System (Monaster And Coolbaugh, 2007)...

    Open Energy Info (EERE)

    navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System (Monaster And Coolbaugh, 2007) Exploration Activity Details Location...

  12. Performance Systems Development | Open Energy Information

    Open Energy Info (EERE)

    Systems Development Jump to: navigation, search Name: Performance Systems Development Place: Ithaca, NY Information About Partnership with NREL Partnership with NREL Yes...

  13. Information Concerning Reliability Impacts under Various System...

    Office of Environmental Management (EM)

    Concerning Reliability Impacts under Various System Configurations of the Mirant Potomac River Plant Information Concerning Reliability Impacts under Various System Configurations ...

  14. Information System Owner | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Information System Owner (also referred to as System Owner) is responsible for the procurement, development, integration, modification, operation, maintenance, and retirement of an...

  15. Nanocoatings for High-Efficiency Industrial Hydraulic and Tooling Systems

    SciTech Connect (OSTI)

    2009-05-01

    This factsheet describes a research project whose goal is to develop degradation-resistant nano-coatings of AlMgB14 and AlMgB14– (titanium diboride) TiB2 that result in improved surface hardness and reduced friction for industrial hydraulic and tooling systems.

  16. pcircle - A Suite of Scalable Parallel File System Tools

    Energy Science and Technology Software Center (OSTI)

    2015-10-01

    Most of the software related to file system are written for conventional local file system, they are serialized and can't take advantage of the benefit of a large scale parallel file system. "pcircle" software builds on top of ubiquitous MPI in cluster computing environment and "work-stealing" pattern to provide a scalable, high-performance suite of file system tools. In particular - it implemented parallel data copy and parallel data checksumming, with advanced features such as asyncmore » progress report, checkpoint and restart, as well as integrity checking.« less

  17. Pipo Systems | Open Energy Information

    Open Energy Info (EERE)

    Pipo Systems Jump to: navigation, search Name: Pipo Systems Place: Spain Product: Spanish wave technology developer. References: Pipo Systems1 This article is a stub. You can...

  18. Redwood Systems | Open Energy Information

    Open Energy Info (EERE)

    Redwood Systems Place: Fremont, California Zip: 94538 Product: Redwood Systems is a Fremont-based technology developer of lighting management systems. Coordinates: 44.2605,...

  19. Energistic Systems | Open Energy Information

    Open Energy Info (EERE)

    Energistic Systems Jump to: navigation, search Logo: Energistic Systems Name: Energistic Systems Address: 13551 W. 43rd Street Dr Place: Golden, Colorado Zip: 80403 Region: Rockies...

  20. Electricity Market Complex Adaptive System | Open Energy Information

    Open Energy Info (EERE)

    Complex Adaptive System Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Electricity Market Complex Adaptive System AgencyCompany Organization: Argonne National...

  1. Motor Systems Efficiency Supply Curves | Open Energy Information

    Open Energy Info (EERE)

    Motor Systems Efficiency Supply Curves Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Motor Systems Efficiency Supply Curves AgencyCompany Organization: United...

  2. Object-oriented Geographic Information System Framework

    Energy Science and Technology Software Center (OSTI)

    2003-03-01

    JeoViewer is an intelligent object-oriented geographic information system (GIS) framework written in Java that provides transparent linkage to any object’s data, behaviors, and optimized spatial geometry representation. Tools are provided for typical GIS functionality, data ingestion, data export, and integration with other frameworks. The primary difference between Jeo Viewer and traditional GIS systems is that traditional GIS systems offer static views of geo-spatial data while JeoViewer can be dynamically coupled to models and live datamore » streams which dynamically change the state of the object which can be immediately represented in JeoViewer. Additionally, JeoViewer’s object-oriented paradigm provides a more natural representation of spatial data. A rich layer hierarchy allows arbitrary grouping of objects based on any relationship as well as the traditional GIS vertical ordering of objects. JeoViewer can run as a standalone product, extended with additional analysis functionality, or embedded in another framework.« less

  3. TWRS information locator database system design description

    SciTech Connect (OSTI)

    Knutson, B.J.

    1996-09-13

    This document gives an overview and description of the Tank Waste Remediation System (TWRS) Information Locator Database (ILD)system design. The TWRS ILD system is an inventory of information used in the TWRS Systems Engineering process to represent the TWRS Technical Baseline. The inventory is maintained in the form of a relational database developed in Paradox 4.5.

  4. Statistical tools for prognostics and health management of complex systems

    SciTech Connect (OSTI)

    Collins, David H; Huzurbazar, Aparna V; Anderson - Cook, Christine M

    2010-01-01

    Prognostics and Health Management (PHM) is increasingly important for understanding and managing today's complex systems. These systems are typically mission- or safety-critical, expensive to replace, and operate in environments where reliability and cost-effectiveness are a priority. We present background on PHM and a suite of applicable statistical tools and methods. Our primary focus is on predicting future states of the system (e.g., the probability of being operational at a future time, or the expected remaining system life) using heterogeneous data from a variety of sources. We discuss component reliability models incorporating physical understanding, condition measurements from sensors, and environmental covariates; system reliability models that allow prediction of system failure time distributions from component failure models; and the use of Bayesian techniques to incorporate expert judgments into component and system models.

  5. Corporate Information Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Corporate Information Systems Corporate Information Systems The mission of the Office of Corporate Information Systems (CF-40) is to plan and manage the design, development, operation and maintenance of the Department's Integrated Management Navigation (iManage) program and projects; identify and implement business process automation initiatives; provide technical support for legacy systems operations and maintenance; provide technical support for web design, development and maintenance; manage

  6. NRG Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: NRG Systems Place: Hinesburg, Vermont Zip: 5461 Sector: Wind energy Product: A US-based manufacturer of wind measurement and turbine...

  7. Hydrothermal System | Open Energy Information

    Open Energy Info (EERE)

    Hydrothermal Systems: A hydrothermal system is one that included fluid, heat, and permeability in a naturally occurring geological formation for the production of electricity....

  8. Chorus Systems | Open Energy Information

    Open Energy Info (EERE)

    Chorus Systems Jump to: navigation, search Name: Chorus Systems Place: Sankt Augustin, Germany Zip: D-53757 Product: Plans and realises PV installations in Germany. References:...

  9. Crystal Systems | Open Energy Information

    Open Energy Info (EERE)

    is located in Salem, Massachusetts. Crystal Systems produces sapphire crystals for optics and electronics, and silicon for photovoltaics. References Crystal Systems...

  10. Megtec Systems | Open Energy Information

    Open Energy Info (EERE)

    "group":"","inlineLabel":"","visitedicon":"" Hide Map References: Megtec Systems1 Methane Capture2 Megtec Systems is a company headquartered in De Pere, Wisconsin. Megtec...

  11. Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    Logo: Solar Systems Name: Solar Systems Address: 45 Grosvenor Street Place: Abbotsford, Australia Sector: Solar Product: Solar concentrators Phone Number: +61 3 9413 8000 Website:...

  12. Socovoltaic Systems | Open Energy Information

    Open Energy Info (EERE)

    Name: Socovoltaic Systems Place: Vicenza, Italy Zip: 36100 Product: Socovoltaic is a joint venture between Socotherm and TSNergy. References: Socovoltaic Systems1 This...

  13. Neptune Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: Neptune Systems Address: PO Box 8719 Place: Breda Zip: 4820 BA Region: Netherlands Sector: Marine and Hydrokinetic Phone Number: +31 (0)...

  14. Environmental remediation and waste management information systems

    SciTech Connect (OSTI)

    Harrington, M.W.; Harlan, C.P.

    1993-12-31

    The purpose of this paper is to document a few of the many environmental information systems that currently exist worldwide. The paper is not meant to be a comprehensive list; merely a discussion of a few of the more technical environmental database systems that are available. Regulatory databases such as US Environmental Protection Agency`s (EPA`s) RODS (Records of Decision System) database [EPA, 1993] and cost databases such as EPA`s CORA (Cost of Remedial Action) database [EPA, 1993] are not included in this paper. Section 2 describes several US Department of Energy (DOE) Environmental Restoration and Waste Management (EM) information systems and databases. Section 3 discusses several US EPA information systems on waste sites and technologies. Section 4 summarizes a few of the European Community environmental information systems, networks, and clearinghouses. And finally, Section 5 provides a brief overview of Geographical Information Systems. Section 6 contains the references, and the Appendices contain supporting information.

  15. Altergy Systems | Open Energy Information

    Open Energy Info (EERE)

    95630 Product: Designs and manufactures proprietary proton exchange membrane (PEM) fuel cell systems. References: Altergy Systems1 This article is a stub. You can help OpenEI by...

  16. Drilling Systems | Open Energy Information

    Open Energy Info (EERE)

    Act: Enhanced Geothermal Systems Component Research and DevelopmentAnalysis Tulsa, OK 2,399,999 600,000 2,999,999 Stinger Enhanced Bits for Engineered Geothermal Systems...

  17. PV Systems | Open Energy Information

    Open Energy Info (EERE)

    PV Systems Place: Wales, United Kingdom Zip: CF15 7JD Product: Welsh building integrated PV (BIPV) company References: PV Systems1 This article is a stub. You can help OpenEI by...

  18. Trip Information Log Tracking System

    Energy Science and Technology Software Center (OSTI)

    1992-06-23

    The system is focused on the Employee Business Travel Event. The system must be able to CRUD (Create, Retrieve, Update, Delete) instances of the Travel Event as well as the ability to CRUD frequent flyer milage associated with airline travel. Additionally the system must provide for a compliance reporting system to monitor reductions in travel costs and lost opportunity costs (i.e., not taking advantage of business class or 7 day advance tickets).

  19. Framework for an Information Visualization System

    Energy Science and Technology Software Center (OSTI)

    2006-08-11

    The Program is a suite of Windows-based software applications and services for ingesting, storing, and analyzing large quantities of disparate inforamtion. The software supports the ingestion and storage of any information that can be represented in eXtensible Markup Language (XML) format. Stored information can be subsequently retrieved via search operations, then "visualized" in multiple ways using a client application that supports a variety of analytical functions. Visualization capabilities include tools for depicting a variety ofmore » relationships that may be present in the information, including geospatial, temporal, topical, categorical, and network relationships.« less

  20. Contact Information Systems | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information Systems Questions about Ames Laboratory network issues, contact networks@ameslab.gov Questions about Ames Laboratory websites, contact webrequest@ameslab.gov To...

  1. E-KIT: An Electronic-Knowledge Information Tool for Organizing Site Information and Improving Technical Communication with Stakeholders - 13082

    SciTech Connect (OSTI)

    Kautsky, Mark; Findlay, Richard C.; Hodges, Rex A.

    2013-07-01

    Managing technical references for projects that have long histories is hampered by the large collection of documents, each of which might contain discrete pieces of information relevant to the site conceptual model. A database application has been designed to improve the efficiency of retrieving technical information for a project. Although many databases are currently used for accessing analytical and geo-referenced data, applications designed specifically to manage technical reference material for projects are scarce. Retrieving site data from the array of available references becomes an increasingly inefficient use of labor. The electronic-Knowledge Information Tool (e-KIT) is designed as a project-level resource to access and communicate technical information. The e-KIT is a living tool that grows as new information becomes available, and its value to the project increases as the volume of site information increases. Having all references assembled in one location with complete reference citations and links to elements of the site conceptual model offers a way to enhance communication with outside groups. The published and unpublished references are incorporated into the e-KIT, while the compendium of references serves as a complete bibliography for the project. (authors)

  2. Reliability review of the remote tool delivery system locomotor

    SciTech Connect (OSTI)

    Chesser, J.B.

    1999-04-01

    The locomotor being built by RedZone Robotics is designed to serve as a remote tool delivery (RID) system for waste retrieval, tank cleaning, viewing, and inspection inside the high-level waste tanks 8D-1 and 8D-2 at West Valley Nuclear Services (WVNS). The RTD systm is to be deployed through a tank riser. The locomotor portion of the RTD system is designed to be inserted into the tank and is to be capable of moving around the tank by supporting itself and moving on the tank internal structural columns. The locomotor will serve as a mounting platform for a dexterous manipulator arm. The complete RTD system consists of the locomotor, dexterous manipulator arm, cameras, lights, cables, hoses, cable/hose management system, power supply, and operator control station.

  3. Paradyme Systems | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Paradyme Systems Region: United States Sector: Marine and Hydrokinetic Website: http: This company is listed in the Marine and Hydrokinetic...

  4. Passiv Systems | Open Energy Information

    Open Energy Info (EERE)

    Place: England, United Kingdom Zip: RG14 2PZ Product: UK based developer of a home energy management system, covering heating, hot water and electrical appliances....

  5. KUKA Systems | Open Energy Information

    Open Energy Info (EERE)

    search Name: KUKA Systems Place: Augsburg, Germany Zip: D-86165 Sector: Solar, Wind energy Product: German manufacturer of assembly lines for solar and wind industries....

  6. Vitex Systems | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Name: Vitex Systems Place: San Jose, California Zip: CA 95131 USA Product: Production of OLEDs and commercialization of flat panel displays (FPDs)...

  7. Arisdyne Systems | Open Energy Information

    Open Energy Info (EERE)

    Cleveland, Ohio Zip: 44142 Product: Arisdyne Systems is a former subsidiary of Five Star Technologies that concentrates on development of biofuel processing technologies,...

  8. Verno Systems | Open Energy Information

    Open Energy Info (EERE)

    search Name: Verno Systems Place: Redmond, Washington State Zip: 98052 Sector: Biofuels Product: California-based investment fund focused on biofuels. References: Verno...

  9. Hydrothermal System | Open Energy Information

    Open Energy Info (EERE)

    of the underlying resource.1 Occurrence Models "To search efficiently for blind geothermal systems, general geographic regions must first be identified based upon...

  10. Disposal Systems Evaluations and Tool Development - Engineered Barrier System Evaluation (Work Package LL1015080425)

    SciTech Connect (OSTI)

    Blink, J A; Buscheck, T A; Halsey, W G; Wolery, T

    2010-03-19

    The Disposal Systems Evaluation Framework (DSEF) will use a logical process for developing one or more disposal system concepts (also referred to as repository system in this report) for any given waste form and geologic setting combination. In the Features, Events, and Processes (FEPs) group of work packages, there are seven categories of waste forms and eight categories of geologic setting being studied. The DSEF will also establish a Used Fuel Disposition Campaign (UFDC) knowledge management system to organize high-level information, data, and assumptions, thereby facilitating consistency in high-level system simulation and economic analyses. This system likely will be housed with the INL-based documentation system. Attention is given to lessons oearned from the systems used at the Waste Isolation Pilot Plant (WIPP) and the Yucca Mountain Project (YMP). Where reference material from other programs (e.g., international) is used or cited, the knowledge-management system imports the reference material directly or refer to it in bibliography form. Alternative data sets (e.g., from other programs) will also be utilized to evaluate their influence on DSEF analyses for given waste form and disposal-system combinations. The knowledge-management system can also be used to maintain the results of DSEF realizations, enabling the comparison and ranking of various waste-form/disposal-system-environment/disposal-system-design options. Finally, the UFDC knowledge-management system will be able to provide a compendium of 'templates' that can be utilized, in a labor-efficient fashion, to build parallel DSEF analyses (e.g., 'one offs'). The DSEF will not be a stand-alone, push-the-button and wait for the results, item of software. it will use osftware (probably EXCEL, initially), to guide the team members through a logical process of evaluating combinations of waste-form, disposal-syste-environment, and disposal-system design. In later stages, it will utilize software developed in the field of knowledge engineering and knowledge-management systems (Umeki et al. 2009). At certain points in the logical process, the DSEF software will point the evaluate to other software tools to do analyses needed to move the process forward. In the development of the DSEF, they will be mindful to make it no more complex than necessary to evaluate the system being considered. The DSEF will organize and document the work such that multiple realizations for different combinations can be compared and contrasted.

  11. Sandia Explosive Inventory and Information System

    SciTech Connect (OSTI)

    Clements, D.A.

    1994-08-01

    The Explosive Inventory and Information System (EIS) is being developed and implemented by Sandia National Laboratories (SNL) to incorporate a cradle to grave structure for all explosives and explosive containing devices and assemblies at SNL from acquisition through use, storage, reapplication, transfer or disposal. The system does more than track all material inventories. It provides information on material composition, characteristics, shipping requirements; life cycle cost information, plan of use; and duration of ownership. The system also provides for following the processes of explosive development; storage review; justification for retention; Resource, Recovery and Disposition Account (RRDA); disassembly and assembly; and job description, hazard analysis and training requirements for all locations and employees involved with explosive operations. In addition, other information systems will be provided through the system such as the Department of Energy (DOE) and SNL Explosive Safety manuals, the Navy`s Department of Defense (DoD) Explosive information system, and the Lawrence Livermore National Laboratories (LLNL) Handbook of Explosives.

  12. IEA-GIA ExCo - National Geothermal Data System and Online Tools...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    IEA-GIA ExCo - National Geothermal Data System and Online Tools IEA-GIA ExCo - National Geothermal Data System and Online Tools National Geothermal Data System presentation by Jay ...

  13. IEA-GIA ExCo - National Geothermal Data System and Online Tools...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    IEA-GIA ExCo - National Geothermal Data System and Online Tools IEA-GIA ExCo - National Geothermal Data System and Online Tools National Geothermal Data System presentation by Jay...

  14. Wind energy systems information user study

    SciTech Connect (OSTI)

    Belew, W.W.; Wood, B.L.; Marle, T.L.; Reinhardt, C.L.

    1981-01-01

    This report describes the results of a series of telephone interviews with potential users of information on wind energy conversion. These interviews, part of a larger study covering nine different solar technologies, attempted to identify: the type of information each distinctive group of information users needed, and the best way of getting information to that group. Groups studied include: wind energy conversion system researchers; wind energy conversion system manufacturer representatives; wind energy conversion system distributors; wind turbine engineers; utility representatives; educators; county agents and extension service agents; and wind turbine owners.

  15. Security Controls for Unclassified Information Systems Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2009-01-05

    The Manual establishes minimum implementation standards for cyber security technical, management, and operational controls that will be followed in all information systems operated by DOE and the information systems. Does not cancel other directives. Canceled by DOE O 205.1B

  16. Security Controls for Unclassified Information Systems Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2009-01-05

    The Manual establishes minimum implementation standards for cyber security technical, management, and operational controls that will be followed in all information systems operated by DOE and the information systems. Admin Chg 1 dated 9-1-09; Admin Chg 2 dated 12-22-09. Canceled by DOE O 205.1B.

  17. Security Controls for Unclassified Information Systems Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2009-01-05

    The Manual establishes minimum implementation standards for cyber security technical, management, and operational controls that will be followed in all information systems operated by DOE and the information systems. Admin Chg 1 dated 9-1-09. Canceled by DOE O 205.1B.

  18. Energy Signal Tool for Decision Support in Building Energy Systems

    SciTech Connect (OSTI)

    Henze, G. P.; Pavlak, G. S.; Florita, A. R.; Dodier, R. H.; Hirsch, A. I.

    2014-12-01

    A prototype energy signal tool is demonstrated for operational whole-building and system-level energy use evaluation. The purpose of the tool is to give a summary of building energy use which allows a building operator to quickly distinguish normal and abnormal energy use. Toward that end, energy use status is displayed as a traffic light, which is a visual metaphor for energy use that is either substantially different from expected (red and yellow lights) or approximately the same as expected (green light). Which light to display for a given energy end use is determined by comparing expected to actual energy use. As expected, energy use is necessarily uncertain; we cannot choose the appropriate light with certainty. Instead, the energy signal tool chooses the light by minimizing the expected cost of displaying the wrong light. The expected energy use is represented by a probability distribution. Energy use is modeled by a low-order lumped parameter model. Uncertainty in energy use is quantified by a Monte Carlo exploration of the influence of model parameters on energy use. Distributions over model parameters are updated over time via Bayes' theorem. The simulation study was devised to assess whole-building energy signal accuracy in the presence of uncertainty and faults at the submetered level, which may lead to tradeoffs at the whole-building level that are not detectable without submetering.

  19. Policy enabled information sharing system

    DOE Patents [OSTI]

    Jorgensen, Craig R.; Nelson, Brian D.; Ratheal, Steve W.

    2014-09-02

    A technique for dynamically sharing information includes executing a sharing policy indicating when to share a data object responsive to the occurrence of an event. The data object is created by formatting a data file to be shared with a receiving entity. The data object includes a file data portion and a sharing metadata portion. The data object is encrypted and then automatically transmitted to the receiving entity upon occurrence of the event. The sharing metadata portion includes metadata characterizing the data file and referenced in connection with the sharing policy to determine when to automatically transmit the data object to the receiving entity.

  20. Analysis Models and Tools: Systems Analysis of Hydrogen and Fuel...

    Energy Savers [EERE]

    Resolved Energy and Environment Tool (STREET) Model PDF icon UC Davis Models: Geospatial Station Network Design Tool and Hydrogen Infrastructure Rollout Economic Analysis ...

  1. Spray forming system for producing molds, dies and related tooling

    DOE Patents [OSTI]

    McHugh, Kevin M. (Idaho Falls, ID)

    2000-01-01

    A system for the spray forming manufacturing of near-net-shape molds, dies and related toolings, wherein liquid material such as molten metal, metallic alloys, or polymers are atomized into fine droplets by a high temperature, high velocity gas and deposited onto a pattern. Quenching of the atomized droplets provides a heat sink, thereby allowing undercooled and partially solidified droplets to be formed in-flight. Composites can be formed by combining the atomized droplets with solid particles such as powders, whiskers or fibers.

