Powered by Deep Web Technologies
Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

InfoCrystal: A visual tool for information retrieval  

E-Print Network [OSTI]

of interest. The InfoCrystal allows users to specify Boolean as well as vector-space queries graphically continuous, multi-variate fields that vary over space and time. Hence, the transformation problem the InfoCrystalTM, that can be used as a visualiza- tion tool as well as a visual query language to help

Spoerri, Anselm

2

Course info Machine Learning  

E-Print Network [OSTI]

Course info Machine Learning Real life problems Lecture 1: Machine Learning Problem Qinfeng (Javen) Shi 28 July 2014 Intro. to Stats. Machine Learning COMP SCI 4401/7401 Qinfeng (Javen) Shi Lecture 1: Machine Learning Problem #12;Course info Machine Learning Real life problems Table of Contents I 1 Course

Shi, Qinfeng "Javen"

3

Kentucky & Tennessee TOBACCOProduc tion Guide  

E-Print Network [OSTI]

2009-2010 Kentucky & Tennessee TOBACCOProduc tion Guide ID-160 F KENTUCKY COLLEGE OF AGRICULTURE. University of Kentucky Authors Kenny Seebold, Editor Department of Plant Pathology Bob Pearce, Co of Biosystems and Agricultural Engineering 2009-2010 Kentucky & Tennessee TOBACCO Produc tion Guide University

Tennessee, University of

4

CONTACT INFO BUILDING SHELTER  

E-Print Network [OSTI]

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.

5

commercializaTion office Agriculture  

E-Print Network [OSTI]

Technology commercializaTion office Agriculture ·Biotechnology ·Blueberries ·Cotton ·Forages Utilization, Renewable Energy ·Algalbiofuels ·Biodiesel ·Biomassengineering ·Biomasspre,skincare,andwoundhealing ·Vaccines Information Technology ·Bioinformaticstools ·Imagerenderingandenhancement ·3

Arnold, Jonathan

6

nanofabricaTion A Resource for Nanoscience  

E-Print Network [OSTI]

The nanofabricaTion cenTer A Resource for Nanoscience and Technology WorKinG WiTh US be appropriate. These projects are directed to more fundamental nanoscience issues, and provide a basis

Blanchette, Robert A.

7

info  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen Owned SmallOf TheViolationsRio Blanco ResponsibleSuite 600, 1901 North8-03R13

8

Info Lit @ Mac Economics 2K03  

E-Print Network [OSTI]

Info Lit @ Mac Economics 2K03 Canadian Economic History Amanda Etches-Johnson Reference Librarian email/MSN: library@mcmaster.ca September 14, 2006 #12;Info Lit @ Mac Economics 2K03 Canadian Economic History Olga Perkovic Reference Librarian email/MSN: library@mcmaster.ca September 21, 2006 #12;Economics

Haykin, Simon

9

Sandia National Laboratories: hydrocarbon combus-tion  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1development Sandia,evaluatingfullhigher-performance spar caphydrocarbon combus-tion

10

Sustainability Double Degree Double Degree Info  

E-Print Network [OSTI]

Sustainability Double Degree Double Degree Info: · 36 credits in B for graduation. Sustainability Core: Take each course below for a total of 17 -20 credits. Term/Grade Course _____ ____ *NR 350 (4) Sustainable

Grünwald, Niklaus J.

11

Columbia University Panhellenic www.columbiagreeks.info  

E-Print Network [OSTI]

Columbia University Panhellenic www.columbiagreeks.info Contact: Samantha Goldfarb President Columbia Panhellenic Council Slgoldfarb2010@gmail.com Elizabeth Carrolo Vice President of Marketing and Public Relations Columbia Panhellenic Council esc2156@columbia.edu January 24, 2013 PANHELLENIC FORMAL

Hone, James

12

Columbia University Panhellenic www.columbiagreeks.info  

E-Print Network [OSTI]

Columbia University Panhellenic www.columbiagreeks.info Contact: Kara B. Mantooth Director AT COLUMBIA UNIVERSITY Brentwood, Tenn.--Alpha Omicron Pi is pleased to formally begin our colonization efforts to join the Greek community at Columbia University. AOII's colonization events conclude a semester

Hone, James

13

Property:StratInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellhead Jump to: navigation,SmallWindWebsiteStratInfo Jump

14

InfoSpi Inc | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy Resources Jump to:46 - 429 Throttled (bot load) Error 429IndianaProfessional JumpInfoSpi Inc Jump to:

15

Macintosh HD:Users:z095994:Desktop:Exits:2013_LAHotel_Info.docx Hotel Info in Los Alamos  

E-Print Network [OSTI]