  2. Summary - System Level Modeling and Simulation Tools for Hanford

    Office of Environmental Management (EM)

    The ob curren plannin Dispos yield re to mod plannin to imp (4) det actual * Th th Th co no in pl * In fo op sy as di re de co an * Th en m ha ev sc The pu techni projec Site: H roject: H Report Date: S ited States valuation in Su Why DOE bjective of the r nt Process Simu ng basis for OR sition System P easonable esti del facilities cur ng or operation rove the rate o termine if addit execution of in What th he current Syst hat are limited t hese tools curr omposition, res ot meeting was itial

  3. Summary - System Level Modeling and Simulation Tools for SRS

    Office of Environmental Management (EM)

    Workflo The ob Proces Savann Dispos assess evaluat design evaluat predict to guid * Th so in w es sy * Th is m * Th fle m de fu The pu techni projec Site: S roject: S Report Date: J ited States valuation i Why DOE ow Diagram bjective of the rev ss Simulation To nah River Site (S sition System Pla s whether the too te methods used , construction, p te methods to im ions; and (4) det e actual executio What th he current Syst oftware tools to formation, and aste. These to stimates, but th ystem

  4. Nanocoatings for High-Efficiency Industrial Hydraulic and Tooling Systems

    SciTech Connect (OSTI)

    Clifton B. Higdon III

    2011-01-07

    Industrial manufacturing in the U.S. accounts for roughly one third of the 98 quadrillion Btu total energy consumption. Motor system losses amount to 1.3 quadrillion Btu, which represents the largest proportional loss of any end-use category, while pumps alone represent over 574 trillion BTU (TBTU) of energy loss each year. The efficiency of machines with moving components is a function of the amount of energy lost to heat because of friction between contacting surfaces. The friction between these interfaces also contributes to downtime and the loss of productivity through component wear and subsequent repair. The production of new replacement parts requires additional energy. Among efforts to reduce energy losses, wear-resistant, low-friction coatings on rotating and sliding components offer a promising approach that is fully compatible with existing equipment and processes. In addition to lubrication, one of the most desirable solutions is to apply a protective coating or surface treatment to rotating or sliding components to reduce their friction coefficients, thereby leading to reduced wear. Historically, a number of materials such as diamond-like carbon (DLC), titanium nitride (TiN), titanium aluminum nitride (TiAlN), and tungsten carbide (WC) have been examined as tribological coatings. The primary objective of this project was the development of a variety of thin film nanocoatings, derived from the AlMgB14 system, with a focus on reducing wear and friction in both industrial hydraulics and cutting tool applications. Proof-of-concept studies leading up to this project had shown that the constituent phases, AlMgB14 and TiB2, were capable of producing low-friction coatings by pulsed laser deposition. These coatings combine high hardness with a low friction coefficient, and were shown to substantially reduce wear in laboratory tribology tests. Selection of the two applications was based largely on the concept of improved mechanical interface efficiencies for energy conservation. In mobile hydraulic systems, efficiency gains through low friction would translate into improved fuel economy and fewer greenhouse gas emissions. Stationary hydraulic systems, accordingly, would consume less electrical power. Reduced tooling wear in machining operations would translate to greater operating yields, while lowering the energy consumed during processing. The AlMgB14 nanocoatings technology progressed beyond baseline laboratory tests into measurable energy savings and enhancements to product durability. Three key hydraulic markets were identified over the course of the project that will benefit from implementation: industrial vane pumps, orbiting valve-in-star hydraulic motors, and variable displacement piston pumps. In the vane pump application, the overall product efficiency was improved by as much as 11%. Similar results were observed with the hydraulic motors tested, where efficiency gains of over 10% were noted. For variable displacement piston pumps, overall efficiency was improved by 5%. For cutting tools, the most significant gains in productivity (and, accordingly, the efficiency of the machining process as a whole) were associated with the roughing and finishing of titanium components for aerospace systems. Use of the AlMgB14 nanocoating in customer field tests has shown that the coated tools were able to withstand machining rates as high as 500sfm (limited only by the substrate material), with relatively low flank wear when compared to other industrial offerings. AlMgB14 coated tools exhibited a 60% improvement over similarly applied TiAlN thin films. Furthermore, AlMgB14-based coatings in these particular tests lasted twice as long than their TiAlN counterparts at the 500sfm feed rates. Full implementation of the technology into the industrial hydraulic and cutting tool markets equates to a worldwide energy savings of 46 trillion BTU/year by 2030. U.S.-based GHG emissions associated with the markets identified would fall accordingly, dropping by as much as 50,000 tonnes annually.

  5. Sensorpedia: Information Sharing Across Autonomous Sensor Systems

    SciTech Connect (OSTI)

    Gorman, Bryan L; Resseguie, David R; Tomkins-Tinch, Christopher H

    2009-01-01

    The concept of adapting social media technologies is introduced as a means of achieving information sharing across autonomous sensor systems. Historical examples of interoperability as an underlying principle in loosely-coupled systems is compared and contrasted with corresponding tightly-coupled, integrated systems. Examples of ad hoc information sharing solutions based on Web 2.0 social networks, mashups, blogs, wikis, and data tags are presented and discussed. The underlying technologies of these solutions are isolated and defined, and Sensorpedia is presented as a formalized application for implementing sensor information sharing across large-scale enterprises with incompatible autonomous sensor systems.

  6. Information Concerning Reliability Impacts under Various System

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Configurations of the Mirant Potomac River Plant | Department of Energy Concerning Reliability Impacts under Various System Configurations of the Mirant Potomac River Plant Information Concerning Reliability Impacts under Various System Configurations of the Mirant Potomac River Plant Docket No. EO-05-01: PJM Interconnection, L.L.C. and PEPCO Holdings, Inc. is hereby providing you with additional information concerning reliability impacts under various system conditions associated with the

  7. Systems Dynamic ToolBox for Water Resource Planning

    Energy Science and Technology Software Center (OSTI)

    2006-08-01

    The Fully Integrated System Dynamics Tookbox for Water Resources Planning (Toolbox) is a library of generic modules intended to assist in water management planning and decision making in watersheds around the world. The modules - built in a commercially available modeling environment called Powersim Studio Expert, represent the different sub-systems ina watershed, including population, agriculture, economics, climate, reservoirs, stream flows, and fish populations, and provides generic building blocks with which complex models of complex modelsmore » of complex watersheds can be assembled. The resulting models provide a tool for observing how research management decision made in one sector of a basin can affect other sectors. Improved water resource management contributes to improved public health, economic development, ecological sustainability, and overall security and stability.« less

  8. River Protection Project information systems assessment

    SciTech Connect (OSTI)

    JOHNSON, A.L.

    1999-07-28

    The Information Systems Assessment Report documents the results from assessing the Project Hanford Management Contract (PHMC) Hanford Data Integrator 2000 (HANDI 2000) system, Business Management System (BMS) and Work Management System phases (WMS), with respect to the System Engineering Capability Assessment Model (CAM). The assessment was performed in accordance with the expectations stated in the fiscal year (FY) 1999 Performance Agreement 7.1.1, item (2) which reads, ''Provide an assessment report on the selected Integrated Information System by July 31, 1999.'' This report assesses the BMS and WMS as implemented and planned for the River Protection Project (RPP). The systems implementation is being performed under the PHMC HANDI 2000 information system project. The project began in FY 1998 with the BMS, proceeded in FY 1999 with the Master Equipment List portion of the WMS, and will continue the WMS implementation as funding provides. This report constitutes an interim quality assessment providing information necessary for planning RPP's information systems activities. To avoid confusion, HANDI 2000 will be used when referring to the entire system, encompassing both the BMS and WMS. A graphical depiction of the system is shown in Figure 2-1 of this report.

  9. New No-Cost ANTFARM Tool Maps Control System Networks to Help...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber Security Standards New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber ...

  10. PIA - Human Resources Information System (HRIS) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information System (HRIS) PIA - Human Resources Information System (HRIS) PIA - Human Resources Information System (HRIS) PDF icon PIA - Human Resources Information System (HRIS) More Documents & Publications PIA - INL PeopleSoft - Human Resource System PIA - Human Resources - Personal Information Change Request - Idaho National Engineering Laboratory PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE

  11. PIA - Human Resources Management Information System (HRMIS) | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Information System (HRMIS) PIA - Human Resources Management Information System (HRMIS) PIA - Human Resources Management Information System (HRMIS) PDF icon PIA - Human Resources Management Information System (HRMIS) More Documents & Publications PIA - INL PeopleSoft - Human Resource System PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE PIA - Human Resources - Personal Information Change Request - Idaho National Engineering Laboratory

  12. The renewable electric plant information system

    SciTech Connect (OSTI)

    Sinclair, K.

    1995-12-01

    This report explains the procedures used for creating the Renewable Electric Plant Information System (REPiS) database, describes the database fields, and summarizes the data. The REPiS database contains comprehensive information on grid-connected renewable electric generation plants in the United States. Originally designed in 1987 and updated in 1990, the database includes information through 1994. The report also illustrates ways of using the data for analysis is and describes how researchers validated the data.

  13. Western Renewable Energy Generation Information System ACCOUNT...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Western Renewable Energy Generation Information System ACCOUNT HOLDER REGISTRATION AGREEMENT (Also referred to as the "TERMS OF USE") June 22,2007 Revised May 1,2008 JUL 3 1 REC'D...

  14. Summary - System Level Modeling and Simulation Tools for SRS

    Office of Environmental Management (EM)

    of pot A further need tool for Saltsto eptance. e ETR Team R 12 months): ( ssor, memory engineers and tools; (3) Deve ation of uncerta s; (4) Review cu most recent DOE ptance...

  15. PIA - General Locator Information & Non-Employee System (GLI...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    General Locator Information & Non-Employee System (GLI-NES) PIA - General Locator Information & Non-Employee System (GLI-NES) PIA - General Locator Information & Non-Employee...

  16. Nuclear Material Control and Accountability System Effectiveness Tool (MSET)

    SciTech Connect (OSTI)

    Powell, Danny H; Elwood Jr, Robert H; Roche, Charles T; Campbell, Billy J; Hammond, Glenn A; Meppen, Bruce W; Brown, Richard F

    2011-01-01

    A nuclear material control and accountability (MC&A) system effectiveness tool (MSET) has been developed in the United States for use in evaluating material protection, control, and accountability (MPC&A) systems in nuclear facilities. The project was commissioned by the National Nuclear Security Administration's Office of International Material Protection and Cooperation. MSET was developed by personnel with experience spanning more than six decades in both the U.S. and international nuclear programs and with experience in probabilistic risk assessment (PRA) in the nuclear power industry. MSET offers significant potential benefits for improving nuclear safeguards and security in any nation with a nuclear program. MSET provides a design basis for developing an MC&A system at a nuclear facility that functions to protect against insider theft or diversion of nuclear materials. MSET analyzes the system and identifies several risk importance factors that show where sustainability is essential for optimal performance and where performance degradation has the greatest impact on total system risk. MSET contains five major components: (1) A functional model that shows how to design, build, implement, and operate a robust nuclear MC&A system (2) A fault tree of the operating MC&A system that adapts PRA methodology to analyze system effectiveness and give a relative risk of failure assessment of the system (3) A questionnaire used to document the facility's current MPC&A system (provides data to evaluate the quality of the system and the level of performance of each basic task performed throughout the material balance area [MBA]) (4) A formal process of applying expert judgment to convert the facility questionnaire data into numeric values representing the performance level of each basic event for use in the fault tree risk assessment calculations (5) PRA software that performs the fault tree risk assessment calculations and produces risk importance factor reports on the facility's MC&A (software widely used in the aerospace, chemical, and nuclear power industries) MSET was peer reviewed in 2007 and validated in 2008 by benchmark testing at the Idaho National Laboratory in the United States. The MSET documents were translated into Russian and provided to Rosatom in July of 2008, and MSET is currently being evaluated for potential application in Russian Nuclear Facilities.

  17. Project Records Information System (PRIS) user's manual

    SciTech Connect (OSTI)

    Smith, P.S.; Nations, J.A.; Short, R.D.

    1991-08-01

    The Projects Record Information System (PRIS) is an interactive system developed for the Information Services Division (ISD) of Martin Marietta Energy Systems, Inc., to perform indexing, maintenance, and retrieval of information about Engineering project record documents for which they are responsible. This PRIS User's Manual provides instruction on the use of this system. Section 2.0 of this manual presents an overview of PRIS, describing the system's purpose; the data that it handles, functions it performs; hardware, software, and access; and help and error functions. Section 3.0 describes the interactive menu-driven operation of PRIS. Appendixes A, B,C, and D contain the data dictionary, help screens, report descriptions, and a primary menu structure diagram, respectively.

  18. Nanocoatings for High-Efficiency Industrial and Tooling Systems

    SciTech Connect (OSTI)

    Blau, P; Qu, J.; Higdon, C.

    2011-02-01

    This industry-driven project was the result of a successful response by Eaton Corporation to a DOE/ITP Program industry call. It consisted of three phases in which ORNL participated. In addition to Eaton Corporation and ORNL (CRADA), the project team included Ames Laboratory, who developed the underlying concept for aluminum-magnesium-boron based nanocomposite coatings [1], and Greenleaf, a small tooling manufacturer in western Pennsylvania. This report focuses on the portion of this work that was conducted by ORNL in a CRADA with Eaton Corporation. A comprehensive final report for the entire effort, which ended in September 2010, has been prepared by Eaton Corporation. Phase I, “Proof of Concept” ran for one year (September 1, 2006 to September 30, 2007) during which the applicability of AlMgB14 single-phase and nanocomposite coatings on hydraulic material coupons and components as well as on tool inserts was demonstrated.. The coating processes used either plasma laser deposition (PLD) or physical vapor deposition (PVD). During Phase I, ORNL conducted laboratory-scale pin-on-disk and reciprocating pin-on-flat tests of coatings produced by PLD and PVD. Non-coated M2 tool steel was used as a baseline for comparison, and the material for the sliding counterface was Type 52100 bearing steel since it simulated the pump materials. Initial tests were run mainly in a commercial hydraulic fluid named Mobil DTE-24, but some tests were later run in a water-glycol mixture as well. A tribosystem analysis was conducted to define the operating conditions of pump components and to help develop simulative tests in Phase II. Phase II, “Coating Process Scale-up” was intended to use scaled-up process to generate prototype parts. This involved both PLD practices at Ames Lab, and a PVD scale-up study at Eaton using its production capable equipment. There was also a limited scale-up study at Greenleaf for the tooling application. ORNL continued to conduct friction and wear tests on process variants and developed tests to better simulate the applications of interest. ORNL also employed existing lubrication models to better understand hydraulic pump frictional behavior and test results. Phase III, “Functional Testing” focused on finalizing the strategy for commercialization of AlMgB14 coatings for both hydraulic and tooling systems. ORNL continued to provide tribology testing and analysis support for hydraulic pump applications. It included both laboratory-scale coupon testing and the analysis of friction and wear data from full component-level tests performed at Eaton Corp. Laboratory-scale tribology test methods are used to characterize the behavior of nanocomposite coatings prior to running them in full-sized hydraulic pumps. This task also includes developing tribosystems analyses, both to provide a better understanding of the performance of coated surfaces in alternate hydraulic fluids, and to help design useful laboratory protocols. Analysis also includes modeling the lubrication conditions and identifying the physical processes by which wear and friction of the contact interface changes over time. This final report summarizes ORNL’s portion of the nanocomposite coatings development effort and presents both generated data and the analyses that were used in the course of this effort.

  19. Improve Chilled Water System Performance, Software Tools for Industry, Industrial Technologies Program (ITP) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-12-01

    This fact sheet describes how the Industrial Technologies Program Chilled Water System Analysis Tool (CWSAT) can help optimize the performance of of industrial chilled water systems.

  20. Chemical Biological Emergency Management Information System

    Energy Science and Technology Software Center (OSTI)

    2004-06-15

    CB-EMIS is designed to provide information and analysis to transit system operators and emergency responders in the event of a chemical attack on a subway system. The software inforporates detector data, video images, train data, meteorological data, and above- and below-ground plume dispersion models, hight of the liquid level.

  1. Information systems to enhance technology exchange

    SciTech Connect (OSTI)

    Hunter, T.; Harrington, M.; Harlan, C.; Drozhko, E.

    1994-03-01

    A fundamental part of international technology exchange is the compilation and dissemination of information. Worldwide environmental problems and technology development activities form the basis for important opportunities across the world and especially for those in the former Soviet Union. Recently, important agreements have been reached among Russian institutes engaged in environmental work and the US Department of Energy (DOE) and its national laboratories. These agreements will allow a systematic compilation of information on environmental contamination problems in Russia that can be included in DOE`s environmental information systems. A computer hardware and software system has been loaned to Russian scientists by the DOE for the sharing of environmental software and data, while establishing standards for future information networks.

  2. Safety Basis Information System | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Basis Information System Safety Basis Information System Safety Basis Report (Public Access) Click on the above link to see the current Safety Basis report. This report provides a list of all DOE nuclear facilities with the safety basis status, hazard categorization, and safety basis type. Safety Basis Login Click on the above link to log in to the Safety Basis web interface. "RESTRICTED; access only to DOE and DOE contractors" Safety Basis Account Request Click on the above link to

  3. Comparative guide to emerging diagnostic tools for large commercial HVAC systems

    SciTech Connect (OSTI)

    Friedman, Hannah; Piette, Mary Ann

    2001-05-01

    This guide compares emerging diagnostic software tools that aid detection and diagnosis of operational problems for large HVAC systems. We have evaluated six tools for use with energy management control system (EMCS) or other monitoring data. The diagnostic tools summarize relevant performance metrics, display plots for manual analysis, and perform automated diagnostic procedures. Our comparative analysis presents nine summary tables with supporting explanatory text and includes sample diagnostic screens for each tool.

  4. Information technology and decision support tools for stakeholder-driven river basin salinity management

    SciTech Connect (OSTI)

    Quinn, N.W.T; Cozad, D.B.; Lee, G.

    2010-01-01

    Innovative strategies for effective basin-scale salinity management have been developed in the Hunter River Basin of Australia and more recently in the San Joaquin River Basin of California. In both instances web-based stakeholder information dissemination has been a key to achieving a high level of stakeholder involvement and the formulation of effective decision support salinity management tools. A common element to implementation of salinity management strategies in both river basins has been the concept of river assimilative capacity for controlling export salt loading and the potential for trading of the right to discharge salt load to the river - the Hunter River in Australia and the San Joaquin River in California. Both rivers provide basin drainage and the means of exporting salt to the ocean. The paper compares and contrasts the use of monitoring, modeling and information dissemination in the two basins to achieve environmental compliance and sustain irrigated agriculture in an equitable and socially and politically acceptable manner.

  5. Information encoder/decoder using chaotic systems

    DOE Patents [OSTI]

    Miller, Samuel Lee; Miller, William Michael; McWhorter, Paul Jackson

    1997-01-01

    The present invention discloses a chaotic system-based information encoder and decoder that operates according to a relationship defining a chaotic system. Encoder input signals modify the dynamics of the chaotic system comprising the encoder. The modifications result in chaotic, encoder output signals that contain the encoder input signals encoded within them. The encoder output signals are then capable of secure transmissions using conventional transmission techniques. A decoder receives the encoder output signals (i.e., decoder input signals) and inverts the dynamics of the encoding system to directly reconstruct the original encoder input signals.

  6. Information encoder/decoder using chaotic systems

    DOE Patents [OSTI]

    Miller, S.L.; Miller, W.M.; McWhorter, P.J.

    1997-10-21

    The present invention discloses a chaotic system-based information encoder and decoder that operates according to a relationship defining a chaotic system. Encoder input signals modify the dynamics of the chaotic system comprising the encoder. The modifications result in chaotic, encoder output signals that contain the encoder input signals encoded within them. The encoder output signals are then capable of secure transmissions using conventional transmission techniques. A decoder receives the encoder output signals (i.e., decoder input signals) and inverts the dynamics of the encoding system to directly reconstruct the original encoder input signals. 32 figs.

  7. Analysis Models and Tools: Systems Analysis of Hydrogen and Fuel Cells |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Analysis Models and Tools: Systems Analysis of Hydrogen and Fuel Cells Analysis Models and Tools: Systems Analysis of Hydrogen and Fuel Cells The Fuel Cell Technologies Office's systems analysis program uses a consistent set of models and data for transparent analytical evaluations. The following fact sheets provide an overview and individual summaries of the models and tools used for systems analysis of hydrogen and fuel cells. View the Overview Fact Sheet and

  8. System 80+ D-RAP, a communication tool

    SciTech Connect (OSTI)

    Siegmann, E.R.; Mody, A.A.

    1994-12-31

    The purpose of {open_quotes}RAP{close_quotes} music is to communicate, and the purpose of D-RAP is to foster communication between the probabilistic risk assessment (PRA) group, designers, and the future combined operating license (COL) applicant. This is to ensure that the design is self-consistent and integrated with the procurement process. The designer reliability assurance program (D-RAP) is the first part of the RAP. The goals of the D-RAP are to have risk-significant systems, structures, and components (SSCs) identified and considered in the detail design and procurement phases and to maintain consistency between PRA and design. Plant safety is maintained throughout the design phase, and pertinent information is passed on to the COL applicant. The operations RAP (O-RAP) covers the plant operation and maintenance.

  9. Function analysis for waste information systems

    SciTech Connect (OSTI)

    Sexton, J.L.; Neal, C.T.; Heath, T.C.; Starling, C.D.

    1996-04-01

    This study has a two-fold purpose. It seeks to identify the functional requirements of a waste tracking information system and to find feasible alternatives for meeting those requirements on the Oak Ridge Reservation (ORR) and the Portsmouth (PORTS) and Paducah (PGDP) facilities; identify options that offer potential cost savings to the US government and also show opportunities for improved efficiency and effectiveness in managing waste information; and, finally, to recommend a practical course of action that can be immediately initiated. In addition to identifying relevant requirements, it also identifies any existing requirements that are currently not being completely met. Another aim of this study is to carry out preliminary benchmarking by contacting representative companies about their strategic directions in waste information. The information obtained from representatives of these organizations is contained in an appendix to the document; a full benchmarking effort, however, is beyond the intended scope of this study.

  10. Classified Automated Information System Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1994-07-15

    To establish uniform requirements, policies, responsibilities, and procedures for the development and implementation of a Department of Energy (DOE) Classified Computer Security Program to ensure the security of classified information in automated data processing (ADP) systems. Cancels DOE O 5637.1. Canceled by DOE O 471.2.

  11. Control and Information Systems for the National Ignition Facility

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Brunton, Gordon; Casey, Allan; Christensen, Marvin; Demaret, Robert; Fedorov, Mike; Flegel, Michael; Folta, Peg; Fraizer, Timothy; Hutton, Matthew; Kegelmeyer, Laura; et al

    2015-11-03

    Orchestration of every National Ignition Facility (NIF) shot cycle is managed by the Integrated Computer Control System (ICCS), which uses a scalable software architecture running code on more than 1950 front-end processors, embedded controllers, and supervisory servers. The ICCS operates laser and industrial control hardware containing 66 000 control and monitor points to ensure that all of NIF’s laser beams arrive at the target within 30 ps of each other and are aligned to a pointing accuracy of less than 50 μm root-mean-square, while ensuring that a host of diagnostic instruments record data in a few billionths of a second.more » NIF’s automated control subsystems are built from a common object-oriented software framework that distributes the software across the computer network and achieves interoperation between different software languages and target architectures. A large suite of business and scientific software tools supports experimental planning, experimental setup, facility configuration, and post-shot analysis. Standard business services using open-source software, commercial workflow tools, and database and messaging technologies have been developed. An information technology infrastructure consisting of servers, network devices, and storage provides the foundation for these systems. This paper is an overview of the control and information systems used to support a wide variety of experiments during the National Ignition Campaign.« less

  12. Summary - System Level Modeling and Simulation Tools for Hanford

    Office of Environmental Management (EM)

    d Simul Waste Pr plan needs to c al, processing. e ETR Team R 12 months): ( ssor, memory engineers and tools; (3) Deve ation of uncerta s; (4) Reconcile ween HTWOS l; (5) Link...

  13. Energy Management and Information Systems Study - 2014 BTO Peer...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Information Systems Study - 2014 BTO Peer Review Energy Management and Information Systems Study - 2014 BTO Peer Review Presenter: Jessica Granderson, Lawrence Berkeley ...

  14. New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cyber Security Standards | Department of Energy New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber Security Standards New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber Security Standards Funded under the Department of Energy's National SCADA Test Bed Program, Sandia National Laboratories recently released a new software tool that will aid energy utility owners in mapping and visualizing their control system networks-a critical first step

  15. U.S. OpenLabs - Software Tools | Open Energy Information

    Open Energy Info (EERE)

    and labelling programs, and to identify the most attractive targets for appliances and efficiency levels. Finance Tools Cost of Renewable Energy Spreadsheet Tool RETFinance:...

  16. The Quick Energy Simulation Tool (eQUEST) | Open Energy Information

    Open Energy Info (EERE)

    search Tool Summary LAUNCH TOOL Name: eQUEST AgencyCompany Organization: James J. Hirsh & Associates Partner: Lawrence Berkeley National Laboratory (LBNL) Sector: Energy...

  17. PIA - AMWTP Information Systems Enclave | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AMWTP Information Systems Enclave PIA - AMWTP Information Systems Enclave PIA - AMWTP Information Systems Enclave PDF icon PIA - AMWTP Information Systems Enclave More Documents & Publications Integrated Safety Management Workshop Registration, PIA, Idaho National Laboratory Occupational Medical Surveillance System (OMSS) PIA, Idaho National Laboratory PIA - Bonneville Power Adminstration Ethics Helpline

  18. PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE PDF icon PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE More Documents & Publications PIA - INL Education Programs Business Enclave Manchester Software 1099 Reporting PIA, Idaho National Laboratory PIA - INL PeopleSoft - Human Resource System

  19. Waste Information Management System-2012 - 12114

    SciTech Connect (OSTI)

    Upadhyay, H.; Quintero, W.; Shoffner, P.; Lagos, L.; Roelant, D. [Applied Research Center, Florida International University, 10555 West Flagler Street, Suite 2100, Miami, FL 33174 (United States)

    2012-07-01

    The Waste Information Management System (WIMS) -2012 was updated to support the Department of Energy (DOE) accelerated cleanup program. The schedule compression required close coordination and a comprehensive review and prioritization of the barriers that impeded treatment and disposition of the waste streams at each site. Many issues related to waste treatment and disposal were potential critical path issues under the accelerated schedule. In order to facilitate accelerated cleanup initiatives, waste managers at DOE field sites and at DOE Headquarters in Washington, D.C., needed timely waste forecast and transportation information regarding the volumes and types of radioactive waste that would be generated by DOE sites over the next 40 years. Each local DOE site historically collected, organized, and displayed waste forecast information in separate and unique systems. In order for interested parties to understand and view the complete DOE complex-wide picture, the radioactive waste and shipment information of each DOE site needed to be entered into a common application. The WIMS application was therefore created to serve as a common application to improve stakeholder comprehension and improve DOE radioactive waste treatment and disposal planning and scheduling. WIMS allows identification of total forecasted waste volumes, material classes, disposition sites, choke points, technological or regulatory barriers to treatment and disposal, along with forecasted waste transportation information by rail, truck and inter-modal shipments. The Applied Research Center (ARC) at Florida International University (FIU) in Miami, Florida, developed and deployed the web-based forecast and transportation system and is responsible for updating the radioactive waste forecast and transportation data on a regular basis to ensure the long-term viability and value of this system. WIMS continues to successfully accomplish the goals and objectives set forth by DOE for this project. It has replaced the historic process of each DOE site gathering, organizing, and reporting their waste forecast information utilizing different databases and display technologies. In addition, WIMS meets DOE's objective to have the complex-wide waste forecast and transportation information available to all stakeholders and the public in one easy-to-navigate system. The enhancements to WIMS made since its initial deployment include the addition of new DOE sites and facilities, an updated waste and transportation information, and the ability to easily display and print customized waste forecast, the disposition maps, GIS maps and transportation information. The system also allows users to customize and generate reports over the web. These reports can be exported to various formats, such as Adobe{sup R} PDF, Microsoft Excel{sup R}, and Microsoft Word{sup R} and downloaded to the user's computer. Future enhancements will include database/application migration to the next level. A new data import interface will be developed to integrate 2012-13 forecast waste streams. In addition, the application is updated on a continuous basis based on DOE feedback. (authors)

  20. Federal Emergency Management Information System (FEMIS) system administration guide. Version 1.4

    SciTech Connect (OSTI)

    Arp, J.A.; Burnett, R.A.; Downing, T.R.

    1997-11-21

    The Federal Emergency Management Information System (FEMIS) is an emergency management planning and analysis tool that was developed by the Pacific Northwest National Laboratory (PNNL) under the direction of the US Army Chemical Biological Defense Command. The FEMIS System Administration Guide defines FEMIS hardware and software requirements and gives instructions for installing the FEMIS software package. This document also contains information on the following: software installation for the FEMIS data servers, communication server, mail server, and the emergency management workstations; distribution media loading and FEMIS installation validation and troubleshooting; and system management of FEMIS users, login privileges, and usage. The system administration utilities (tools), available in the FEMIS client software, are described for user accounts and site profile. This document also describes the installation and use of system and database administration utilities that will assist in keeping the FEMIS system running in an operational environment. The FEMIS system is designed for a single Chemical Stockpile Emergency Preparedness Program (CSEPP) site that has multiple Emergency Operations Centers (EOCs). Each EOC has personal computers (PCs) that emergency planners and operations personnel use to do their jobs. These PCs are connected via a local area network (LAN) to servers that provide EOC-wide services. Each EOC is interconnected to other EOCs via telecommunications links.

  1. Integrated MARKAL-EFOM System (TIMES) | Open Energy Information

    Open Energy Info (EERE)

    Program ComplexityEase of Use: Advanced Website: iea-etsap.orgwebTimes.asp Cost: Free Related Tools TEEMP Intertemporal Computable Equilibrium System (ICES) MCA4Climate -...

  2. Policy Analysis Modeling System (PAMS) | Open Energy Information

    Open Energy Info (EERE)

    TOOL Name: Policy Analysis Modeling System AgencyCompany Organization: Lawrence Berkeley National Laboratory Sector: Energy Focus Area: Buildings, Energy Efficiency Topics:...

  3. System Advisor Model (SAM) | Open Energy Information

    Open Energy Info (EERE)

    Resource assessment Resource Type: Case studiesexamples, Dataset, Guidemanual, Training materials, Softwaremodeling tools, Video User Interface: Desktop Application...

  4. Development of Characterization Tools for Reliability Testing of MicroElectroMechanical System Actuators

    SciTech Connect (OSTI)

    Allen, James J.; Eaton, William P.; Smith, Norman F.; Tanner, Danelle M.

    1999-07-26

    Characterization tools have been developed to study the performance characteristics and reliability of surface micromachined actuators. These tools include (1) the ability to electrically stimulate or stress the actuator, (2) the capability to visually inspect the devices in operation, (3) a method for capturing operational information, and (4) a method to extract performance characteristics from the operational information. Additionally, a novel test structure has been developed to measure electrostatic forces developed by a comb drive actuator.

  5. MOX Services Unclassified Information System PIA, National Nuclear Services

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administration | Department of Energy MOX Services Unclassified Information System PIA, National Nuclear Services Administration MOX Services Unclassified Information System PIA, National Nuclear Services Administration MOX Services Unclassified Information System PIA, National Nuclear Services Administration PDF icon MOX Services Unclassified Information System PIA, National Nuclear Services Administration More Documents & Publications TRAIN-PIA.pdf Occupational Medicine - Assistant

  6. Overview of existing residential energy-efficiency rating systems and measuring tools

    SciTech Connect (OSTI)

    Hendrickson, P.L.; Garrett-Price, B.A.; Williams, T.A.

    1982-10-01

    Three categories of rating systems/tools were identified: prescriptive, calculational, and performance. Prescriptive systems include rating systems that assign points to various conservation features. Most systems that have been implemented to date have been prescriptive systems. The vast majority of these are investor-owned utility programs affiliated with the National Energy Watch program of the Edison Electric Institute. The calculational category includes computational tools that can be used to estimate energy consumption. This estimate could then be transformed, probably by indexing, into a rating. The available computational tools range from very simple to complex tools requiring use of a main-frame computer. Performance systems refer to residential energy-efficiency ratings that are based on past fuel consumption of a home. There are few of these systems. For each identified system/tool, the name, address, and telephone number of the developer is included. In addition, relevant publications discussing the system/tool are cited. The extent of field validation/verification of individual systems and tools is discussed. In general, there has been little validation/verification done. A bibliography of literature relevant to the use and implementation of a home energy rating system is also included.

  7. Information processing systems, reasoning modules, and reasoning system design methods

    DOE Patents [OSTI]

    Hohimer, Ryan E; Greitzer, Frank L; Hampton, Shawn D

    2014-03-04

    Information processing systems, reasoning modules, and reasoning system design methods are described. According to one aspect, an information processing system includes working memory comprising a semantic graph which comprises a plurality of abstractions, wherein the abstractions individually include an individual which is defined according to an ontology and a reasoning system comprising a plurality of reasoning modules which are configured to process different abstractions of the semantic graph, wherein a first of the reasoning modules is configured to process a plurality of abstractions which include individuals of a first classification type of the ontology and a second of the reasoning modules is configured to process a plurality of abstractions which include individuals of a second classification type of the ontology, wherein the first and second classification types are different.

  8. Information processing systems, reasoning modules, and reasoning system design methods

    DOE Patents [OSTI]

    Hohimer, Ryan E.; Greitzer, Frank L.; Hampton, Shawn D.

    2015-08-18

    Information processing systems, reasoning modules, and reasoning system design methods are described. According to one aspect, an information processing system includes working memory comprising a semantic graph which comprises a plurality of abstractions, wherein the abstractions individually include an individual which is defined according to an ontology and a reasoning system comprising a plurality of reasoning modules which are configured to process different abstractions of the semantic graph, wherein a first of the reasoning modules is configured to process a plurality of abstractions which include individuals of a first classification type of the ontology and a second of the reasoning modules is configured to process a plurality of abstractions which include individuals of a second classification type of the ontology, wherein the first and second classification types are different.

  9. Building Energy Information Systems: User Case Studies

    SciTech Connect (OSTI)

    Granderson, Jessica; Piette, Mary Ann; Ghatikar, Girish

    2010-03-22

    Measured energy performance data are essential to national efforts to improve building efficiency, as evidenced in recent benchmarking mandates, and in a growing body of work that indicates the value of permanent monitoring and energy information feedback. This paper presents case studies of energy information systems (EIS) at four enterprises and university campuses, focusing on the attained energy savings, and successes and challenges in technology use and integration. EIS are broadly defined as performance monitoring software, data acquisition hardware, and communication systems to store, analyze and display building energy information. Case investigations showed that the most common energy savings and instances of waste concerned scheduling errors, measurement and verification, and inefficient operations. Data quality is critical to effective EIS use, and is most challenging at the subsystem or component level, and with non-electric energy sources. Sophisticated prediction algorithms may not be well understood but can be applied quite effectively, and sites with custom benchmark models or metrics are more likely to perform analyses external to the EIS. Finally, resources and staffing were identified as a universal challenge, indicating a need to identify additional models of EIS use that extend beyond exclusive in-house use, to analysis services.

  10. Disposal Systems Evaluations and Tool Development- Engineered Barrier System (EBS) Evaluation

    Broader source: Energy.gov [DOE]

    The engineered barrier system (EBS) plays a key role in the long-term isolation of nuclear waste in geological repository environments. This report focuses on the progress made in the evaluation of EBS design concepts, assessment of clay phase stability at repository-relevant conditions, thermodynamic database development for cement and clay phases, and THMC coupled phenomena along with the development of tools and methods to examine these processes; it also documents the advancements of the Disposal System Evaluation Framework (DSEF) for the development of repository design concepts and potential variants according to waste form and disposal environment characteristics.

  11. Information System Security Officer (ISSO) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Officer (ISSO) Information System Security Officer (ISSO) digital-388075_960_720.jpg The Information System Security Officer (ISSO) is responsible to the Information System Security Manager (SSM), information owner, and system owner for ensuring a proper security posture is in place. PDF icon ISSO Core Competency Training Worksheet More Documents & Publications Cybersecurity Program Manager (CSPM) Authorizing Official Designated Representative (AODR) Information System Owner (ISO

  12. File:Excel sheet Datasets Tools.pdf | Open Energy Information

    Open Energy Info (EERE)

    Excel sheet Datasets Tools.pdf Jump to: navigation, search File File history File usage File:Excel sheet Datasets Tools.pdf Size of this preview: 776 600 pixels. Go to page 1 2...

  13. Information findability : an informal study to explore options for improving information findability for the systems analysis group.

    SciTech Connect (OSTI)

    Stoecker, Nora K.

    2014-03-01

    A Systems Analysis Group has existed at Sandia National Laboratories since at least the mid-1950s. Much of the group’s work output (reports, briefing documents, and other materials) has been retained, along with large numbers of related documents. Over time the collection has grown to hundreds of thousands of unstructured documents in many formats contained in one or more of several different shared drives or SharePoint sites, with perhaps five percent of the collection still existing in print format. This presents a challenge. How can the group effectively find, manage, and build on information contained somewhere within such a large set of unstructured documents? In response, a project was initiated to identify tools that would be able to meet this challenge. This report documents the results found and recommendations made as of August 2013.

  14. Radiance: Synthetic Imaging System | Open Energy Information

    Open Energy Info (EERE)

    tools User Interface: Desktop Application Website: radsite.lbl.govradiance Cost: Free References: Radiance1 Logo: RADIANCE RADIANCE is a highly accurate ray-tracing...

  15. COMFEN 3.0 - Evolution of an Early Design Tool for Commercial Facades and Fenestration Systems

    SciTech Connect (OSTI)

    McClintock Facade Consulting LLC, Walnut Creek, CA; McQuillen Interactive LLC, Santa Cruz, CA; Selkowitz, Stephen; Mitchell, Robin; McClintock, Maurya; McQuillen, Daniel; McNeil, Andrew; Yazdanian, Mehry

    2011-03-09

    Achieving a net-zero energy building cannot be done solely by improving the efficiency of the engineering systems. It also requires consideration of the essential nature of the building including factors such as architectural form, massing, orientation and enclosure. Making informed decisions about the fundamental character of a building requires assessment of the effects of the complex interaction of these factors on the resulting performance of the building. The complexity of these interactions necessitates the use of modeling and simulation tools to dynamically analyze the effects of the relationships, yet decisions about the building fundamentals are often made in the earliest stages of design, before a `building? exists to model. To address these issues, Lawrence Berkeley National Laboratory (LBNL) has developed an early-design energy modeling tool (COMFEN) specifically to help make informed decisions about building facade fundamentals by considering the design of the building envelope, orientation and massing on building performance. COMFEN focuses on the concept of a ?space? or ?room? and uses the EnergyPlus, and RadianceTM engines and a simple, graphic user interface to allow the user to explore the effects of changing key early-design input variables on energy consumption, peak energy demand, and thermal and visual comfort. Comparative results are rapidly presented in a variety of graphic and tabular formats to help users move toward optimal facade and fenestration design choices.While COMFEN 1.0 utilized an ExcelTM-based user interface, COMFEN 3.0 has been reworked to include a simple, more intuitive, yet powerful Graphic User Interface (GUI), a broader range of libraries for associated system and component choices and deliver a wider range of graphic outputs and options. This paper (and presentation) outlines the objectives in developing and further refining COMFEN, the mechanics of the program, and plans for future development.

  16. PIA - INL SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SECURITY INFORMATION MANAGEMENT SYSTEM BUSINESS ENCLAVE PIA - INL SECURITY INFORMATION ... 1099 Reporting PIA, Idaho National Laboratory PIA - INL PeopleSoft - Human Resource ...

  17. Energy Procurement Information Center (EPiC) - Deb Bouslog, Systems...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Procurement Information Center (EPiC) - Deb Bouslog, Systems Division, OAPM Energy Procurement ... dedicated to provide information to DOE's project management community. ...

  18. High power laser downhole cutting tools and systems

    SciTech Connect (OSTI)

    Zediker, Mark S; Rinzler, Charles C; Faircloth, Brian O; Koblick, Yeshaya; Moxley, Joel F

    2015-01-20

    Downhole cutting systems, devices and methods for utilizing 10 kW or more laser energy transmitted deep into the earth with the suppression of associated nonlinear phenomena. Systems and devices for the laser cutting operations within a borehole in the earth. These systems and devices can deliver high power laser energy down a deep borehole, while maintaining the high power to perform cutting operations in such boreholes deep within the earth.

  19. High power laser workover and completion tools and systems

    SciTech Connect (OSTI)

    Zediker, Mark S; Rinzler, Charles C; Faircloth, Brian O; Koblick, Yeshaya; Moxley, Joel F

    2014-10-28

    Workover and completion systems, devices and methods for utilizing 10 kW or more laser energy transmitted deep into the earth with the suppression of associated nonlinear phenomena. Systems and devices for the laser workover and completion of a borehole in the earth. These systems and devices can deliver high power laser energy down a deep borehole, while maintaining the high power to perform laser workover and completion operations in such boreholes deep within the earth.

  20. The Integrated Waste Tracking Systems (IWTS) - A Comprehensive Waste Management Tool

    SciTech Connect (OSTI)

    Robert S. Anderson

    2005-09-01

    The US Department of Energy (DOE) Idaho National Laboratory (INL) site located near Idaho Falls, ID USA, has developed a comprehensive waste management and tracking tool that integrates multiple operational activities with characterization data from waste declaration through final waste disposition. The Integrated Waste Tracking System (IWTS) provides information necessary to help facility personnel properly manage their waste and demonstrate a wide range of legal and regulatory compliance. As a client?server database system, the IWTS is a proven tracking, characterization, compliance, and reporting tool that meets the needs of both operations and management while providing a high level of flexibility. This paper describes some of the history involved with the development and current use of IWTS as a comprehensive waste management tool as well as a discussion of IWTS deployments performed by the INL for outside clients. Waste management spans a wide range of activities including: work group interactions, regulatory compliance management, reporting, procedure management, and similar activities. The IWTS documents these activities and performs tasks in a computer-automated environment. Waste characterization data, container characterization data, shipments, waste processing, disposals, reporting, and limit compliance checks are just a few of the items that IWTS documents and performs to help waste management personnel perform their jobs. Throughout most hazardous and radioactive waste generating, storage and disposal sites, waste management is performed by many different groups of people in many facilities. Several organizations administer their areas of waste management using their own procedures and documentation independent of other organizations. Files are kept, some of which are treated as quality records, others not as stringent. Quality records maintain a history of: changes performed after approval, the reason for the change(s), and a record of whom and when the changes were made. As regulations and permits change, and as the proliferation of personal computers flourish, procedures and data files begin to be stored in electronic databases. With many different organizations, contractors, and unique procedures, several dozen databases are used to track and maintain aspects of waste management. As one can see, the logistics of collecting and certifying data from all organizations to provide comprehensive information would not only take weeks to perform, but usually presents a variety of answers that require an immediate unified resolution. A lot of personnel time is spent scrubbing the data in order to determine the correct information. The issue of disparate data is a concern in itself, and is coupled with the costs associated with maintaining several separate databases. In order to gain waste management efficiencies across an entire facility or site, several waste management databases located among several organizations would need to be consolidated. The IWTS is a system to do just that, namely store and track containerized waste information for an entire site. The IWTS has proven itself at the INL since 1995 as an efficient, successful, time saving management tool to help meet the needs of both operations and management for hazardous and radiological containerized waste. Other sites have also benefited from IWTS as it has been deployed at West Valley Nuclear Services Company DOE site as well as Ontario Power Ge

  1. North American Industry Classification System (NAICS) Search Tool

    Broader source: Energy.gov [DOE]

    The North American Industry Classification System (NAICS) is the standard used by Federal statistical agencies in classifying business establishments for the purpose of collecting, analyzing, and...

  2. IEA-GIA ExCo - National Geothermal Data System and Online Tools |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy IEA-GIA ExCo - National Geothermal Data System and Online Tools IEA-GIA ExCo - National Geothermal Data System and Online Tools National Geothermal Data System presentation by Jay Nathwani at the September 30, 2011 IEA-GIA ExCo conference in London. PDF icon gtp_iea-gia_presentation_nathwani_9-30-11.pdf More Documents & Publications International Partnership for Geothermal Technology - 2012 Peer Review Presentation Innovative Exploration Technologies Subprogram

  3. Data Tools & Models - U.S. Energy Information Administration (EIA)

    U.S. Energy Information Administration (EIA) Indexed Site

    Data Tools & Models Glossary › FAQS › Overview Data Tools Time Series Models & Documentation EIA has a vast amount of data, reports, forecasts, analytical content, and documentation to assist researchers working on energy topics. For users eager to dive deeper into our content, we have assembled tools to customize searches, view specific data sets, study detailed documentation, and access time-series data. Application Programming Interface (API): The API allows computers to more

  4. Multi-Scale Modeling Tools to Enable Manufacturing-Informed Design...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Vehicle Technologies Office Merit Review 2014: Development of Computer-Aided Design Tools for Automotive Batteries Vehicle Technologies Office Merit ...