, NM 87544 505-672-3838 Holiday Inn Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505Macintosh HD:Users:z095994:Desktop:Exits:2013_LAHotel_Info.docx Hotel Info in Los Alamos of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma Linda Dr. Los Alamos, NM 87544 505

16

postdoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos  

E-Print Network [OSTI]

-672-3838 Holiday Inn Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505-661-2646 Motel 6 2175 Trinitypostdoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma Linda Dr. Los Alamos, NM 87544 505

17

SANDIA COKPOK4TION SANDIA BASE, .QLDUQUERQUE. N. M.  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*.MSE&.17- I1/066/04SANDIA COKPOK4TION

18

Returns or Repairs of Products Ordered via PO# or Pro Card (including Standing Orders): You are welcome to call vendors on your own and make arrangements and get RMA # when  

E-Print Network [OSTI]

): You are welcome to call vendors on your own and make arrangements and get RMA # when applicable, if charges are incurred, please be sure to find out how vendor prefers to do business pertaining to a return to communicate them to Cindy via email so she is in the know. Either you or she can contact the vendor initially

Movileanu, Liviu

19

PsycINFO user guide citations summaries abstracts  

E-Print Network [OSTI]

the period you wish to search. #12;2 PsycINFO user guide September 2002 Enter your search term or terms) will search all of the records for your search term. If you want to limit your search to an author or a title search, select from the drop down button alongside "Find Terms" (marked below). Find Terms: Anyw here

Martin, Stephen John

20

www.d-waste.com info@d-waste.com  

E-Print Network [OSTI]

, the International Solid Waste Association, GIZ/SWEEP-Net, the Waste to Energy Research Council (WTERT) and the Solidwww.d-waste.com info@d-waste.com Acharnon 141 10446 ATHENS GREECE T: +30 2155302449 F: +30 2155302447 For Release November 13, 2013 Waste Atlas shows how the world handles its refuse D-Waste

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

http://energyefficientmechanism.blogspot.com/ http://mechanicalresearch.info/  

E-Print Network [OSTI]

by Energyefficient Mechanism at 11:05 PM Wednesday, February 4, 2009 Stationary hydraulic force can help to rotate by Energyefficient Mechanism at 7:41 AM Friday, October 10, 2008 Energy Security, Global Warming and Engineering://mechanicalresearch.info/report.pdf Posted by Energyefficient Mechanism at 4:00 AM Thursday, July 17, 2008 Stationary Force Can Be Utilized

Kostic, Milivoje M.

22

Chemistry in Higher What's available and where is the info?  

E-Print Network [OSTI]

Chemistry in Higher Education What's available and where is the info? What does studying chemistry? Where does it lead and what might a chemistry career look like? Dr. David Read, Director of Outreach 2013 #12;310 (294) HE courses with chemistry offered as a single subject hosted at 53 universities 699

Anderson, Jim

23

Donnerstag, 24. Juli 2003 Biomasse Info-Zentrum  

E-Print Network [OSTI]

Centre Biogas - fuel cell Dust engine/-turbine ORC--process Hot Gasturbine Gasification - engine-engine Steamprocess Bioethanol - engine Methanol - engine* Methanol - fuel cell* Co- Combustion Biogas Methan - fuel 8 Biomasse Info-Zentrum Biomass Information Centre Internal Combustion Engine, Biogas #12;Donnerstag

24

Info-F-205 : Solutions TP1 Introduction  

E-Print Network [OSTI]

Info-F-205 : Solutions TP1 Introduction Matlab : Matrix Laboratory Interpréteur avec une structure Possibilités graphiques commande plot(x,y) 2 séries de valeurs de même taille 1 graphe. Exemple : x = -pi:0 après dans un même graphe. On peut voir le résultat dans la Figure 1. 2 #12;Structures de contrôle pour

Bontempi, Gianluca

25

STBPO-PostDoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos  

E-Print Network [OSTI]

Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505-661-2646 Motel 6 2175 Trinity Dr. LosSTBPO-PostDoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma Linda Dr. Los Alamos, NM 87544 505

26

Secondary Energy InfoBook | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of InspectorConcentrating Solar PowerstoriesNrelPartnerTypePonsa, Mallorca: EnergySecondary Energy InfoBook Jump

27

Alan Turing's Legacy: Info-Computational Philosophy of Nature  

E-Print Network [OSTI]

Alan Turing's pioneering work on computability, and his ideas on morphological computing support Andrew Hodges' view of Turing as a natural philosopher. Turing's natural philosophy differs importantly from Galileo's view that the book of nature is written in the language of mathematics (The Assayer, 1623). Computing is more than a language of nature as computation produces real time physical behaviors. This article presents the framework of Natural Info-computationalism as a contemporary natural philosophy that builds on the legacy of Turing's computationalism. Info-computationalism is a synthesis of Informational Structural Realism (the view that nature is a web of informational structures) and Natural Computationalism (the view that nature physically computes its own time development). It presents a framework for the development of a unified approach to nature, with common interpretation of inanimate nature as well as living organisms and their social networks. Computing is understood as information processing that drives all the changes on different levels of organization of information and can be modeled as morphological computing on data sets pertinent to informational structures. The use of infocomputational conceptualizations, models and tools makes possible for the first time in history the study of complex selforganizing adaptive systems, including basic characteristics and functions of living systems, intelligence, and cognition.