  5. Distributed Object Oriented Geographic Information System

    Energy Science and Technology Software Center (OSTI)

    1997-02-01

    This interactive, object-oriented, distributed Geographic Information System (GIS) uses the World Wibe Web (WWW) as application medium and distribution mechanism. The software provides distributed access to multiple geo-spatial databases and presents them as if they came from a single coherent database. DOOGIS distributed access comes not only in the form of multiple geo-spatial servers but can break down a single logical server into the constituent physical servers actually storing the data. The program provides formore » dynamic protocol resolution and content handling allowing unknown objects from a particular server to download their handling code. Security and access privileges are negotiated dynamically with each server contacted and each access attempt.« less

  6. Value Added Energy Information Systems VAEIS | Open Energy Information

    Open Energy Info (EERE)

    Solar, Wind energy Product: Provides turn-key monitoring systems for the performance of solar, wind, fuel cell and other distributed generation installations. Coordinates:...

  7. Proceedings of the Workshop on software tools for distributed intelligent control systems

    SciTech Connect (OSTI)

    Herget, C.J.

    1990-09-01

    The Workshop on Software Tools for Distributed Intelligent Control Systems was organized by Lawrence Livermore National Laboratory for the United States Army Headquarters Training and Doctrine Command and the Defense Advanced Research Projects Agency. The goals of the workshop were to the identify the current state of the art in tools which support control systems engineering design and implementation, identify research issues associated with writing software tools which would provide a design environment to assist engineers in multidisciplinary control design and implementation, formulate a potential investment strategy to resolve the research issues and develop public domain code which can form the core of more powerful engineering design tools, and recommend test cases to focus the software development process and test associated performance metrics. Recognizing that the development of software tools for distributed intelligent control systems will require a multidisciplinary effort, experts in systems engineering, control systems engineering, and compute science were invited to participate in the workshop. In particular, experts who could address the following topics were selected: operating systems, engineering data representation and manipulation, emerging standards for manufacturing data, mathematical foundations, coupling of symbolic and numerical computation, user interface, system identification, system representation at different levels of abstraction, system specification, system design, verification and validation, automatic code generation, and integration of modular, reusable code.

  8. IEA-GIA ExCo - National Geothermal Data System and Online Tools

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    IEA-GIA ExCo National Geothermal Data System & Online Tools Jay Nathwani Enel Salt Wells - ... Capacity Increases 2005-2010 5 In 2010 only 15 MW came online in the United States. ...

  9. System for loading executable code into volatile memory in a downhole tool

    DOE Patents [OSTI]

    Hall, David R.; Bartholomew, David B.; Johnson, Monte L.

    2007-09-25

    A system for loading an executable code into volatile memory in a downhole tool string component comprises a surface control unit comprising executable code. An integrated downhole network comprises data transmission elements in communication with the surface control unit and the volatile memory. The executable code, stored in the surface control unit, is not permanently stored in the downhole tool string component. In a preferred embodiment of the present invention, the downhole tool string component comprises boot memory. In another embodiment, the executable code is an operating system executable code. Preferably, the volatile memory comprises random access memory (RAM). A method for loading executable code to volatile memory in a downhole tool string component comprises sending the code from the surface control unit to a processor in the downhole tool string component over the network. A central processing unit writes the executable code in the volatile memory.

  10. NNSA's G2 Management Information System Wins Association for Enterprise

    National Nuclear Security Administration (NNSA)

    Information's (AFEI) "Excellence in Enterprise Information Award" | National Nuclear Security Administration NNSA's G2 Management Information System Wins Association for Enterprise Information's (AFEI) "Excellence in Enterprise Information Award" February 17, 2016 The G2 team and the 2015 Association for Enterprise Information's (AFEI) Excellence in Enterprise Information Award. (WASHINGTON, D.C) - The National Nuclear Security Administration (NNSA) has received the 2015

  11. Geographic Information System (Nash, Et Al., 2002) | Open Energy...

    Open Energy Info (EERE)

    search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System (Nash, Et Al., 2002) Exploration Activity Details Location Unspecified Exploration...

  12. OLADE-Geo-Information System Referenced Renewable Energy | Open...

    Open Energy Info (EERE)

    Website Website: www.hidroinformatica.orgsigerhomeesindex.html Cost: Free Language: Spanish; Castilian OLADE-Geo-Information System Referenced Renewable Energy...

  13. Geographic Information System At Lightning Dock Geothermal Area...

    Open Energy Info (EERE)

    navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Lightning Dock Geothermal Area (Getman, 2014) Exploration Activity...

  14. W.E.T. Automotive Systems | Open Energy Information

    Open Energy Info (EERE)

    E.T. Automotive Systems Jump to: navigation, search Name: W.E.T. Automotive Systems Place: Odelzhausen, Germany Information About Partnership with NREL Partnership with NREL Yes...

  15. Montana Ground Water Pollution Control System Information Webpage...

    Open Energy Info (EERE)

    Ground Water Pollution Control System Information Webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Montana Ground Water Pollution Control System...

  16. Method and system of integrating information from multiple sources

    DOE Patents [OSTI]

    Alford, Francine A.; Brinkerhoff, David L.

    2006-08-15

    A system and method of integrating information from multiple sources in a document centric application system. A plurality of application systems are connected through an object request broker to a central repository. The information may then be posted on a webpage. An example of an implementation of the method and system is an online procurement system.

  17. New Automotive Air Conditioning System Simulation Tool Developed in MATLAB/Simulink

    SciTech Connect (OSTI)

    Kiss, T.; Chaney, L.; Meyer, J.

    2013-07-01

    Further improvements in vehicle fuel efficiency require accurate evaluation of the vehicle's transient total power requirement. When operated, the air conditioning (A/C) system is the largest auxiliary load on a vehicle; therefore, accurate evaluation of the load it places on the vehicle's engine and/or energy storage system is especially important. Vehicle simulation software, such as 'Autonomie,' has been used by OEMs to evaluate vehicles' energy performance. A transient A/C simulation tool incorporated into vehicle simulation models would also provide a tool for developing more efficient A/C systems through a thorough consideration of the transient A/C system performance. The dynamic system simulation software Matlab/Simulink was used to develop new and more efficient vehicle energy system controls. The various modeling methods used for the new simulation tool are described in detail. Comparison with measured data is provided to demonstrate the validity of the model.

  18. Disposal systems evaluations and tool development : Engineered Barrier System (EBS) evaluation.

    SciTech Connect (OSTI)

    Rutqvist, Jonny; Liu, Hui-Hai; Steefel, Carl I.; Serrano de Caro, M. A.; Caporuscio, Florie Andre; Birkholzer, Jens T.; Blink, James A.; Sutton, Mark A.; Xu, Hongwu; Buscheck, Thomas A.; Levy, Schon S.; Tsang, Chin-Fu; Sonnenthal, Eric; Halsey, William G.; Jove-Colon, Carlos F.; Wolery, Thomas J.

    2011-01-01

    Key components of the nuclear fuel cycle are short-term storage and long-term disposal of nuclear waste. The latter encompasses the immobilization of used nuclear fuel (UNF) and radioactive waste streams generated by various phases of the nuclear fuel cycle, and the safe and permanent disposition of these waste forms in geological repository environments. The engineered barrier system (EBS) plays a very important role in the long-term isolation of nuclear waste in geological repository environments. EBS concepts and their interactions with the natural barrier are inherently important to the long-term performance assessment of the safety case where nuclear waste disposition needs to be evaluated for time periods of up to one million years. Making the safety case needed in the decision-making process for the recommendation and the eventual embracement of a disposal system concept requires a multi-faceted integration of knowledge and evidence-gathering to demonstrate the required confidence level in a deep geological disposal site and to evaluate long-term repository performance. The focus of this report is the following: (1) Evaluation of EBS in long-term disposal systems in deep geologic environments with emphasis on the multi-barrier concept; (2) Evaluation of key parameters in the characterization of EBS performance; (3) Identification of key knowledge gaps and uncertainties; and (4) Evaluation of tools and modeling approaches for EBS processes and performance. The above topics will be evaluated through the analysis of the following: (1) Overview of EBS concepts for various NW disposal systems; (2) Natural and man-made analogs, room chemistry, hydrochemistry of deep subsurface environments, and EBS material stability in near-field environments; (3) Reactive Transport and Coupled Thermal-Hydrological-Mechanical-Chemical (THMC) processes in EBS; and (4) Thermal analysis toolkit, metallic barrier degradation mode survey, and development of a Disposal Systems Evaluation Framework (DSEF). This report will focus on the multi-barrier concept of EBS and variants of this type which in essence is the most adopted concept by various repository programs. Empasis is given mainly to the evaluation of EBS materials and processes through the analysis of published studies in the scientific literature of past and existing repository research programs. Tool evaluations are also emphasized, particularly on THCM processes and chemical equilibria. Although being an increasingly important aspect of NW disposition, short-term or interim storage of NW will be briefly discussed but not to the extent of the EBS issues relevant to disposal systems in deep geologic environments. Interim storage will be discussed in the report Evaluation of Storage Concepts FY10 Final Report (Weiner et al. 2010).

  19. System for gathering and summarizing internet information

    DOE Patents [OSTI]

    Potok, Thomas E.; Elmore, Mark Thomas; Reed, Joel Wesley; Treadwell, Jim N.; Samatova, Nagiza Faridovna

    2006-07-04

    A computer method of gathering and summarizing large amounts of information comprises collecting information from a plurality of information sources (14, 51) according to respective maps (52) of the information sources (14), converting the collected information from a storage format to XML-language documents (26, 53) and storing the XML-language documents in a storage medium, searching for documents (55) according to a search query (13) having at least one term and identifying the documents (26) found in the search, and displaying the documents as nodes (33) of a tree structure (32) having links (34) and nodes (33) so as to indicate similarity of the documents to each other.

  20. Koyo Thermo Systems | Open Energy Information

    Open Energy Info (EERE)

    Koyo Thermo Systems Jump to: navigation, search Name: Koyo Thermo Systems Place: Nara, Japan Zip: 632-0084 Product: Koyo Thermo Systems is a Japanese crystalline silicon...

  1. Wind to Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Jump to: navigation, search Name: Wind to Power Systems Place: Madrid, Spain Zip: 28108 Sector: Wind energy Product: Wind to Power Systems designs, supplies and...

  2. Gas Recovery Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: Gas Recovery Systems Place: California Zip: 94550 Product: Turnkey landfill gas (LFG) energy extraction systems. References: Gas Recovery...

  3. Biodiesel Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    Systems LLC Jump to: navigation, search Name: Biodiesel Systems, LLC Place: Madison, Wisconsin Zip: WI 53704 Product: The core business of Biodiesel Systems is plan, design,...

  4. Trinity Thermal Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Place: Texas Zip: 75028 Product: Trinity Thermal Systems provides power storage products aimed a shifting energy use from air conditioning systems to off-peak times....

  5. Blind Geothermal System | Open Energy Information

    Open Energy Info (EERE)

    Blind Geothermal System Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Print PDF Blind Geothermal System Dictionary.png Blind Geothermal System: An area with a...

  6. Bio Fuel Systems BFS | Open Energy Information

    Open Energy Info (EERE)

    Fuel Systems BFS Jump to: navigation, search Name: Bio Fuel Systems (BFS) Place: Alicante, Spain Sector: Biomass Product: Bio Fuel Systems focuses on the development of biofuel...

  7. Mirasol Solar Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Mirasol Solar Energy Systems Jump to: navigation, search Logo: Mirasol Solar Energy Systems Name: Mirasol Solar Energy Systems Address: 101 Spring Road NE Place: Rio Rancho, New...

  8. Expert Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    Solar Systems Jump to: navigation, search Logo: Expert Solar Systems Name: Expert Solar Systems Address: 11700 E. Sneller Vista Place: Tucson, Arizona Zip: 85749 Sector: Solar...

  9. Landfill Energy Systems LES | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems LES Jump to: navigation, search Name: Landfill Energy Systems (LES) Place: Michigan Zip: 48393 Product: Landfill gas to energy systems project developer, gas...

  10. Aperion Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    system controls, and fuel options with various stack technologies to supply optimized fuel cell systems. References: Aperion Energy Systems1 This article is a stub. You can...

  11. Orion Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: Orion Energy Systems Place: Plymouth, Wisconsin Zip: 53073 Product: Designs and manufactures application specific lighting systems and...

  12. Ambient Control Systems | Open Energy Information

    Open Energy Info (EERE)

    Control Systems Jump to: navigation, search Logo: Ambient Control Systems Name: Ambient Control Systems Address: 1810 Gillespie Way Place: El Cajon, California Zip: 92020 Region:...

  13. Energy Conservation Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Systems Inc Jump to: navigation, search Name: Energy Conservation Systems Inc Place: Prostpect, Kentucky Zip: 40059 Product: Smart solutionspower control system provider...

  14. Classified Matter Protection and Control (CMPC) Policy Resource and Information Tool (CPRIT)

    Broader source: Energy.gov [DOE]

    This tool may be used in conjunction with DOE M 470.4-4A when developing local CMPC programs. No requirements are established in this document and its use or application is discretionary. The...

  15. Web-based energy information systems for large commercial buildings

    SciTech Connect (OSTI)

    Motegi, Naoya; Piette, Mary Ann

    2003-03-29

    Energy Information Systems (EIS), which monitor and organize building energy consumption and related trend data over the Internet, have been evolving over the past decade. This technology helps perform key energy management functions such as organizing energy use data, identifying energy consumption anomalies, managing energy costs, and automating demand response strategies. During recent years numerous developers and vendors of EIS have been deploying these products in a highly competitive market. EIS offer various software applications and services for a variety of purposes. Costs for such system vary greatly depending on the system's capabilities and how they are marketed. Some products are marketed directly to end users while others are made available as part of electric utility programs. EIS can be a useful tool in building commissioning and retro-commissioning. This paper reviews more than a dozen EIS. We have developed an analytical framework to characterize the main features of these products, which are developed for a variety of utility programs and end-use markets. The purpose of this research is to evaluate EIS capabilities and limitations, plus examine longer-term opportunities for utilizing such technology to improve building energy efficiency and load management.

  16. The Web Interface Template System (WITS), a software developer`s tool

    SciTech Connect (OSTI)

    Lauer, L.J.; Lynam, M.; Muniz, T.

    1995-11-01

    The Web Interface Template System (WITS) is a tool for software developers. WITS is a three-tiered, object-oriented system operating in a Client/Server environment. This tool can be used to create software applications that have a Web browser as the user interface and access a Sybase database. Development, modification, and implementation are greatly simplified because the developer can change and test definitions immediately, without writing or compiling any code. This document explains WITS functionality, the system structure and components of WITS, and how to obtain, install, and use the software system.

  17. Power Systems Life Cycle Analysis Tool (Power L-CAT).

    SciTech Connect (OSTI)

    Andruski, Joel; Drennen, Thomas E.

    2011-01-01

    The Power Systems L-CAT is a high-level dynamic model that calculates levelized production costs and tracks environmental performance for a range of electricity generation technologies: natural gas combined cycle (using either imported (LNGCC) or domestic natural gas (NGCC)), integrated gasification combined cycle (IGCC), supercritical pulverized coal (SCPC), existing pulverized coal (EXPC), nuclear, and wind. All of the fossil fuel technologies also include an option for including carbon capture and sequestration technologies (CCS). The model allows for quick sensitivity analysis on key technical and financial assumptions, such as: capital, O&M, and fuel costs; interest rates; construction time; heat rates; taxes; depreciation; and capacity factors. The fossil fuel options are based on detailed life cycle analysis reports conducted by the National Energy Technology Laboratory (NETL). For each of these technologies, NETL's detailed LCAs include consideration of five stages associated with energy production: raw material acquisition (RMA), raw material transport (RMT), energy conversion facility (ECF), product transportation and distribution (PT&D), and end user electricity consumption. The goal of the NETL studies is to compare existing and future fossil fuel technology options using a cradle-to-grave analysis. The NETL reports consider constant dollar levelized cost of delivered electricity, total plant costs, greenhouse gas emissions, criteria air pollutants, mercury (Hg) and ammonia (NH3) emissions, water withdrawal and consumption, and land use (acreage).

  18. Information propagation for interacting-particle systems (Journal Article)

    Office of Scientific and Technical Information (OSTI)

    | SciTech Connect Information propagation for interacting-particle systems Citation Details In-Document Search Title: Information propagation for interacting-particle systems We study the speed at which information propagates through systems of interacting quantum particles moving on a regular lattice and show that for a certain class of initial conditions there exists a maximum speed of sound at which information can propagate. Our argument applies equally to quantum spins, bosons such as

  19. List of Major Information Systems,National Nuclear Security Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ADaPT Networked: | Department of Energy List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems, Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear

  20. TWRS information locator database system administrator`s manual

    SciTech Connect (OSTI)

    Knutson, B.J., Westinghouse Hanford

    1996-09-13

    This document is a guide for use by the Tank Waste Remediation System (TWRS) Information Locator Database (ILD) System Administrator. The TWRS ILD System is an inventory of information used in the TWRS Systems Engineering process to represent the TWRS Technical Baseline. The inventory is maintained in the form of a relational database developed in Paradox 4.5.

  1. Decontamination Systems Information and Reseach Program

    SciTech Connect (OSTI)

    Echol E. Cook

    1998-04-01

    The following paragraphs comprise the research efforts during the first quarter of 1998 (January 1 - March 31). These tasks have been granted a continuation from the 1997 work and will all end in June 1998. This report represents the last technical quarterly report deliverable for the WVU Cooperative Agreement - Decontamination Systems Information and Research Program. Final reports for all of the 1997 projects will be submitted afterwards as one document. During this period, groundwater extraction operations were completed on Task 1.6 - Pilot Scale Demonstration of TCE Flushing Through PVDs at the DOE/RMI Extrusion Plant. The data have been evaluated and graphs are presented. The plot of TCE Concentration versus Time shows that the up-gradient groundwater monitoring well produced consistent levels of TCE contamination. A similar trend was observed for the down-gradient wells via grab samples tested. Groundwater samples from the PVD test pad Zone of Influence showed consistent reductions in TCE concentrations with respect to time. In addition, a natural pulse frequency is evident which will have a significant impact on the efficiency of the contaminant removal under natural groundwater advection/diffusion processes. The relationships between the PVD Extraction Flow Rate versus Cumulative Time shows a clear trend in flow rate. Consistent values between 20 to 30 g.p.m. at the beginning of the extraction duration, to less than 10 g.p.m. by the end of the extraction cycle are observed. As evidenced by the aquifer�s diminishing recharge levels, the PVD extraction is affecting the response of the aquifer�s natural attenuation capability. Progress was also marked on the Injection and Circulation of Potable Water Through PVDs task. Data reduction from this sequence of testing is ongoing. Work planned for next quarter includes completing the Injection / Extraction of potable water task and beginning the Surfactant Injection and removal task.

  2. Federal Emergency Management Information System (FEMIS) System Administration Guide for FEMIS Version 1.4.6

    SciTech Connect (OSTI)

    Arp, J.A.; Bower, J.C.; Burnett, R.A.; Carter, R.J.; Downing, T.R.; Fangman, P.M.; Gerhardstein, L.H.; Homer, B.J.; Johnson, D.M.; Johnson, R.L.; Johnson, S.M.; Loveall, R.M.; Martin, T.J.; Millard, W.D.; Schulze, S.A.; Stoops, L.R.; Tzemos, S.; Wood, B.M.

    1999-06-29

    The Federal Emergency Management Information System (FEMIS) is an emergency management planning and response tool that was developed by the Pacific Northwest National Laboratory (PNNL) under the direction of the U.S. Army Chemical Biological Defense Command. The FEMIS System Administration Guide provides information necessary for the system administrator to maintain the FEMIS system. The FEMIS system is designed for a single Chemical Stockpile Emergency Preparedness Program (CSEPP) site that has multiple Emergency Operations Centers (EOCs). Each EOC has personal computers (PCs) that emergency planners and operations personnel use to do their jobs. These PCs are corrected via a local area network (LAN) to servers that provide EOC-wide services. Each EOC is interconnected to other EOCs via a Wide Area Network (WAN). Thus, FEMIS is an integrated software product that resides on client/server computer architecture. The main body of FEMIS software, referred to as the FEMIS Application Software, resides on the PC client(s) and is directly accessible to emergency management personnel. The remainder of the FEMIS software, referred to as the FEMIS Support Software, resides on the UNIX server. The Support Software provides the communication data distribution and notification functionality necessary to operate FEMIS in a networked, client/server environment.

  3. Information security management system planning for CBRN facilities

    SciTech Connect (OSTI)

    Lenaeu, Joseph D.; O'Neil, Lori Ross; Leitch, Rosalyn M.; Glantz, Clifford S.; Landine, Guy P.; Bryant, Janet L.; Lewis, John; Mathers, Gemma; Rodger, Robert; Johnson, Christopher

    2015-12-01

    The focus of this document is to provide guidance for the development of information security management system planning documents at chemical, biological, radiological, or nuclear (CBRN) facilities. It describes a risk-based approach for planning information security programs based on the sensitivity of the data developed, processed, communicated, and stored on facility information systems.

  4. Louisville Electric System | Open Energy Information

    Open Energy Info (EERE)

    Louisville Electric System Jump to: navigation, search Name: Louisville Electric System Place: Mississippi References: EIA Form EIA-861 Final Data File for 2010 - File1a1 EIA...

  5. Sathian Sun Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Sathian Sun Power Systems Jump to: navigation, search Name: Sathian Sun Power Systems Place: Salem, Andhra Pradesh, India Sector: Solar Product: Manufacturer of solar street lights...

  6. Southwest Photovoltaic Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Southwest Photovoltaic Systems Inc Jump to: navigation, search Name: Southwest Photovoltaic Systems Inc Place: Tomball, Texas Zip: 77375 Product: Distributor of small scale PV...

  7. American Geothermal Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Place: Austin, Texas Sector: Geothermal energy Product: Installer of geothermal heating and cooling technologies, also has a patented water to air heat pump system....

  8. Kawasaki Plant Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    Systems Ltd Jump to: navigation, search Name: Kawasaki Plant Systems Ltd Place: Kobe, Japan Zip: 650-8670 Sector: Biomass, Services, Solar Product: Engineers, manufactures, and...

  9. Advanced Fuel Cell Systems | Open Energy Information

    Open Energy Info (EERE)

    Fuel Cell Systems Jump to: navigation, search Name: Advanced Fuel Cell Systems Place: Amherst, New York Zip: 14228 Product: Collaboration of three companies (ATSI Engineering,...

  10. Natural Climate Systems | Open Energy Information

    Open Energy Info (EERE)

    search Name: Natural Climate Systems Place: Spain Product: Develops bioclimatic architecture projects. References: Natural Climate Systems1 This article is a stub. You can...

  11. Synergetic Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Sector: Buildings, Solar Product: Start-up planning to install parabolic concentrated solar collector systems on large flat-roofed buildings to power their HVAC systems, and...

  12. Independent Energy Systems IES | Open Energy Information

    Open Energy Info (EERE)

    IES Jump to: navigation, search Name: Independent Energy Systems (IES) Place: Santa Cruz, California Zip: 95062 Product: Independent Energy Systems sells, designs, and installs...

  13. REpower Systems AG | Open Energy Information

    Open Energy Info (EERE)

    Systems AG Jump to: navigation, search Name: REpower Systems AG Place: Hamburg, Germany Zip: D-22297 Sector: Services, Wind energy Product: Wind turbine manufacturer with...

  14. Alstom Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Alstom Energy Systems Jump to: navigation, search Name: Alstom Energy Systems Address: 3 avenue Andr Malraux Place: Levallois-Perret Cedex, France Website: www.alstom.com...

  15. Saft Power Systems | Open Energy Information

    Open Energy Info (EERE)

    and systems, servicing the telecom and coal industries; in particular, manufacturers inverters and balance of systems for solar industry. Coordinates: 48.88811, 2.194915 Show...

  16. Microgy Cogeneration Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Microgy Cogeneration Systems Inc Jump to: navigation, search Name: Microgy Cogeneration Systems Inc Place: Tarrytown, New York Zip: 10591 Product: New York-based Microgy...

  17. Solimpeks Solar Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Solimpeks Solar Energy Systems Jump to: navigation, search Name: Solimpeks Solar Energy Systems Place: Karatay - KONYA, Turkey Zip: 42300 Sector: Solar Product: Turkish...

  18. Rand Solar Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Rand Solar Energy Systems Jump to: navigation, search Name: Rand Solar Energy Systems Place: Petach Tikva, Israel Zip: 49130 Sector: Solar Product: Israel-based manufacturer and...

  19. ICOS Vision Systems NV | Open Energy Information

    Open Energy Info (EERE)

    ICOS Vision Systems NV Jump to: navigation, search Name: ICOS Vision Systems NV Place: Leuvan, Belgium Zip: 3001 Product: Provides inspection products for the manufacturing...

  20. American Transmission Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    American Transmission Systems Inc Jump to: navigation, search Name: American Transmission Systems Inc Place: Ohio Website: www.atcllc.com Twitter: @amertransco References: EIA...

  1. American Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Systems Inc Jump to: navigation, search Name: American Energy Systems Inc Place: Minnesota Zip: 55350 Product: Biofuel burning appliance manufacturer (pellets & corn). References:...

  2. Hydraulic Hybrid Systems | Open Energy Information

    Open Energy Info (EERE)

    Hydraulic Hybrid Systems Retrieved from "http:en.openei.orgwindex.php?titleHydraulicHybridSystems&oldid768560" Categories: Organizations Companies Energy...

  3. Optimal Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems Place: Torrance, California Zip: 90505 Product: Manufacturer of flywheel power system, specialising in aerospace and defence sector. Coordinates: 40.417285,...

  4. Distributed Energy Systems Corp | Open Energy Information

    Open Energy Info (EERE)

    Distributed Energy Systems Corp Jump to: navigation, search Name: Distributed Energy Systems Corp Place: Wallingford, Connecticut Zip: CT 06492 Product: The former holding company...

  5. Advanced Energy Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    Systems Ltd Place: Welshpool, Western Australia, Australia Zip: 6016 Sector: Solar, Wind energy Product: Manufacturer and distributor of micro wind turbines, solar systems, gas...

  6. Corporate Systems Engineering | Open Energy Information

    Open Energy Info (EERE)

    Systems Engineering Jump to: navigation, search Name: Corporate Systems Engineering Place: Indianapolis, Indiana Product: Indiana-based energy management company. Coordinates:...

  7. Biomass Combustion Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Biomass Combustion Systems Inc Retrieved from "http:en.openei.orgwindex.php?titleBiomassCombustionSystemsInc&oldid768602" Feedback Contact needs updating Image...

  8. Greasecar Vegetable Fuel Systems | Open Energy Information

    Open Energy Info (EERE)

    Greasecar Vegetable Fuel Systems Jump to: navigation, search Name: Greasecar Vegetable Fuel Systems Place: Florence, Massachusetts Zip: 1062 Product: Manufacturer of vegetable fuel...

  9. Renewable Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Renewable Power Systems Place: Bedford, England, United Kingdom Zip: MK42 9TW Sector: Renewable Energy Product: Bedford, UK based developer of renewable power systems. References:...

  10. Husk Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Jump to: navigation, search Name: Husk Power Systems Place: Patna, Bihar, India Zip: 800023 Sector: Biomass Product: India-based developer of mini biomass plants....

  11. Interval Data Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Interval Data Systems Inc Jump to: navigation, search Name: Interval Data Systems Inc Address: 135 Beaver Street Place: Waltham, Massachusetts Zip: 02452 Region: Greater Boston...

  12. Independent Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems is an independent energy consultancy specialising in reducing client energy and environmental costs. References: Independent Power Systems1 This article is a stub. You...

  13. Star Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: Star Energy Systems Place: Ahmedabad, Gujarat, India Zip: 380 009 Sector: Solar Product: Solar PV product distributor. Coordinates:...

  14. Thermal Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems Jump to: navigation, search Name: Thermal Energy Systems Place: London, United Kingdom Sector: Biomass Product: UK based company that constructs and installs boilers...

  15. Solargy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Solar Product: Solargy Systems designs and manufactures PV cells and develops waste to energy and biomass plants. References: Solargy Systems Inc.1 This article is a stub....

  16. InPower Systems | Open Energy Information

    Open Energy Info (EERE)

    Name: InPower Systems Place: Carbondale, Colorado Zip: 81623 Sector: Geothermal energy, Solar Product: InPower Systems designs, installs and maintains turn-key solar, solar...

  17. Flywheel Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    K2H 8S1 Product: Focuses on design, fabrication, assembling and distributing flywheel energy storage systems and related components. References: Flywheel Energy Systems Inc1...

  18. West Point Utility System | Open Energy Information

    Open Energy Info (EERE)

    Utility System Jump to: navigation, search Name: West Point Utility System Place: Iowa Phone Number: (319) 837-6313 Website: www.westpointiowa.comwp-utili Facebook: https:...

  19. Enova Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    search Name: Enova Systems Inc Place: Torrance, California Zip: CA 90502 Product: Enova Systems develops and manufactures power management and power conversion products with a...

  20. WebGen Systems | Open Energy Information

    Open Energy Info (EERE)

    search Logo: WebGen Systems Name: WebGen Systems Address: 41 Linksey Way Place: Cambridge, Massachusetts Zip: 02142 Region: Greater Boston Area Sector: Efficiency Product:...

  1. Promethean Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Jump to: navigation, search Name: Promethean Power Systems Place: Cambridge, Massachusetts Zip: 2138 Product: US-based developer of a solar-powered...

  2. Naps Systems Oy | Open Energy Information

    Open Energy Info (EERE)

    Naps Systems Oy Jump to: navigation, search Name: Naps Systems Oy Place: Vantaa, Finland Zip: 1510 Sector: Solar Product: Naps provides solar electricity solutions that range from...

  3. Green Design Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: Green Design Systems Address: PO Box 1229 Place: Healdsburg, California Zip: 95448 Region: Bay Area Sector: Buildings Product: Refuse...

  4. Green Systems UK | Open Energy Information

    Open Energy Info (EERE)

    Systems UK Jump to: navigation, search Name: Green Systems UK Place: Cambridge, United Kingdom Sector: Solar Product: Design and installation of vacuum tube & flat plate solar hot...

  5. Directional Drilling Systems | Open Energy Information

    Open Energy Info (EERE)

    Directional Drilling Systems Jump to: navigation, search Geothermal ARRA Funded Projects for Directional Drilling Systems Loading map... "format":"googlemaps3","type":"ROADMAP","t...

  6. Nighthawk Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Nighthawk Systems Inc Jump to: navigation, search Name: Nighthawk Systems Inc Place: San Antonio, Texas Zip: 78216 Product: Texas-based, provider of intelligent wireless power...

  7. American Alternative Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Alternative Energy Systems Jump to: navigation, search Name: American Alternative Energy Systems Place: Denton, Texas Zip: 76209 Product: An American company involved in project...

  8. California Wind Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Jump to: navigation, search Name: California Wind Systems Address: 3411 Camino Corte Place: Carlsbad, California Zip: 92008 Region: Southern CA Area Sector: Wind energy...

  9. Invensys Building System | Open Energy Information

    Open Energy Info (EERE)

    Zip: 61132 Product: Invensys was a supplier of integrated systems for building automation, and is now merged with TAC. References: Invensys Building System1 This article is...

  10. Tahoe Water Systems | Open Energy Information

    Open Energy Info (EERE)

    Tahoe Water Systems Jump to: navigation, search Name: Tahoe Water Systems Sector: Solar, Wind energy Product: Develops a self-contained solarwind based water pumping technology....

  11. Renewable Energy Systems Americas | Open Energy Information

    Open Energy Info (EERE)

    Americas Jump to: navigation, search Name: Renewable Energy Systems Americas Place: Broomfield, CO Website: www.res-americas.com References: Renewable Energy Systems Americas1...

  12. Powersource Energy Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    Systems Ltd Jump to: navigation, search Name: Powersource Energy Systems Ltd Place: Canada Product: A spinoff from Soltek Powersource Ltd, since 1996, it merged back with them...

  13. Bio Energy Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    search Name: Bio-Energy Systems LLC Place: san Anselmo, California Zip: 94960 Product: Biodiesel producer in Vallejo, California. References: Bio-Energy Systems LLC1 This...

  14. Apollo Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Apollo Energy Systems Inc Place: Pompano Beach, Florida Zip: FLA 33069 Sector: Hydro, Hydrogen, Renewable Energy Product: Apollo Energy Systems is a developer, producer, marketor...

  15. Monolithic Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Jump to: navigation, search Name: Monolithic Power Systems Place: San Jose, California Zip: 95120 Product: A California-based analog semiconductor company....

  16. Renewable Power Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    Power Systems LLC Jump to: navigation, search Name: Renewable Power Systems, LLC Place: Averill Park, New York Zip: 12018 Sector: Solar Product: Albany, New York-based solar...

  17. Integrated Tool Development for Used Fuel Disposition Natural System Evaluation Phase I Report

    Broader source: Energy.gov [DOE]

    The natural barrier system (NBS) is an integral part of a geologic nuclear waste repository. The report describes progress in development of an integrated modeling framework that can be used for systematically analyzing the performance of a natural barrier system and identifying key factors that control the performance. This framework is designed as an integrated tool for prioritization and programmatic decisions.

  18. A Runtime Environment for Supporting Research in Resilient HPC System Software & Tools

    SciTech Connect (OSTI)

    Vallee, Geoffroy R; Naughton, III, Thomas J; Boehm, Swen; Engelmann, Christian

    2013-01-01

    The high-performance computing (HPC) community continues to increase the size and complexity of hardware platforms that support advanced scientific workloads. The runtime environment (RTE) is a crucial layer in the software stack for these large-scale systems. The RTE manages the interface between the operating system and the application running in parallel on the machine. The deployment of applications and tools on large-scale HPC computing systems requires the RTE to manage process creation in a scalable manner, support sparse connectivity, and provide fault tolerance. We have developed a new RTE that provides a basis for building distributed execution environments and developing tools for HPC to aid research in system software and resilience. This paper describes the software architecture of the Scalable runTime Component Infrastructure (STCI), which is intended to provide a complete infrastructure for scalable start-up and management of many processes in large-scale HPC systems. We highlight features of the current implementation, which is provided as a system library that allows developers to easily use and integrate STCI in their tools and/or applications. The motivation for this work has been to support ongoing research activities in fault-tolerance for large-scale systems. We discuss the advantages of the modular framework employed and describe two use cases that demonstrate its capabilities: (i) an alternate runtime for a Message Passing Interface (MPI) stack, and (ii) a distributed control and communication substrate for a fault-injection tool.

  19. Tools and Methods for Hardening Communication Security of Energy Delivery Systems

    SciTech Connect (OSTI)

    Gadgil, Shrirang; Lin, Yow-Jian; Ghosh, Abhrajit; Samtani, Sunil; Kang, Jaewon; Siegell, Bruce; Kaul, Vikram; Unger, John; De Bruet, Andre; Martinez, Catherine; Vermeulen, Gerald; Rasche, Galen; Sternfeld, Scott; Berthier, Robin; Bobba, Rakesh; Campbell, Roy; Sanders, Williams; Lin, Yow-Jian

    2014-06-30

    This document summarizes the research and development work the TT Government Solutions (TTGS), d.b.a. Applied Communication Sciences (ACS), team performed for the Department of Energy Cybersecurity for Energy Delivery Systems (CEDS) program. It addresses the challenges in protecting critical grid control and data communication, including the identification of vulnerabilities and deficiencies of communication protocols commonly used in energy delivery systems (e.g., ICCP, DNP3, C37.118, C12.22), as well as the development of effective means to detect and prevent the exploitation of such vulnerabilities and deficiencies. The team consists of • TT Government Solutions (TTGS), a leading provider of communications solutions that has extensive experience in commercializing communications solutions. TTGS also has deep cyber security research and development expertise supporting a variety of customers. • University of Illinois at Urbana-Champaign (UIUC), a leader in the cyber security research for the power grid. UIUC brings unique experience in designing secure communication protocols to this project. • Electric Power Research Institute (EPRI), an independent nonprofit that conducts research and development relating to the generation, delivery and use of electricity for the benefit of the public. EPRI brings to this effort its extensive technical expertise and its utility connections, with members representing more than 90 percent of the electricity generated and delivered in the United States. • DTE Energy, the 10th largest electric utility in the US, which helps ensure that this project focuses on the needs of utilities and is rightly positioned to address the needs of the market place. We designed, developed, and demonstrated a modular and extensible ADEC-G (Agent-based, Distributed, Extensible Cybersecurity for the Grid) system for monitoring/detecting abnormal energy delivery systems (EDS) protocol usage and ensuring security coverage. Our approach consists of i. An online system with stateful model based checkers (SMBCs) that helps utilities monitor EDS protocol communication contexts and flag abnormal session behaviors; ii. An offline framework that security tool developers, operators, and auditors can use to verify security properties (leverages formal methods). The modular design of the ADEC-G online system enables its easy extension to cover added protocol features, to introduce new monitoring capabilities, and to apply to additional communication protocols. Its monitoring capabilities and user interface features also facilitate visibilities into ongoing communication patterns and quick grasps of suspicious communication activities. The offline framework provides a platform not only for rigorous validation of security coverage, but also for systematic refinement of checker design leveraging the counter traces generated by the model checking tool. The ADEC-G online monitoring/detection system and the offline validation framework are both operational and have been demonstrated in various settings. The ADEC-G online system has also been integrated into TTGS SecureSmart Managed Security Services offering and been employed to perform security assessment in a section of a utility’s operational network as well as in other Smart Grid security pilot project offerings. TTGS is also in discussions with several system integrators for incorporating the integrated SecureSmart Managed Security Services offering as the cyber security solution for the nce of Operations Technology (OT) and Information Technology (IT).

  20. Open Energy Information Systems - 2013 Peer Review | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - 2013 Peer Review Open Energy Information Systems - 2013 Peer Review Emerging Technologies Project for the 2013 Building Technologies Office's Program Peer Review PDF icon emrgtech04_granderson_040213.pdf More Documents & Publications Open Energy Information Systems (OpenEIS) - 2014 Peer Review Buildings Performance Database - 2013 BTO Peer Review Energy Management Systems Package for Small Commercial Buildings

  1. Federal Emergency Management Information System (FEMIS) system administration guide, version 1.4.5

    SciTech Connect (OSTI)

    Arp, J.A.; Burnett, R.A.; Carter, R.J.

    1998-06-26

    The Federal Emergency Management Information Systems (FEMIS) is an emergency management planning and response tool that was developed by the Pacific Northwest National Laboratory (PNNL) under the direction of the US Army Chemical Biological Defense Command. The FEMIS System Administration Guide provides information necessary for the system administrator to maintain the FEMIS system. The FEMIS system is designed for a single Chemical Stockpile Emergency Preparedness Program (CSEPP) site that has multiple Emergency Operations Centers (EOCs). Each EOC has personal computers (PCs) that emergency planners and operations personnel use to do their jobs. These PCs are connected via a local area network (LAN) to servers that provide EOC-wide services. Each EOC is interconnected to other EOCs via a Wide Area Network (WAN). Thus, FEMIS is an integrated software product that resides on client/server computer architecture. The main body of FEMIS software, referred to as the FEMIS Application Software, resides on the PC client(s) and is directly accessible to emergency management personnel. The remainder of the FEMIS software, referred to as the FEMIS Support Software, resides on the UNIX server. The Support Software provides the communication, data distribution, and notification functionality necessary to operate FEMIS in a networked, client/server environment. The UNIX server provides an Oracle relational database management system (RDBMS) services, ARC/INFO GIS (optional) capabilities, and basic file management services. PNNL developed utilities that reside on the server include the Notification Service, the Command Service that executes the evacuation model, and AutoRecovery. To operate FEMIS, the Application Software must have access to a site specific FEMIS emergency management database. Data that pertains to an individual EOC`s jurisdiction is stored on the EOC`s local server. Information that needs to be accessible to all EOCs is automatically distributed by the FEMIS database to the other EOCs at the site.

  2. Quantitative Risk reduction estimation Tool For Control Systems, Suggested Approach and Research Needs

    SciTech Connect (OSTI)

    Miles McQueen; Wayne Boyer; Mark Flynn; Sam Alessi

    2006-03-01

    For the past year we have applied a variety of risk assessment technologies to evaluate the risk to critical infrastructure from cyber attacks on control systems. More recently, we identified the need for a stand alone control system risk reduction estimation tool to provide owners and operators of control systems with a more useable, reliable, and credible method for managing the risks from cyber attack. Risk is defined as the probability of a successful attack times the value of the resulting loss, typically measured in lives and dollars. Qualitative and ad hoc techniques for measuring risk do not provide sufficient support for cost benefit analyses associated with cyber security mitigation actions. To address the need for better quantitative risk reduction models we surveyed previous quantitative risk assessment research; evaluated currently available tools; developed new quantitative techniques [17] [18]; implemented a prototype analysis tool to demonstrate how such a tool might be used; used the prototype to test a variety of underlying risk calculational engines (e.g. attack tree, attack graph); and identified technical and research needs. We concluded that significant gaps still exist and difficult research problems remain for quantitatively assessing the risk to control system components and networks, but that a useable quantitative risk reduction estimation tool is not beyond reach.

  3. MSE Power Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    MSE Power Systems Inc Jump to: navigation, search Name: MSE Power Systems Inc Place: Albany, New York Zip: NY 12205 Sector: Services Product: Albany-based privately held company...

  4. Borrego Solar Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Cajon, California Zip: 92020 Product: US-based installer of PV systems for commercial and public projects. References: Borrego Solar Systems Inc1 This article is a stub. You can...

  5. Aura Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Aura Systems Inc Jump to: navigation, search Name: Aura Systems Inc Place: El Segundo, California Zip: 90245 Product: El Segundo-head quartered developer of AuraGen, an axial flux...

  6. Tri Power Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Logo: Tri Power Systems Inc Name: Tri Power Systems Inc Address: P.O. Box 1450 Place: Idaho Springs, Colorado Zip: 80452 Region: Rockies Area Sector: Solar...

  7. National Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    National Solar Systems Place: Al-Khobar, Saudi Arabia Zip: 31952 Product: Leading system intergrator in Saudi Arabia. Coordinates: 26.28665, 50.21434 Show Map Loading map......

  8. A123Systems | Open Energy Information

    Open Energy Info (EERE)

    A123Systems Place: Watertown, Massachusetts Zip: 02472 Product: Massachusetts-based lithium-ion battery manufacturer. Website: www.a123systems.com Coordinates: 43.197366,...

  9. State Energy Data System | Open Energy Information

    Open Energy Info (EERE)

    Data System Jump to: navigation, search Name State Energy Data System Data Format CSV Geographic Scope United States TODO: Import actual dataset contents into OpenEI The State...

  10. Mercury Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    of PV products and systems for commercial and residential clients in the New York metrotri-state area. References: Mercury Solar Systems1 This article is a stub. You can...

  11. Geco System Spa | Open Energy Information

    Open Energy Info (EERE)

    Zip: 21052 Product: Geco System offers "turnkey" solutions for the proudction of photovoltaic energy. References: Geco System Spa1 This article is a stub. You can help OpenEI...

  12. EDrive Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    EDrive Systems LLC Place: Los Angeles, California Product: Developer of a plug-in and battery kit for the Toyota Prius. References: EDrive Systems LLC1 This article is a stub....

  13. Point Power Systems | Open Energy Information

    Open Energy Info (EERE)

    systems, ranging from 1-6kW. It has received support from Environmental Business Cluster, a California-based incubator. References: Point Power Systems1 This article is a...

  14. Sustainable Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    Zip: 59812 Sector: Renewable Energy Product: Renewable energy and biobased product research, development and commercialization company. References: Sustainable Systems...