Gordana Dodig-Crnkovic

2012-07-03T23:59:59.000Z

28

MSW Registration Info/ 1 10/11/13 TO: MSW Students  

E-Print Network [OSTI]

MSW Registration Info/ 1 10/11/13 MEMO TO: MSW Students FROM: Sandy Butler, MSW Coordinator DATE Licensure for students in the Full "Regular" MSW and Advanced Standing programs.Please note the distinction the last five years and are thus completing the MSW program with fewer credits #12;MSW Registration Info/ 2

Thomas, Andrew

29

LinShim6 -Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6  

E-Print Network [OSTI]

LinShim6 - Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6 Documentation at http://inl.info.ucl. ac.be/publications/shim6-masterthesis. Like the whole project, this documentation

Bonaventure, Olivier

30

EFRIGERATION OF FISH -PART 4 PRE PARA TION, FRE EZI NG,  

E-Print Network [OSTI]

EFRIGERATION OF FISH - PART 4 PRE PARA TION, FRE EZI NG, AND COLD STORAGE OF FISH, SHELLFISH Washington 25, D. C. 1956 REFRI GERATION OF FISH: PART FOUR PREPARATION, FREEZING, AND COLD STORAGE OF FISH

31

MAGENCO: A map generalization controller for Arc/Info  

SciTech Connect (OSTI)

The Arc/Info GENERALIZE command implements the Douglas-Peucker algorithm, a well-regarded approach that preserves line ``character`` while reducing the number of points according to a tolerance parameter supplied by the user. The authors have developed an Arc Macro Language (AML) interface called MAGENCO that allows the user to browse workspaces, select a coverage, extract a sample from this coverage, then apply various tolerances to the sample. The results are shown in multiple display windows that are arranged around the original sample for quick visual comparison. The user may then return to the whole coverage and apply the chosen tolerance. They analyze the ergonomics of line simplification, explain the design (which includes an animated demonstration of the Douglas-Peucker algorithm), and discuss key points of the MAGENCO implementation.

Ganter, J.H.; Cashwell, J.W.

1994-06-01T23:59:59.000Z

32

Efficient Computation of Info-Gap Robustness for Finite Element Models  

SciTech Connect (OSTI)

A recent research effort at LANL proposed info-gap decision theory as a framework by which to measure the predictive maturity of numerical models. Info-gap theory explores the trade-offs between accuracy, that is, the extent to which predictions reproduce the physical measurements, and robustness, that is, the extent to which predictions are insensitive to modeling assumptions. Both accuracy and robustness are necessary to demonstrate predictive maturity. However, conducting an info-gap analysis can present a formidable challenge, from the standpoint of the required computational resources. This is because a robustness function requires the resolution of multiple optimization problems. This report offers an alternative, adjoint methodology to assess the info-gap robustness of Ax = b-like numerical models solved for a solution x. Two situations that can arise in structural analysis and design are briefly described and contextualized within the info-gap decision theory framework. The treatments of the info-gap problems, using the adjoint methodology are outlined in detail, and the latter problem is solved for four separate finite element models. As compared to statistical sampling, the proposed methodology offers highly accurate approximations of info-gap robustness functions for the finite element models considered in the report, at a small fraction of the computational cost. It is noted that this report considers only linear systems; a natural follow-on study would extend the methodologies described herein to include nonlinear systems.

Stull, Christopher J. [Los Alamos National Laboratory; Hemez, Francois M. [Los Alamos National Laboratory; Williams, Brian J. [Los Alamos National Laboratory

2012-07-05T23:59:59.000Z

33

Lactation Room Locations Building Location Room Details Contact Name Contact Info Instructions  

E-Print Network [OSTI]

, hot water heater, educational info Natalie Blais narnold@pitt.edu Contact Natalie to receive and request a key to this locked room. Public Health A712 Crabtree Hall table, chairs, storage cabinet, fridge

Jiang, Huiqiang

34

maintenance. This research is relevant to opera-tions and maintenance challenges facing aging  