  15. Toward the Holy Grail of Perfect Information: Lessons Learned Implementing an Energy Information System in a Commercial Building

    SciTech Connect (OSTI)

    Kircher, Kevin; Ghatikar, Girish; Greenberg, Steve; Watson, Dave; Diamond, Rick; Sartor, Dale; Federspiel, Cliff; McEachern, Alex; Owen, Tom

    2010-05-14

    Energy information systems (real-time acquisition, analysis, and presentation of information from energy end-uses) in commercial buildings have demonstrated value as tools for improving energy efficiency and thermal comfort. These improvements include characterization through benchmarking, identification of retrofit opportunities, anomaly detection to inform retro-commissioning, and feedback to occupants to encourage shifts in behavior. Energy information systems can play a vital role in achieving a variety of ambitious sustainability goals for the existing stock of commercial buildings, but their implementation is often fraught with pitfalls. In this paper, we present a case study of an EIS and sub-metering project executed in a representative commercial office building. We describe the building, highlight a few of its problems, and detail the hardware and software technologies we employed to address them. We summarize the difficulties encountered and lessons learned, and suggest general guidelines for future EIS projects to improve performance and save energy in the commercial building fleet. These guidelines include measurement criteria, monitoring strategies, and analysis methods. In particular, we propose processes for: - Defining project goals, - Selecting end-use targets and depth of metering, - Selecting contractors and software vendors, - Installing and networking measurement devices, - Commissioning and using the energy information system.

  16. Recommendation 171: Commendation for Waste Information Management System |

    Office of Environmental Management (EM)

    Department of Energy 1: Commendation for Waste Information Management System Recommendation 171: Commendation for Waste Information Management System The ORSSAB commends DOE and Florida International University for development of the Waste Information Management System and strongly recommends that it be periodically updated and improved. PDF icon Recommendation 171 PDF icon DOE response to recommendation 171 PDF icon DOE Gelles response to recommendation 171 More Documents & Publications

  17. Guidance for FY2014 Facilities Information Management System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guidance for Fiscal Year 2015 Facilities Information Management System Data Validations Deputy Secretary Memo on Improving DOE-wide Recruitment and Hiring Processes FY2012 Three ...

  18. Geographic Information System At Northern Basin & Range Region...

    Open Energy Info (EERE)

    Nash & Johnson, 2003) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Northern Basin & Range Region (Nash &...

  19. Geographic Information System At Nw Basin & Range Region (Nash...

    Open Energy Info (EERE)

    Nw Basin & Range Region (Nash & Johnson, 2003) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Nw Basin & Range...

  20. Geographic Information System At Chena Geothermal Area (Holdmann...

    Open Energy Info (EERE)

    Details Location Chena Geothermal Area Exploration Technique Geographic Information System Activity Date 2005 - 2007 Usefulness useful DOE-funding Unknown Exploration Basis...

  1. Geographic Information System At U.S. West Region (Williams ...

    Open Energy Info (EERE)

    U.S. West Region (Williams & Deangelo, 2008) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At U.S. West Region...

  2. Information System Security Manager (ISSM) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The Information Security System Manager (ISSM) is designated by an operating unit's (DOE organization or site) Senior Manager to manage the unit's cyber security program. ...

  3. Geographic Information System At Dixie Valley Geothermal Area...

    Open Energy Info (EERE)

    Nash & D., 1997) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Dixie Valley Geothermal Area (Nash & D., 1997)...

  4. National Energy Modeling System (NEMS) | Open Energy Information

    Open Energy Info (EERE)

    Modeling System (NEMS) AgencyCompany Organization: Energy Information Administration Sector: Energy Focus Area: Economic Development Phase: Develop Goals Topics: Policies...

  5. Electronic DOE Information Security System (eDISS) PIA, Office...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Information Security System (eDISS) PIA, Office of Health Safety and Security ... Integrated Safety Management Workshop Registration, PIA, Idaho National Laboratory ...

  6. MOX Services Unclassified Information System PIA, National Nuclear...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    MOX Services Unclassified Information System PIA, National Nuclear Services Administration MOX ... TRAIN-PIA.pdf Occupational Medicine - Assistant PIA, Idaho National Laboratory ...

  7. Visualization of Electric Power System Information: Workshop Proceedings

    SciTech Connect (OSTI)

    Kroposki, B.; Komomua, C.

    2013-01-01

    This report summarizes the workshop entitled: Visualization of Electric Power System Information. The workshop was held on September 11, 2012 on NREL's campus in Golden, Colorado.

  8. Geographic Information System At Walker-Lane Transitional Zone...

    Open Energy Info (EERE)

    Zone Region (Laney, 2005) Exploration Activity Details Location Walker-Lane Transition Zone Geothermal Region Exploration Technique Geographic Information System Activity...

  9. Geographic Information System At Fish Lake Valley Area (Deymonaz...

    Open Energy Info (EERE)

    Fish Lake Valley Area (Deymonaz, Et Al., 2008) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Fish Lake Valley...

  10. Geographic Information System At Nevada Test And Training Range...

    Open Energy Info (EERE)

    Nevada Test And Training Range Area (Sabin, Et Al., 2004) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Nevada...

  11. Arnold Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Arnold Energy Systems Region: United States Sector: Marine and Hydrokinetic Website: http: This company is listed in the Marine and Hydrokinetic...

  12. California Independent System Operator | Open Energy Information

    Open Energy Info (EERE)

    search 200px Name: California Independent System Operator Address: California ISO P.O. Box 639014 Place: Folsom, California Zip: 95763-9014 Sector: Services Phone Number:...

  13. Environmental Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    Environmental Solar Systems Address: 117 West Street Place: Methuen, Massachusetts Zip: 01844 Region: Greater Boston Area Sector: Solar Product: Solar thermal panels for home...

  14. Taylor Munro Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    V4G 1E2 Sector: Solar Product: Taylor Munro focuses on design and installation of solar water heating systems for residential and commercial applications. References: Taylor...

  15. Vaillant Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    Zip: 92075 Sector: Solar Product: California-based solar company specializing in solar water heating, solar pool heating and solar space heating systems for residential and...

  16. Integrated Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Integrated Energy Systems Address: 747 N Main Street Place: Orange, California Zip: 92868 Region: Southern CA Area Sector: Solar Product: EPC Year Founded: 1985 Phone Number:...

  17. Steam-system upgrades | Open Energy Information

    Open Energy Info (EERE)

    upgrades Jump to: navigation, search TODO: Add description List of Steam-system upgrades Incentives Retrieved from "http:en.openei.orgwindex.php?titleSteam-systemupgrades&old...

  18. Ramgen Power Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Inc Place: Bellevue, Washington State Zip: 98005 Product: Developer of engines and turbines using ramjet shockwave compression technology. Coordinates: 47.61002,...

  19. Resource Energy Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    provides property owners with turn-key solar energy services. RES completes all phases of solar design, installation, and completion. References: Resource Energy Systems, LLC1...

  20. A123 Systems | Open Energy Information

    Open Energy Info (EERE)

    Zip: 02472 Region: Greater Boston Area Sector: Efficiency Product: Nanotech batteries Website: www.a123systems.com Coordinates: 42.3637762, -71.1662161 Show Map...

  1. Cape Systems Limited | Open Energy Information

    Open Energy Info (EERE)

    Limited Jump to: navigation, search Name: Cape Systems Limited Place: Rock Sound, Bahamas Sector: Services Product: Offers installation and site surveying services for clean...

  2. Sustainable Transport Systems STS | Open Energy Information

    Open Energy Info (EERE)

    STS Jump to: navigation, search Name: Sustainable Transport Systems (STS) Place: Santa Cruz, California Zip: 95062 Sector: Carbon, Efficiency Product: California-based...

  3. Sequentric Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    About Partnership with NREL Partnership with NREL Yes Partnership Type Test & Evaluation Partner Partnering Center within NREL Electricity Resources & Building Systems...

  4. Plurion Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    to develop, market and distribute a new technology for High Capacity Electricity Storage (HCES) batteries. References: Plurion Systems Inc1 This article is a stub. You can...

  5. MGE UPS SYSTEMS SA | Open Energy Information

    Open Energy Info (EERE)

    SA Jump to: navigation, search Name: MGE UPS SYSTEMS SA Place: Saint Ismier, France Zip: 38 334 Product: Provides a comprehensive range of Uninterruptible Power Supply and power...

  6. Solstice Solar Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    California Zip: 95008-6906 Sector: Solar Product: US-based manufacturer of PV inverters and wires to connect solar panels. References: Solstice Solar Systems LLC1 This...

  7. MGE UPS SYSTEMS Inc | Open Energy Information

    Open Energy Info (EERE)

    conversion and distribtution products such as uninterruptible power supplies, inverters, rectifiers and surge suppressors. References: MGE UPS SYSTEMS Inc1 This article...

  8. Depasol Eco Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Trinitapoli, Italy Zip: 71049 Sector: Solar Product: Manufacturer of PV modules and solar passive systems, plans an ingot and cell division as of January 2008. Coordinates:...

  9. Fuel Systems Solutions Inc | Open Energy Information

    Open Energy Info (EERE)

    company with divisions focusing on bringing cleaner-burning gaseous fuel (such as propane and natural gas) technology to various types of vehicles. References: Fuel Systems...

  10. Jadoo Power Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Product: US-based fuel cell developer, Jadoo Power Systems Inc, produces high energy density power products for the law enforcement, military and electronic news gathering...

  11. Innovative Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Valley Road Place: St. Paul, Minnesota Zip: 55108 Sector: Solar Product: solar and wind electric systems Year Founded: 1991 Phone Number: 612-623-3246 Website:...

  12. ReEnergie Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Place: Behringersdorf, Germany Zip: D-90571 Sector: Biomass, Hydro, Solar, Wind energy Product: Distributor and marketer of equipment using solar, wind, biomass and...

  13. Megawatt Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems Place: Zionsville, Indiana Sector: Renewable Energy, Services, Solar, Wind energy Phone Number: 317.797.3381 Website: www.mwenergysystems.com Coordinates:...

  14. Energy Systems Network ESN | Open Energy Information

    Open Energy Info (EERE)

    associations and breakthroughs in cleantech which help promote growth in the local economy. References: Energy Systems Network (ESN)1 This article is a stub. You can help...

  15. Sunpower Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Inc manufacturers and markets the first fully integrated patented solar charged cellular phone battery. References: Sunpower Systems Inc1 This article is a stub. You can...

  16. Clean Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Zip: 95742 Product: The company has developed oxyfuel technology for zero emission fossil fuel power plants. References: Clean Energy Systems1 This article is a stub. You can...

  17. Perpetual Energy Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    search Name: Perpetual Energy Systems Ltd. Place: Hyderabad, Andhra Pradesh, India Zip: 500 029 Sector: Biomass Product: Biomass project developer in India Coordinates:...

  18. Solar Roofing Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Inc Place: Aurora, Ontario, Canada Zip: L4G 3S8 Product: Manufactures and develops photovoltaic roofing and portable products. References: Solar Roofing Systems Inc1 This...

  19. Supercritical Recovery Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    Recovery Systems LLC Place: Clayton, Missouri Zip: 63105 Product: Holder of various biofuel processing technologies. Deeveloping an ethanol plant in Lacassine, Louisiana....

  20. Advanced Lighting Systems | Open Energy Information

    Open Energy Info (EERE)

    Minnesota Zip: 56378 Product: Advanced Lighting Systems (ALS) provides a number of LED and fiber optic lighting solutions. It was acquired by Nexxus Lighting in September...

  1. Energy Systems Limited ESL | Open Energy Information

    Open Energy Info (EERE)

    Renewable Energy, Solar Product: ESL deals with design, supply, installations and maintenance of solar and other renewable energy systems in Uganda. The company has a special...

  2. Building Management System Integrators | Open Energy Information

    Open Energy Info (EERE)

    Place: Berkshire, England, United Kingdom Zip: SL1 5AU Product: Service and maintenance provider. References: Building Management System Integrators1 This article is a...

  3. Enolia Solar Systems | Open Energy Information

    Open Energy Info (EERE)

    PV project developer, installer, distributor of products, and operations and maintenance service provider. References: Enolia Solar Systems1 This article is a stub. You...

  4. Energy Systems Laboratory ESL | Open Energy Information

    Open Energy Info (EERE)

    ESL specializes in the research fields of metering, modeling and data analysis of energy use in buildings. References: Energy Systems Laboratory (ESL)1 This article is a...

  5. Facility Energy Decision System | Open Energy Information

    Open Energy Info (EERE)

    System (FEDS) AgencyCompany Organization: Federal Energy Management Program Sector: Energy Focus Area: Buildings Phase: Evaluate Effectiveness and Revise as Needed Topics:...

  6. Fastcap Systems Corporation | Open Energy Information

    Open Energy Info (EERE)

    Corporation Jump to: navigation, search Name: Fastcap Systems Corporation Place: Cambridge, Massachusetts Zip: 2139 Sector: Carbon Product: Cambridge-based ultracapacitor...

  7. Nextronex Energy Systems LLC | Open Energy Information

    Open Energy Info (EERE)

    Systems LLC Address: 4400 Moline Martin Rd Place: Millbury, Ohio Zip: 43447-9401 Sector: Efficiency, Renewable Energy, Services, Solar Website: www.nextronex.comdefault.asp...

  8. Greentech Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Place: Denmark Product: The company aims to develop, own or partly own energy plants, which produce electricity on the basis of sustainable energy forms. References:...

  9. Alternative Fuel Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    Ltd Place: Slinfold, United Kingdom Zip: RH13 7SZ Product: Supplier and installer of LPG conversions. Also develops Alkaline Fuel Cell systems. Coordinates: 51.069,...

  10. Ballard Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Avenue Place: Lowell, Massachusetts Zip: 01851 Region: Greater Boston Area Sector: Hydrogen Product: Designs and manufactures fuel cell systems Website: www.ballard.com...

  11. Perpetual Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Perpetual Energy Systems Place: Woodland Hills, California Zip: 91367 Sector: Renewable Energy, Solar Product: String representation "Perpetual Energ ... sustainability." is too...

  12. System Advisor Model (SAM) | Open Energy Information

    Open Energy Info (EERE)

    total electricity production in kilowatt-hours for the first year based on hourly weather data for a particular location, and physical specifications of the power system...

  13. Teletrol Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Manchester, New Hampshire Zip: NH 03101 Product: A global supplier of building automation and management systems and components designed to reduce energy consumption, improve...

  14. Sustina Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Energy provides customers with a variety of renewable energy products. Their online store features the Evergreen 180 Watt Solar Module, and the AIR Breeze wind power system.2...

  15. Redhawk Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Redhawk Energy Systems Address: 10340 Palmer Rd. SW Place: Athens, Ohio Zip: 45701 Sector: Efficiency, Renewable Energy, Services, Solar,...

  16. Enhanced Geothermal Systems (EGS) | Open Energy Information

    Open Energy Info (EERE)

    DOE EGS Technical Roadmap DOE EGS Systems Demonstration Projects How EGS Works (Animation) EGS Development (Animation) EGS Schematic.jpg Dictionary.png Enhanced Geothermal...

  17. Proton Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Proton Energy Systems Inc Place: Wallingford, Connecticut Zip: 6492 Sector: Hydro, Hydrogen Product: Develops, manufactures and sells proprietary Proton Exchange Membrane (PEM)...

  18. Virent Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems Inc Place: Madison, Wisconsin Zip: 53704 Sector: Biomass, Hydro, Hydrogen Product: A start-up focused on the development and commercialization of a new process...

  19. SunSystem Srl | Open Energy Information

    Open Energy Info (EERE)

    search Name: SunSystem Srl Place: Milan, Italy Zip: 20124 Product: Subsidiary of Italian engineering company HQ engineering, Sunsystems specialises in the installation of...

  20. INI Power Systems | Open Energy Information

    Open Energy Info (EERE)

    search Name: INI Power Systems Place: Cary, North Carolina Zip: 27513 Product: Direct methanol fuel cells targeted at the portable electronics marketplace. Coordinates: 35.78933,...

  1. Towards Sustainable Watershed Dvelopment: A Geographic Information Systems based Approach

    SciTech Connect (OSTI)

    Bhaduri, Budhendra L

    2006-01-01

    With an unprecedented projection of population and urban growth in the coming decades, assessment of the long-term hydrologic impacts of land use change is crucial for optimizing management practices to control runoff and non-point source (NPS) pollution associated with sustainable watershed development. Land use change, dominated by an increase in urban/impervious areas, can have a significant impact on water resources. Non-point source (NPS) pollution is the leading cause of degraded water quality in the US and urban areas are an important source of NPS pollution. Most planners, government agencies, and consultants lack access to simple impact-assessment tools despite widespread concern over the environmental impacts of watershed development. Before investing in complex analyses and customized data collection, it is often useful to utilize simple screening analyses using data that are already available. In this paper, we discuss such a technique for long-term hydrologic impact assessment (L-THIA) that makes use of basic land use, soils and long-term rainfall data to compare the hydrologic impacts of past, present and any future land use change. Long-term daily rainfall records are used in combination with soils and land use information to calculate average annual runoff and NPS pollution at a watershed scale. Because of the geospatial nature of land use and soils data, and the increasingly widespread use of GIS by planners, government agencies and consultants, the model is integrated with a Geographic Information System (GIS) that allows convenient generation and management of model input and output data, and provides advanced visualization of the model results. An application of the L-THIA/NPS model on the Little Eagle Creek (LEC) watershed near Indianapolis, Indiana is illustrated in this paper. Three historical land use scenarios for 1973, 1984, and 1991 were analyzed to track land use change in the watershed and to assess the impacts of land use change on annual average runoff and NPS pollution from the watershed and its five sub-basins. Results highlight the effectiveness of the L-THIA approach in assessing the long-term hydrologic impact of urban sprawl. The L-THIA/NPS GIS model is a powerful tool for identifying environmentally sensitive areas in terms of NPS pollution potential and for evaluating alternative land use scenarios to enhance NPS pollution management. Access to the model via the INTERNET enhances the usability and effectiveness of the technique significantly. Recommendations can be made to community decision makers, based on this analysis, concerning how development can be controlled within the watershed to minimize the long-term impacts of increased stormwater runoff and NPS pollution for better management of water resources.

  2. Commissioning of the LHC Low Level RF System Remote Configuration Tools

    SciTech Connect (OSTI)

    Van Winkle, Daniel; Fox, John; Mastorides, Themis; Rivetta, Claudio; Baudrenghien, Philippe; Butterworth, Andrew; Molendijk, John; /CERN

    2010-08-26

    The LHC Low Level RF system (LLRF) is a complex multi-loop system used to regulate the superconductive cavity gap voltage as well as to reduce the impedance presented by RF stations to the beam. The RF system can have a profound impact on the stability of the beam; a mis-configured RF system has the potential of causing longitudinal instabilities, beam diffusion and beam loss. To configure the RF station for operation, a set of parameters in the LLRF multi-loop system have to be defined. Initial system commissioning as well as ongoing operation requires a consistent method of computer based remote measurement and model-based design of each RF station feedback system. This paper describes the suite of Matlab tools used for configuring the LHC RF system during the start up in Nov2009-Feb2010. We present a brief overview of the tool, examples of commissioning results, and basics of the model-based design algorithms. This work complements our previous presentation, where the algorithms and methodology followed in the tools were described.

  3. Plate Tectonics, Geographical Information System, paleogeography

    Energy Science and Technology Software Center (OSTI)

    2002-05-24

    The PaleoX.framwork is a dynamically linked/loaded framework for Cocoa applications. The primary goal of this library is to standardize several elements used for working with paleogeographic data. This includes objects designed to organize information for tectonic plates, including maps, rotation objects, plate names, and designations. In addition, PaleoX provides object-oriented solutions for handling standard paleogeographic file formats from the PALEOMAP Project.

  4. Development of a Carbon Management Geographic Information System (GIS) for the United States

    SciTech Connect (OSTI)

    Howard Herzog; Holly Javedan

    2009-12-31

    In this project a Carbon Management Geographical Information System (GIS) for the US was developed. The GIS stored, integrated, and manipulated information relating to the components of carbon management systems. Additionally, the GIS was used to interpret and analyze the effect of developing these systems. This report documents the key deliverables from the project: (1) Carbon Management Geographical Information System (GIS) Documentation; (2) Stationary CO{sub 2} Source Database; (3) Regulatory Data for CCS in United States; (4) CO{sub 2} Capture Cost Estimation; (5) CO{sub 2} Storage Capacity Tools; (6) CO{sub 2} Injection Cost Modeling; (7) CO{sub 2} Pipeline Transport Cost Estimation; (8) CO{sub 2} Source-Sink Matching Algorithm; and (9) CO{sub 2} Pipeline Transport and Cost Model.

  5. Photovoltaic systems for export application. Informal report

    SciTech Connect (OSTI)

    Duffy, J.; Campbell, H.; Sajo, A.; Sanz, E.

    1988-01-31

    One approach to improving the competitiveness of photovoltaic systems is the development of designs specifically for export applications. In other words, where is it appropriate in a system design to incorporate components manufactured and/or assembled in the receiving country in order to improve the photovoltaic exports from the US? What appears to be needed is a systematic method of evaluating the potential for export from the US of PV systems for various application in different countries. Development of such a method was the goal of this project.

  6. Implementation of an Integrated Information Management System for the US DOE Hanford Tank Farms Project

    SciTech Connect (OSTI)

    Joyner, William Scott; Knight, Mark A.

    2013-11-14

    In its role as the Tank Operations Contractor at the U.S. Department of Energy's site in Hanford, WA, Washington River Protection Solutions, LLC is implementing an integrated document control and configuration management system. This system will combine equipment data with technical document data that currently resides in separate disconnected databases. The new system will provide integrated information, enabling users to more readily identify the documents that relate to a structure, system, or component and vice-versa. Additionally, the new system will automate engineering work processes through electronic workflows, and where practical and feasible provide integration with design authoring tools. Implementation of this system will improve configuration management of the technical baseline, increase work process efficiencies, support the efficient design of future large projects, and provide a platform for the efficient future turnover of technical baseline data and information.

  7. Photon Energy Systems Ltd | Open Energy Information

    Open Energy Info (EERE)

    PV modules and PV-powered garden lights, pumps and fences, as well as solar passive water heating systems. Coordinates: 17.6726, 77.5971 Show Map Loading map......

  8. Weatherford Mun Utility System | Open Energy Information

    Open Energy Info (EERE)

    Weatherford Mun Utility System Place: Texas Phone Number: 817-598-4257 Website: www.ci.weatherford.tx.usindex Outage Hotline: 817-598-4257 References: EIA Form EIA-861 Final...

  9. PowerGenix Systems | Open Energy Information

    Open Energy Info (EERE)

    California Zip: 92131-1109 Product: Develops high-discharge nickel-zinc rechargeable batteries. References: PowerGenix Systems1 This article is a stub. You can help OpenEI by...

  10. Teledyne Energy Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Inc Place: Hunt Valley, Maryland Zip: 21031-1311 Product: A global provider of on-site gas and power generation systems based on proprietary fuel cell, electrolysis and...

  11. Columbia Power System | Open Energy Information

    Open Energy Info (EERE)

    931-388-4833 Website: www.cpws.com Facebook: https:www.facebook.compagesColumbia-Power-Water-Systems123897314290346 Outage Hotline: 931-388-4833 References: EIA Form...

  12. Unitil Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Energy Systems Place: New Hampshire Phone Number: 800-582-7276 Website: unitil.com Twitter: @Unitil Facebook: https:www.facebook.comUnitil Outage Hotline: 800-852-3339...

  13. Global Wind Systems Inc | Open Energy Information

    Open Energy Info (EERE)

    Global Wind Systems, Inc. Place: Novi, Michigan Zip: 48375 Product: Michigan-based startup company that plans to develop a turbine assembly plant in the town of Novi, using a...

  14. Accelrate Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Systems Place: Vancouver, British Columbia, Canada Zip: V6E 4G1 Product: High Speed Battery Charger Technology. Coordinates: 49.26044, -123.114034 Show Map Loading map......

  15. Solar Systems USA | Open Energy Information

    Open Energy Info (EERE)

    up":"","inlineLabel":"","visitedicon":"" Hide Map References: Solar Systems USA Online Solar Panel Retailer1 This article is a stub. You can help OpenEI by expanding it. Solar...

  16. Solar Systems sro | Open Energy Information

    Open Energy Info (EERE)

    Republic Zip: 180 00 Product: Czech leading developer for residential and utility PV plants. References: Solar Systems sro1 This article is a stub. You can help OpenEI by...

  17. Proton Power Systems Plc | Open Energy Information

    Open Energy Info (EERE)

    Power Systems Plc Place: Starnberg, Bavaria, Germany Zip: D-82319 Sector: Hydro, Hydrogen Product: UK-based parent company of Proton Motor GmbH, which operates in Germany. The...

  18. Guidance for Fiscal Year 2015 Facilities Information Management System Data

    Energy Savers [EERE]

    Validations | Department of Energy Fiscal Year 2015 Facilities Information Management System Data Validations Guidance for Fiscal Year 2015 Facilities Information Management System Data Validations PDF icon FIMS VALIDATION GUIDANCE_FY 2015 with MEMO 141120 FINAL.pdf More Documents & Publications Three-year Rolling Timeline Three Year Rolling Timeline WAPA Recovery Act Implementation Appropriation

  19. Analysis Models and Tools: Systems Analysis of Hydrogen and Fuel Cells

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Page1 Hierarchy of Various Models Used for Hydrogen and Fuel Cell Analyses Analysis Models and Tools Systems Analysis of Hydrogen & Fuel Cells With a multitude of end-uses-such as distributed power for back-up, primary, and combined heat-and- power systems; automobiles, buses, forklifts and other specialty vehicles; and auxiliary power units and portable electronics-fuel cell applications hold potential to dramatically impact the 21st century clean energy economy. Fuel cells can efficiently

  20. The AmeriFlux Data Activity and Data System: An Evolving Collection of Data Management Techniques, Tools, Products and Services

    SciTech Connect (OSTI)

    Boden, Thomas A; Krassovski, Misha B; Yang, Bai

    2013-01-01

    The Carbon Dioxide Information Analysis Center (CDIAC) at Oak Ridge National Laboratory (ORNL), USA has provided scientific data management support for the U.S. Department of Energy and international climate change science since 1982. Over this period, climate change science has expanded from research focusing on basic understanding of geochemical cycles, particularly the carbon cycle, to integrated research addressing climate change impacts, vulnerability, adaptation, and mitigation. Interests in climate change data and information worldwide have grown remarkably and, as a result, so have demands and expectations for CDIAC s data systems. To meet the growing demands, CDIAC s strategy has been to design flexible data systems using proven technologies blended with new, evolving technologies and standards. CDIAC development teams are multidisciplinary and include computer science and information technology expertise, but also scientific expertise necessary to address data quality and documentation issues and to identify data products and system capabilities needed by climate change scientists. CDIAC has learned there is rarely a single commercial tool or product readily available to satisfy long-term scientific data system requirements (i.e., one size does not fit all and the breadth and diversity of environmental data are often too complex for easy use with commercial products) and typically deploys a variety of tools and data products in an effort to provide credible data freely to users worldwide. Like many scientific data management applications, CDIAC s data systems are highly customized to satisfy specific scientific usage requirements (e.g., developing data products specific for model use) but are also designed to be flexible and interoperable to take advantage of new software engineering techniques, standards (e.g., metadata standards) and tools and to support future Earth system data efforts (e.g., ocean acidification). CDIAC has provided data management support for numerous long-term measurement projects crucial to climate change science. One current example is the AmeriFlux measurement network. AmeriFlux provides continuous measurements from forests, grasslands, wetlands, and croplands in North, Central, and South America and offers important insight about carbon cycling in terrestrial ecosystems. We share our approaches in satisfying the challenges of delivering AmeriFlux data worldwide to benefit others with similar challenges handling climate change data, further heighten awareness and use of an outstanding ecological data resource, and highlight expanded software engineering applications being used for climate change measurement data.

  1. The use of information systems to transform utilities and regulatory commissions: The application of geographic information systems

    SciTech Connect (OSTI)

    Wirick, D.W.; Montgomery, G.E.; Wagman, D.C.; Spiers, J.

    1995-09-01

    One technology that can assist utilities remain financially viable in competitive markets and help utilities and regulators to better serve the public is information technology. Because geography is an important part of an electric, natural gas, telecommunications, or water utility, computer-based Geographic Information Systems (GIS) and related Automated Mapping/Facilities Management systems are emerging as core technologies for managing an ever-expanding variety of formerly manual or paper-based tasks. This report focuses on GIS as an example of the types of information systems that can be used by utilities and regulatory commissions. Chapter 2 provides general information about information systems and effects of information on organizations; Chapter 3 explores the conversion of an organization to an information-based one; Chapters 4 and 5 set out GIS as an example of the use of information technologies to transform the operations of utilities and commissions; Chapter 6 describes the use of GIS and other information systems for organizational reengineering efforts; and Chapter 7 examines the regulatory treatment of information systems.

  2. Method and system for analyzing and classifying electronic information

    DOE Patents [OSTI]

    McGaffey, Robert W.; Bell, Michael Allen; Kortman, Peter J.; Wilson, Charles H.

    2003-04-29

    A data analysis and classification system that reads the electronic information, analyzes the electronic information according to a user-defined set of logical rules, and returns a classification result. The data analysis and classification system may accept any form of computer-readable electronic information. The system creates a hash table wherein each entry of the hash table contains a concept corresponding to a word or phrase which the system has previously encountered. The system creates an object model based on the user-defined logical associations, used for reviewing each concept contained in the electronic information in order to determine whether the electronic information is classified. The data analysis and classification system extracts each concept in turn from the electronic information, locates it in the hash table, and propagates it through the object model. In the event that the system can not find the electronic information token in the hash table, that token is added to a missing terms list. If any rule is satisfied during propagation of the concept through the object model, the electronic information is classified.

  3. Deactivation and Decommissioning Planning and Analysis with Geographic Information Systems

    SciTech Connect (OSTI)

    Bollinger, James S.; Koffman, Larry D.; Austin, William E.

    2008-01-15

    From the mid-1950's through the 1980's, the U.S. Department of Energy's Savannah River Site produced nuclear materials for the weapons stockpile, for medical and industrial applications, and for space exploration. Although SRS has a continuing defense-related mission, the overall site mission is now oriented toward environmental restoration and management of legacy chemical and nuclear waste. With the change in mission, SRS no longer has a need for much of the infrastructure developed to support the weapons program. This excess infrastructure, which includes over 1000 facilities, will be decommissioned and demolished over the forthcoming years. Dis-positioning facilities for decommissioning and deactivation requires significant resources to determine hazards, structure type, and a rough-order-of-magnitude estimate for the decommissioning and demolition cost. Geographic information systems (GIS) technology was used to help manage the process of dis-positioning infrastructure and for reporting the future status of impacted facilities. Several thousand facilities of various ages and conditions are present at SRS. Many of these facilities, built to support previous defense-related missions, now represent a potential hazard and cost for maintenance and surveillance. To reduce costs and the hazards associated with this excess infrastructure, SRS has developed an ambitious plan to decommission and demolish unneeded facilities in a systematic fashion. GIS technology was used to assist development of this plan by: providing locational information for remote facilities, identifying the location of known waste units adjacent to buildings slated for demolition, and for providing a powerful visual representation of the impact of the overall plan. Several steps were required for the development of the infrastructure GIS model. The first step involved creating an accurate and current GIS representation of the infrastructure data. This data is maintained in a Computer Aided Design (CAD) system and had to be imported into a GIS framework. Since the data is maintained in a different format in CAD, import into GIS involved several spatial processing steps to convert various geometric shapes present in the CAD data to self-closing polygons. The polygons represent facility footprints in plan or map view. Once these were successfully imported and converted, building identifier attributes from the CAD had to be associated with the appropriate polygons in GIS. Attributes are stored as graphical information in a CAD system and are not 'attached' to a building in a relational sense. In GIS, attributes such as building names, building area, hazards, or other descriptive information, must be associated or related to the spatial polygon representing a particular building. This spatial relationship between building polygons and the descriptive attribute information is very similar to relating tables of information in a relational database in which each table record has a unique identifier that can be used to join or relate that table to other tables of information present in the database. The CAD building identifiers were imported into the GIS and several spatial processing steps were used to associate building polygons with the correct identifiers. These spatial steps involved determining the intersection of and nearest identifiers with each building polygon in the GIS. Automating this process in GIS saved a significant amount of time. Once a current and geographically correct representation of the infrastructure data had been created in GIS, field-engineering teams collected information for each facility. This information included the building area, radiological hazards and the associated area, industrial hazards such as asbestos or mercury, structure type (e.g. hardened, industrial, nuclear), annual surveillance and monitoring cost, and other engineering data. The facility engineering data was used in a simple model to determine the rough-order-of-magnitude cost for decontaminating and demolishing each facility. Finally, the engineering and cost data was linked to the GIS model so that this data could be rapidly displayed and analyzed in its geographic context. Once the GIS representing SRS infrastructure and associated descriptive attribute information was developed, detailed maps depicting the future status of all site facilities were created. These maps display the relationship between known waste units and buildings that will be decommissioned and demolished. Cost and hazard information was also depicted illustrating areas and facilities that could present a particular demolition challenge. Although the GIS was quite helpful as an engineering and planning tool, its real power was evident in communicating the impact of the facilities disposition plan to senior management and other stakeholders.

  4. Webinar: An Overview of NREL’s Online Data Tool for Fuel Cell System-Derived Contaminants

    Broader source: Energy.gov [DOE]

    The Fuel Cell Technologies Office will present a webinar on the National Renewable Energy Laboratory's online data tool for fuel cell system-derived contaminants.

  5. Improving Power System Modeling. A Tool to Link Capacity Expansion and Production Cost Models

    SciTech Connect (OSTI)

    Diakov, Victor; Cole, Wesley; Sullivan, Patrick; Brinkman, Gregory; Margolis, Robert

    2015-11-01

    Capacity expansion models (CEM) provide a high-level long-term view at the prospects of the evolving power system. In simulating the possibilities of long-term capacity expansion, it is important to maintain the viability of power system operation in the short-term (daily, hourly and sub-hourly) scales. Production-cost models (PCM) simulate routine power system operation on these shorter time scales using detailed load, transmission and generation fleet data by minimizing production costs and following reliability requirements. When based on CEM 'predictions' about generating unit retirements and buildup, PCM provide more detailed simulation for the short-term system operation and, consequently, may confirm the validity of capacity expansion predictions. Further, production cost model simulations of a system that is based on capacity expansion model solution are 'evolutionary' sound: the generator mix is the result of logical sequence of unit retirement and buildup resulting from policy and incentives. The above has motivated us to bridge CEM with PCM by building a capacity expansion - to - production cost model Linking Tool (CEPCoLT). The Linking Tool is built to onset capacity expansion model prescriptions onto production cost model inputs. NREL's ReEDS and Energy Examplar's PLEXOS are the capacity expansion and the production cost models, respectively. Via the Linking Tool, PLEXOS provides details of operation for the regionally-defined ReEDS scenarios.

  6. Decontamination systems information and research program

    SciTech Connect (OSTI)

    Not Available

    1993-01-01

    It is estimated that over 3700 hazardous waste sites are under the jurisdiction of the Department of Energy (DOE). These sites were primarily generated from 45 years worth of environmental pollution from the design and manufacture of nuclear materials and weapons, and contain numerous types of wastes including: (1) volatile, low-volatile and nonvolatile organics, (2) radionuclides (e.g., uranium, plutonium and cesium), (3) nonradioactive heavy metals (e.g., chromium, nickel, and lead), and (4) toxic chemicals. These contaminants affect several media including soils (saturated and unsaturated), groundwater, vegetation, and air. Numerous and diverse DOE hazardous waste sites can be enumerated from soils contaminated by organics such as trichloroethylene (TCE) and perchloroethylene (PCE) at the Savannah River site to biota and vegetation contaminated by radionuclides such as radiocesium and radiostrontium at the Oak Ridge site. Over the next 30 years, the Department of Energy (DOE) is committed to bringing all its facilities into compliance with applicable Federal, State, and local environmental laws and regulations. This clean-up task is quite complex involving numerous sites containing various radioactive, organic and inorganic contaminants. To perform this clean-up effort in the most efficient manner at each site will require that DOE managers have access to all available information on pertinent technologies; i.e., to aid in maximum technology transfer. The purpose of this effort is to systematically develop a databast of those currently available and emerging clean-up technologies.

  7. Analyst Tools and Quality Control Software for the ARM Data System

    SciTech Connect (OSTI)

    Moore, S.T.

    2004-12-14

    ATK Mission Research develops analyst tools and automated quality control software in order to assist the Atmospheric Radiation Measurement (ARM) Data Quality Office with their data inspection tasks. We have developed a web-based data analysis and visualization tool, called NCVweb, that allows for easy viewing of ARM NetCDF files. NCVweb, along with our library of sharable Interactive Data Language procedures and functions, allows even novice ARM researchers to be productive with ARM data with only minimal effort. We also contribute to the ARM Data Quality Office by analyzing ARM data streams, developing new quality control metrics, new diagnostic plots, and integrating this information into DQ HandS - the Data Quality Health and Status web-based explorer. We have developed several ways to detect outliers in ARM data streams and have written software to run in an automated fashion to flag these outliers.

  8. System and method for acquisition management of subject position information

    DOE Patents [OSTI]

    Carrender, Curt

    2005-12-13

    A system and method for acquisition management of subject position information that utilizes radio frequency identification (RF ID) to store position information in position tags. Tag programmers receive position information from external positioning systems, such as the Global Positioning System (GPS), from manual inputs, such as keypads, or other tag programmers. The tag programmers program each position tag with the received position information. Both the tag programmers and the position tags can be portable or fixed. Implementations include portable tag programmers and fixed position tags for subject position guidance, and portable tag programmers for collection sample labeling. Other implementations include fixed tag programmers and portable position tags for subject route recordation. Position tags can contain other associated information such as destination address of an affixed subject for subject routing.

  9. System and method for acquisition management of subject position information

    DOE Patents [OSTI]

    Carrender, Curt

    2007-01-23

    A system and method for acquisition management of subject position information that utilizes radio frequency identification (RF ID) to store position information in position tags. Tag programmers receive position information from external positioning systems, such as the Global Positioning System (GPS), from manual inputs, such as keypads, or other tag programmers. The tag programmers program each position tag with the received position information. Both the tag programmers and the position tags can be portable or fixed. Implementations include portable tag programmers and fixed position tags for subject position guidance, and portable tag programmers for collection sample labeling. Other implementations include fixed tag programmers and portable position tags for subject route recordation. Position tags can contain other associated information such as destination address of an affixed subject for subject routing.

  10. Load Model Data Tool

    Energy Science and Technology Software Center (OSTI)

    2013-04-30

    The LMDT software automates the process of the load composite model data preparation in the format supported by the major power system software vendors (GE and Siemens). Proper representation of the load composite model in power system dynamic analysis is very important. Software tools for power system simulation like GE PSLF and Siemens PSSE already include algorithms for the load composite modeling. However, these tools require that the input information on composite load to bemore » provided in custom formats. Preparation of this data is time consuming and requires multiple manual operations. The LMDT software enables to automate this process. Software is designed to generate composite load model data. It uses the default load composition data, motor information, and bus information as an input. Software processes the input information and produces load composition model. Generated model can be stored in .dyd format supported by GE PSLF package or .dyr format supported by Siemens PSSE package.« less

  11. Attachment 2 Â… List of Major Information Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exhibit 1 - List of Major Information Systems Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear Security Administration ADaPT Network Infrastructure: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. Advanced Simulation and

  12. Application of geographic information systems to waste minimization efforts at Los Alamos National Laboratory

    SciTech Connect (OSTI)

    Lyttle, T.W.; Smith, D.M.; Burns, M.; Weinrach, J.B.

    1993-01-01

    At Los Alamos National Laboratory (LANL), facility waste streams tend to be small but highly diverse. Initial characterization of such waste streams is often difficult in part due to a lack of tools to assist the generators themselves in completing such assessments. A methodology has been developed at LANL to allow process knowledgeable field personnel to develop baseline waste generation assessments and to evaluate potential waste minimization technology. This Process Waste Assessment (PWA) system is an application constructed within the Process Modeling System and currently being integrated with the InFoCAD Geographic Information System (GIS) . The Process Modeling System (PMS) is an object-oriented, mass balance-based, discrete-event simulation framework written using the Common Lisp Object System (CLOS) . Analytical capabilities supported within the PWA system include: complete mass balance specifications, historical characterization of selected waste streams and generation of facility profiles for materials consumption, resource utilization and worker exposure. Development activities include integration with the LANL facilities management Geographic Information System (GIS) and provisions for a Best Available Technologies (BAT) database. The environments used to develop these assessment tools will be discussed in addition to a review of initial implementation results.

  13. Database for Regional Geology, Phase 1- A Tool for informing Regional

    Energy Savers [EERE]

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  14. Resource Planning Model: An Integrated Resource Planning and Dispatch Tool for Regional Electric Systems

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Resource Planning Model: An Integrated Resource Planning and Dispatch Tool for Regional Electric Systems Trieu Mai, Easan Drury, Kelly Eurek, Natalie Bodington, Anthony Lopez, and Andrew Perry Technical Report NREL/TP-6A20- 56723 January 2013 NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. National Renewable Energy Laboratory 15013 Denver West Parkway Golden, Colorado 80401

  15. DECONTAMINATION SYSTEMS AND INFORMATION RESEARCH PROGRAM

    SciTech Connect (OSTI)

    Echol E. Cook, Ph.D., PE.

    1998-11-01

    During the five plus years this Cooperative Agreement existed, more than 45 different projects were funded. Most projects were funded for a one year period but there were some, deemed of such quality and importance, funded for multiple years. Approximately 22 external agencies, businesses, and other entities have cooperated with or been funded through the WVU Cooperative Agreement over the five plus years. These external entities received 33% of the funding by this Agreement. The scope of this Agreement encompassed all forms of hazardous waste remediation including radioactive, organic, and inorganic contaminants. All matrices were of interest; generally soil, water, and contaminated structures. Economic, health, and regulatory aspects of technologies were also within the scope of the agreement. The highest priority was given to small businesses funded by the Federal Energy Technology Center (FETC) and Department of Energy (DOE) involved in research and development of innovative remediation processes. These projects were to assist in the removal of barriers to development and commercialization of these new technologies. Studies of existing, underdeveloped technologies, were preferred to fundamental research into remediation technologies. Sound development of completely new technologies was preferred to minor improvements in existing methods. Solid technological improvements in existing technologies or significant cost reduction through innovative redesign were the preferred projects. Development, evaluation, and bench scale testing projects were preferred for the WVU research component. In the effort to fill gaps in current remediation technologies, the worth of the WVU Cooperative Agreement was proven. Two great technologies came out of the program. The Prefabricated Vertical Drain Technology for enhancing soil flushing was developed over the 6-year period and is presently being demonstrated on a 0.10 acre Trichloroethylene contaminated site in Ohio. The SpinTek Centrifugal Membrane System was a unique separation process introduced through the Agreement that is now being used at the Los Alamos National Laboratory. Based on the cost to the USDOE for both technologies and considering their usefulness in cleaning up contaminated sites, no other technologies developed through USDOE provide or have the propensity to provide as great a return on investment and impact on environmental remediation. These technologies alone make the $10.3 million USDOE investment in the WVU Cooperative Agreement a tremendous investment.

  16. NNSA's G2 Management Information System Wins Association for...

    National Nuclear Security Administration (NNSA)

    Apply for Our Jobs Our Jobs Working at NNSA Blog Home Library Press Releases NNSA's G2 Management Information System ... the U.S. Department of Energy responsible for enhancing ...

  17. The Bureau of Land Management's Well Information System (WIS...

    Open Energy Info (EERE)

    Bureau of Land Management's Well Information System (WIS) How-To Guide Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - Guide...

  18. Nuclear fuel cycle system simulation tool based on high-fidelity component modeling

    SciTech Connect (OSTI)

    Ames, David E.

    2014-02-01

    The DOE is currently directing extensive research into developing fuel cycle technologies that will enable the safe, secure, economic, and sustainable expansion of nuclear energy. The task is formidable considering the numerous fuel cycle options, the large dynamic systems that each represent, and the necessity to accurately predict their behavior. The path to successfully develop and implement an advanced fuel cycle is highly dependent on the modeling capabilities and simulation tools available for performing useful relevant analysis to assist stakeholders in decision making. Therefore a high-fidelity fuel cycle simulation tool that performs system analysis, including uncertainty quantification and optimization was developed. The resulting simulator also includes the capability to calculate environmental impact measures for individual components and the system. An integrated system method and analysis approach that provides consistent and comprehensive evaluations of advanced fuel cycles was developed. A general approach was utilized allowing for the system to be modified in order to provide analysis for other systems with similar attributes. By utilizing this approach, the framework for simulating many different fuel cycle options is provided. Two example fuel cycle configurations were developed to take advantage of used fuel recycling and transmutation capabilities in waste management scenarios leading to minimized waste inventories.

  19. Controllable quantum information network with a superconducting system

    SciTech Connect (OSTI)

    Zhang, Feng-yang, E-mail: zhangfy@mail.dlut.edu.cn [School of Physics and Materials Engineering, Dalian Nationalities University, Dalian 116600 (China); Liu, Bao [Beijing Computational Science Research Center (CSRC), Beijing 100084 (China); Chen, Zi-hong [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China); Wu, Song-lin [School of Physics and Materials Engineering, Dalian Nationalities University, Dalian 116600 (China); Song, He-shan [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)

    2014-07-15

    We propose a controllable and scalable architecture for quantum information processing using a superconducting system network, which is composed of current-biased Josephson junctions (CBJJs) as tunable couplers between the two superconducting transmission line resonators (TLRs), each coupling to multiple superconducting qubits (SQs). We explicitly demonstrate that the entangled state, the phase gate, and the information transfer between any two selected SQs can be implemented, respectively. Lastly, numerical simulation shows that our scheme is robust against the decoherence of the system. -- Highlights: •An architecture for quantum information processing is proposed. •The quantum information transfer between any two selected SQs is implemented. •This proposal is robust against the decoherence of the system. •This architecture can be fabricated on a chip down to the micrometer scale.

  20. Mounting arrangement for the drive system of an air-bearing spindle on a machine tool

    DOE Patents [OSTI]

    Lunsford, J.S.; Crisp, D.W.; Petrowski, P.L.

    1987-12-07

    The present invention is directed to a mounting arrangement for the drive system of an air-bearing spindle utilized on a machine tool such as a lathe. The mounting arrangement of the present invention comprises a housing which is secured to the casing of the air bearing in such a manner that the housing position can be selectively adjusted to provide alignment of the air-bearing drive shaft supported by the housing and the air-bearing spindle. Once this alignment is achieved the air between spindle and the drive arrangement is maintained in permanent alignment so as to overcome misalignment problems encountered in the operation of the machine tool between the air-bearing spindle and the shaft utilized for driving the air-bearing spindle.

  1. Columbia River Coordinated Information System (CIS); Information Needs, 1992 Technical Report.

    SciTech Connect (OSTI)

    Petrosky, Charlie; Kinney, William J.; Rowe, Mike

    1993-05-01

    Successful application of adaptive management to rebuilding the Columbia Basin`s anadromous fish resources requires that available information and experience be organized and shared between numerous organizations and individuals. Much of this knowledge exists only in unpublished form in agency and individual files. Even that information which is published in the form of technical and contract reports receives only limited distribution and is often out of print and unavailable after a few years. Only a small fraction of the basin`s collective knowledge is captured in permanent and readily available databases and recognized journals. State, tribal, and federal fishery managers have recognize these information management problems and have committed to a program, the Coordinated Information System Project, to capture and share more easily the core data and other information upon which management decisions are based. That project is now completing the process of scoping and identification of information needs. Construction of prototype systems will begin in 1992. This report is one in a series of seven describing the results of the Coordinated Information on System scoping and needs identification phase.

  2. Mutually exclusive aspects of information carried by physical systems: Complementarity between local and nonlocal information

    SciTech Connect (OSTI)

    Oppenheim, Jonathan; Horodecki, Karol; Horodecki, Michal; Horodecki, Ryszard; Horodecki, Pawel

    2003-08-01

    Complex physical systems contain information which, under some well-defined processes can differentiate between local and nonlocal information. Both these fundamental aspects of information are defined operationally. Local information is locally accessible and allows one to perform processes, such as physical work, while nonlocal information allows one to perform processes such as teleportation. It is shown that these two kinds of information are complementary in the sense that two parties can either gain access to the nonlocal information or to the local information but not both. This complementarity has a form similar to that expressed by entropic uncertainty relations. For pure states, the entanglement plays the role of Planck's constant. We also find another class of complementarity relations which applies to operators and is induced when two parties can only perform local operations and communicate classical (LOCC). In particular, observables such as the parity and phase of two qubits commute but under LOCC, they are complementary observables. It is also found this complementarity is pure in the sense that it can be ''decoupled'' from the uncertainty principle. It is suggested that these complementarities represent an essential extension of Bohr's complementarity to complex (distributed) systems which are entangled.

  3. COMPREHENSIVE DIAGNOSTIC AND IMPROVEMENT TOOLS FOR HVAC-SYSTEM INSTALLATIONS IN LIGHT COMMERCIAL BUILDINGS

    SciTech Connect (OSTI)

    Abram Conant; Mark Modera; Joe Pira; John Proctor; Mike Gebbie

    2004-10-31

    Proctor Engineering Group, Ltd. (PEG) and Carrier-Aeroseal LLP performed an investigation of opportunities for improving air conditioning and heating system performance in existing light commercial buildings. Comprehensive diagnostic and improvement tools were created to address equipment performance parameters (including airflow, refrigerant charge, and economizer operation), duct-system performance (including duct leakage, zonal flows and thermal-energy delivery), and combustion appliance safety within these buildings. This investigation, sponsored by the National Energy Technology Laboratory, a division of the U.S. Department of Energy, involved collaboration between PEG and Aeroseal in order to refine three technologies previously developed for the residential market: (1) an aerosol-based duct sealing technology that allows the ducts to be sealed remotely (i.e., without removing the ceiling tiles), (2) a computer-driven diagnostic and improvement-tracking tool for residential duct installations, and (3) an integrated diagnosis verification and customer satisfaction system utilizing a combined computer/human expert system for HVAC performance. Prior to this work the aerosol-sealing technology was virtually untested in the light commercial sector--mostly because the savings potential and practicality of this or any other type of duct sealing had not been documented. Based upon the field experiences of PEG and Aeroseal, the overall product was tailored to suit the skill sets of typical HVAC-contractor personnel.

  4. Collaboration Tools | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services » Information Systems » Collaboration Tools Collaboration Tools Collaboration is much more than just sharing information. It is a form of teamwork and a process of exchanging ideas that positively impacts progress. While it is relatively easy to collaborate with your peers in the office, effective collaboration is difficult to achieve within distributed teams without use of technology. In order to bridge the distance between project teams, Office of Project Management Oversight &

  5. Massively parallel processing on the Intel Paragon system: One tool in achieving the goals of the Human Genome Project

    SciTech Connect (OSTI)

    Ecklund, D.J.

    1993-12-31

    A massively parallel computing system is one tool that has been adopted by researchers in the Human Genome Project. This tool is one of many in a toolbox of theories, algorithms, and systems that are used to attack the many questions posed by the project. A good tool functions well when applied alone to the problem for which it was devised. A superior tool achieves its solitary goal, and supports and interacts with other tools to achieve goals beyond the scope of any individual tool. The author believes that Intel`s massively parallel Paragon{trademark} XP/S system is a superior tool. This paper presents specific requirements for a superior computing tool for the Human Genome Project (HGP) and shows how the Paragon system addresses these requirements. Computing requirements for HGP are based on three factors: (1) computing requirements of algorithms currently used in sequence homology, protein folding, and database insertion/retrieval; (2) estimates of the computing requirements of new applications arising from evolving biological theories; and (3) the requirements for facilities that support collaboration among scientists in a project of this magnitude. The Paragon system provides many hardware and software features that effectively address these requirements.

  6. Guidelines for the implementation of an open source information system

    SciTech Connect (OSTI)

    Doak, J.; Howell, J.A.

    1995-08-01

    This work was initially performed for the International Atomic Energy Agency (IAEA) to help with the Open Source Task of the 93 + 2 Initiative; however, the information should be of interest to anyone working with open sources. The authors cover all aspects of an open source information system (OSIS) including, for example, identifying relevant sources, understanding copyright issues, and making information available to analysts. They foresee this document as a reference point that implementors of a system could augment for their particular needs. The primary organization of this document focuses on specific aspects, or components, of an OSIS; they describe each component and often make specific recommendations for its implementation. This document also contains a section discussing the process of collecting open source data and a section containing miscellaneous information. The appendix contains a listing of various providers, producers, and databases that the authors have come across in their research.

  7. Montana Rivers Information System : Edit/Entry Program User's Manual.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration; Montana Department of Fish, Wildlife and Parks

    1992-07-01

    The Montana Rivers Information System (MRIS) was initiated to assess the state`s fish, wildlife, and recreation value; and natural cultural, and geologic features. The MRIS is now a set of data bases containing part of the information in the Natural Heritage Program natural features and threatened and endangered species data bases and comprises of the Montana Interagency Stream Fisheries Database; the MDFWP Recreation Database; and the MDFWP Wildlife Geographic Information System. The purpose of this User`s Manual is to describe to the user how to maintain the MRIS database of their choice by updating, changing, deleting, and adding records using the edit/entry programs; and to provide to the user all information and instructions necessary to complete data entry into the MRIS databases.

  8. Certification and Accreditation Process for Information Systems Including National Security Systems

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2004-02-19

    The Notice ensures the effectiveness of security controls on DOE Federal information systems including national security systems. The Notice will also ensure compliance with the requirements of DOE O 205.1, Department of Energy Cyber Security Management Program, dated 3-21-03, and protect DOE information and information systems from unauthorized access, use, disclosure, modification, or destruction. No cancellations. DOE N 205.15, dated 3-18-05, extends this directive until 3-18-06.

  9. Update on Small Modular Reactors Dynamics System Modeling Tool -- Molten Salt Cooled Architecture

    SciTech Connect (OSTI)

    Hale, Richard Edward; Cetiner, Sacit M.; Fugate, David L.; Qualls, A L.; Borum, Robert C.; Chaleff, Ethan S.; Rogerson, Doug W.; Batteh, John J.; Tiller, Michael M.

    2014-08-01

    The Small Modular Reactor (SMR) Dynamic System Modeling Tool project is in the third year of development. The project is designed to support collaborative modeling and study of various advanced SMR (non-light water cooled) concepts, including the use of multiple coupled reactors at a single site. The objective of the project is to provide a common simulation environment and baseline modeling resources to facilitate rapid development of dynamic advanced reactor SMR models, ensure consistency among research products within the Instrumentation, Controls, and Human-Machine Interface (ICHMI) technical area, and leverage cross-cutting capabilities while minimizing duplication of effort. The combined simulation environment and suite of models are identified as the Modular Dynamic SIMulation (MoDSIM) tool. The critical elements of this effort include (1) defining a standardized, common simulation environment that can be applied throughout the program, (2) developing a library of baseline component modules that can be assembled into full plant models using existing geometry and thermal-hydraulic data, (3) defining modeling conventions for interconnecting component models, and (4) establishing user interfaces and support tools to facilitate simulation development (i.e., configuration and parameterization), execution, and results display and capture.

  10. Automatic tool alignment in a backscatter x-ray scanning system

    DOE Patents [OSTI]

    Garretson, Justin; Hobart, Clinton G.; Gladwell, Thomas S.; Monda, Mark J.

    2015-06-16

    Technologies pertaining to backscatter x-ray scanning systems are described herein. The backscatter x-ray scanning system includes an x-ray source, which directs collimated x-rays along a plurality of output vectors towards a target. A detector detects diffusely reflected x-rays subsequent to respective collimated x-rays impacting the target, and outputs signals indicative of parameters of the detected x-rays. An image processing system generates an x-ray image based upon parameters of the detected x-rays, wherein each pixel in the image corresponds to a respective output vector. A user selects a particular portion of the image, and a tool is positioned such that its directional axis is coincident with the output vector corresponding to at least one pixel in the portion of the image.

  11. Department 1824 Job Card System: A new web-based business tool

    SciTech Connect (OSTI)

    Brangan, J.R.

    1998-02-01

    The Analytical Chemistry Department uses a system of job cards to control and monitor the work through the organization. In the past, many different systems have been developed to allow each laboratory to monitor their individual work and report data. Unfortunately, these systems were separate and unique which caused difficulty in ascertaining any overall picture of the Department`s workload. To overcome these shortcomings, a new Job Card System was developed on Lotus Notes/Domino{trademark} for tracking the work through the laboratory. This application is groupware/database software and is located on the Sandia Intranet which allows users of any type of computer running a network browser to access the system. Security is provided through the use of logons and passwords for users who must add and/or modify information on the system. Customers may view the jobs in process by entering the system as an anonymous user. An overall view of the work in the department can be obtained by selecting from a variety of on screen reports. This enables the analysts, customers, customer contacts, and the Department Manager to quickly evaluate the work in process, the resources required, and the availability of equipment. On-line approval of the work and e-mail messaging of completed jobs has been provided to streamline the review and approval cycle. This paper provides a guide for the use of the Job Card System and information on maintenance of the system.

  12. Rapid solidification processing system for producing molds, dies and related tooling

    DOE Patents [OSTI]

    McHugh, Kevin M.

    2004-06-08

    A system for the spray forming manufacturing of near-net-shape molds, dies and related toolings, wherein liquid material such as molten metal, metallic alloys, or polymers are atomized into fine droplets by a high temperature, high velocity gas and deposited onto a pattern. Quenching of the in-flight atomized droplets provides a heat sink, thereby allowing undercooled and partially solidified droplets to be formed in-flight. Composites can be formed by combining the atomized droplets with solid particles such as powders, whiskers or fibers.

  13. An Energy Signal Tool for Decision Support in Building Energy Systems

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    An Energy Signal Tool for Decision Support in Building Energy Systems Gregor P. Henze, Gregory S. Pavlak, Anthony R. Florita, Robert H. Dodier, and Adam I. Hirsch Technical Report NREL/TP-5500-63130 December 2014 NREL is a national laboratory of the U.S. Department of Energy Office of Energy Efficiency & Renewable Energy Operated by the Alliance for Sustainable Energy, LLC This report is available at no cost from the National Renewable Energy Laboratory (NREL) at www.nrel.gov/publications.

  14. Laboratory information management system at the Hanford Site

    SciTech Connect (OSTI)

    Leggett, W.; Barth, D.; Ibsen, T.; Newman, B.

    1994-03-01

    In January of 1994 an important new technology was brought on line to help in the monumental waste management and environmental restoration work at the Hanford Site. Cleanup at the Hanford Site depends on analytical chemistry information to identify contaminates, design and monitor cleanup processes, assure worker safety, evaluate progress, and prove completion. The new technology, a laboratory information management system (LIMS) called ``LABCORE,`` provides the latest systems to organize and communicate the analytical tasks: track work and samples; collect and process data, prepare reports, and store data in readily accessible electronic form.

  15. Intergovernmental cooperation for mission-oriented information systems: a memoir

    SciTech Connect (OSTI)

    Woolston, John E.

    2004-12-01

    This frankly personal account is based on my involvement in negotiations, design, and development for international bibliographic systems to support three different missions: fostering the peaceful uses of atomic energy (International Nuclear Information System, or INIS); supporting research, development, and better practices in agriculture (International Information System for the Agricultural Sciences and Technology, or AGRIS); and improving economic and social conditions in poorer countries (Development Sciences Information System, or DEVSIS). All three designs were based on the concept of decentralized operation: each country reports the information produced in its own territory; the merging of this input and the overall management are in the hands of an organization in the United Nations system; and all participants have equal rights to exploit the entire database. INIS began in 1970 and is still in steady operation; AGRIS started in 1975 and showed quantitative and qualitative growth for more than twenty years but has been in disastrous decline since its peak in 1996; and DEVSIS, unfortunately, was not launched on a global scale. Attempts are made to identify the condition -- political and technical -- likely to favor or frustrate efforts to obtain cooperation among countries for the construction of large, essentially comprehensive databases and ultimately for sharing knowledge without discrimination between rich and poor participants.

  16. Assessment of Tools and Data for System-Level Dynamic Analyses

    SciTech Connect (OSTI)

    Steven J. Piet; Nick R. Soelberg

    2011-06-01

    The only fuel cycle for which dynamic analyses and assessments are not needed is the null fuel cycle - no nuclear power. For every other concept, dynamic analyses are needed and can influence relative desirability of options. Dynamic analyses show how a fuel cycle might work during transitions from today's partial fuel cycle to something more complete, impact of technology deployments, location of choke points, the key time lags, when benefits can manifest, and how well parts of fuel cycles work together. This report summarizes the readiness of existing Fuel Cycle Technology (FCT) tools and data for conducting dynamic analyses on the range of options. VISION is the primary dynamic analysis tool. Not only does it model mass flows, as do other dynamic system analysis models, but it allows users to explore various potential constraints. The only fuel cycle for which constraints are not important are those in concept advocates PowerPoint presentations; in contrast, comparative analyses of fuel cycles must address what constraints exist and how they could impact performance. The most immediate tool need is extending VISION to the thorium/U233 fuel cycle. Depending on further clarification of waste management strategies in general and for specific fuel cycle candidates, waste management sub-models in VISION may need enhancement, e.g., more on 'co-flows' of non-fuel materials, constraints in waste streams, or automatic classification of waste streams on the basis of user-specified rules. VISION originally had an economic sub-model. The economic calculations were deemed unnecessary in later versions so it was retired. Eventually, the program will need to restore and improve the economics sub-model of VISION to at least the cash flow stage and possibly to incorporating cost constraints and feedbacks. There are multiple sources of data that dynamic analyses can draw on. In this report, 'data' means experimental data, data from more detailed theoretical or empirical calculations on technology performance, and assumptions such as the earliest date a technology can be deployed. The only fuel cycles for which we currently have adequate data are those we are sure we will never build, e.g., a PUREX plant in the U.S. For actual candidates, even for once through LWRs, there remain missing data such as how the fuel cycle would be completed with a geologic repository. The most immediate data needs are probably basic reactor physics data for new concepts and data associated with waste management for anything other than current technology. The readiness of tools and data is fluid and depends on what purposes are envisioned to drive upcoming analyses and further definition of the waste-related characteristics of fuel cycle candidates. Tools and data sets evolve as needs evolve. Thus, much of the document explains that if the FCT program wants a certain type of analysis, then the tools and data needs are as indicated. For example, functions can be treated as either commodities or facilities. Reactors, separation, fuel fabrication, repository are treated as facility types. Other functions such as uranium mining, conversion, enrichment, and waste packaging and non-repository disposal are treated as commodities and therefore not modeled as extensively. In summary, the tools are functional and can answer many fuel cycle questions but some analyses will require that the tools be modified to support those analyses.

  17. Policy Strategies and Paths to promote Sustainable Energy Systems- The dynamic Invert Simulation Tool

    SciTech Connect (OSTI)

    Stadler, Michael; Kranzl, Lukas; Huber, Claus; Haas, Reinhard; Tsioliaridou, Elena

    2006-05-01

    The European Union has established a number of targetsregarding energy efficiency, Renewable Energy Sources (RES) and CO2reductions as the 'GREEN PAPER on Energy Efficiency', the Directive for'promotion of the use of bio-fuels or other renewable fuels fortransport' or 'Directive of the European Parliament of the Council on thepromotion of cogeneration based on a useful heat demand in the internalenergy market'. A lot of the according RES and RUE measures are notattractive for investors from an economic point of view. Thereforegovernmentsall over the world have to spend public money to promotethese technologies/measures to bring them into market. These expenditureshave to be adjusted to budget concerns and should be spent mostefficiently. Therefore, the spent money has to be dedicated totechnologies and efficiency measures with the best yield in CO2 reductionwithout wasting money. The core question: "How can public money - forpromoting sustainable energy systems - be spent most efficiently toreduce GHG-emissions?" has been well investigated by the European projectInvert. In course of this project a simulation tool has been designed toanswer this core question. This paper describes the modelling with theInvert simulation tool and shows the key features necessary forsimulating the energy system. A definition of 'Promotion SchemeEfficiency' is given which allows estimating the most cost effectivetechnologies and/or efficiency measures to reduce CO2 emissions.Investigations performed with the Invert simulation tool deliver anoptimum portfolio mix of technologies and efficiency measures for eachselected region. Within Invert seven European regions were simulated andfor the Austrian case study the detailed portfolio mix is shown andpolitical conclusions are derived.

  18. 2014 Earth System Grid Federation and Ultrascale Visualization Climate Data Analysis Tools Conference Report

    SciTech Connect (OSTI)

    Williams, Dean N.

    2015-01-27

    The climate and weather data science community met December 9–11, 2014, in Livermore, California, for the fourth annual Earth System Grid Federation (ESGF) and Ultrascale Visualization Climate Data Analysis Tools (UV-CDAT) Face-to-Face (F2F) Conference, hosted by the Department of Energy, National Aeronautics and Space Administration, National Oceanic and Atmospheric Administration, the European Infrastructure for the European Network of Earth System Modelling, and the Australian Department of Education. Both ESGF and UVCDATremain global collaborations committed to developing a new generation of open-source software infrastructure that provides distributed access and analysis to simulated and observed data from the climate and weather communities. The tools and infrastructure created under these international multi-agency collaborations are critical to understanding extreme weather conditions and long-term climate change. In addition, the F2F conference fosters a stronger climate and weather data science community and facilitates a stronger federated software infrastructure. The 2014 F2F conference detailed the progress of ESGF, UV-CDAT, and other community efforts over the year and sets new priorities and requirements for existing and impending national and international community projects, such as the Coupled Model Intercomparison Project Phase Six. Specifically discussed at the conference were project capabilities and enhancements needs for data distribution, analysis, visualization, hardware and network infrastructure, standards, and resources.

  19. Advanced Instrumentation, Information, and Control Systems Technologies Technical Program Plan

    SciTech Connect (OSTI)

    Bruce Hallbert

    2012-09-01

    Reliable instrumentation, information, and control (II&C) systems technologies are essential to ensuring safe and efficient operation of the U.S. light water reactor (LWR) fleet. These technologies affect every aspect of nuclear power plant (NPP) and balance-of-plant operations. In 1997, the National Research Council conducted a study concerning the challenges involved in modernization of digital instrumentation and control systems in NPPs. Their findings identified the need for new II&C technology integration.

  20. Improve Motor System Efficiency with MotorMaster+, Software Tools for Industry, Industrial Technologies Program (ITP) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-12-01

    This fact sheet describes how the Industrial Technologies Program MotorMaster+ software tool aids industrial plants with finding energy-efficient motor replacement options and managing motor systems.