E-Print Network [OSTI]

the need for preventive maintenance or other diagnostic activities on the physical system. Simulationsmaintenance. This research is relevant to opera- tions and maintenance challenges facing aging-benefit of extending the time between overhauls. reducing the probability of a failure in the field. and preventive

35

Tag der InnovaTIon Fokus WerksToFFWIssenschaFTen  

E-Print Network [OSTI]

Tag der InnovaTIon Fokus WerksToFFWIssenschaFTen auFTakTveransTalTung zur MITarbe erfolg. ein beitrag dazu soll der,,Tag der Innovation ­ Fokus Werkstoffwissenschaften" sein, der am 26 des zentralinstitutes für neue Materialien und Prozesstechnik und des Fraunhofer-Institutes ezr

Fiebig, Peter

36

China For all ages a MulTi-generaTional exPloraTion  

E-Print Network [OSTI]

China For all ages a MulTi-generaTional exPloraTion The greaT Wall, TerraCoTTa Warriors & The MighCTuresque China Experience the Delights of a Well-Crafted Family Tour Dear Princetonian, Join Princeton Journeys, June 27 ­ July 9, 2013, for a comprehensive tour of China designed with families in mind. Explore

Rowley, Clarence W.

37

SEASONAL V A R IA TIONS IN STRUCTURE AND CIRCULATION IN THE RED SEA  

E-Print Network [OSTI]

SEASONAL V A R IA TIONS IN STRUCTURE AND CIRCULATION IN THE RED SEA A DISSERTATION SUBMITTE D and surface circulation in the Red Sea, occur r ing along the north-south axis of the Sea and extending fr om on in the northern Red Sea is frorn the nor th-northwest throughout the year' during the winter ( fr om October

Luther, Douglas S.

38

Harvesting, Curing, Stripping, and Marketing 8 2008 Burley ToBacco ProducTion Guide  

E-Print Network [OSTI]

Harvesting, Curing, Stripping, and Marketing 8 2008 Burley ToBacco ProducTion Guide HARVESTING, CURING, STRIPPING, AND MARkETING Danny R. Peek, Extension Specialist, Burley Tobacco Harvesting Growers should only harvest mature, ripe tobacco. Burley tobac- co usually matures and is ready for harvest three

Liskiewicz, Maciej

39

Cooperative Spectrum Sensing and Localiza-tion in Cognitive Radio Systems using Com-  

E-Print Network [OSTI]

Cooperative Spectrum Sensing and Localiza- tion in Cognitive Radio Systems using Com- pressed features in cog- nitive radio systems (CRS): spectrum sensing and location awareness in a single compressed implementing a cognitive radio system. The major problem for spectrum sensing arises in wideband radio, when

Gesbert, David

40

A Dialogue Concerning Two World Systems: Info-Computational vs. Mechanistic  

E-Print Network [OSTI]

The dialogue develops arguments for and against adopting a new world system, info-computationalist naturalism, that is poised to replace the traditional mechanistic world system. We try to figure out what the info-computational paradigm would mean, in particular its pancomputationalism. We make some steps towards developing the notion of computing that is necessary here, especially in relation to traditional notions. We investigate whether pancomputationalism can possibly provide the basic causal structure to the world, whether the overall research programme appears productive and whether it can revigorate computationalism in the philosophy of mind.

Gordana Dodig-Crnkovic; Vincent C. Mueller

2009-10-26T23:59:59.000Z

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

INFO-F-309 Administration des Systmes TP1: Installation de Linux et gestion des packages  

E-Print Network [OSTI]

INFO-F-309 Administration des Systmes TP1: Installation de Linux et gestion des packagesBox. Ensuite nous verrons comment fonctionne la gestion de packages, la mise jour du systme et l la gestion de packages. 2 Installation de Linux 2.1 Prparation Surtout lorsqu'il s'agit d'un serveur

Collette. Sbastien

42

Company City State Contact Info Acacia Research Corporation Newport Beach CA www.acaciaresearch.com  

E-Print Network [OSTI]

Company City State Contact Info Acacia Research Corporation Newport Beach CA www. Fountain City CA www.kingston.com Microchip Technology Incorporated Chandler AZ www Milpitas CA www.sandisk.com Silicon Storage Technology, Inc. Sunnyvale CA www.sst.com SMART Modular

McGaughey, Alan

43

Biodiversity, Entropy and Thermodynamics http://math.ucr.edu/home/baez/bio info/  

E-Print Network [OSTI]

Biodiversity, Entropy and Thermodynamics John Baez http://math.ucr.edu/home/baez/bio info/ October(pi ) is fundamental to thermodynamics and information theory. But it's also used to measure biodiversity, where pi. In biodiversity studies, the entropy of an ecosystem is the expected amount of information we gain about

Baez, John

44

SJSU Information Support Services Run a Query info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

....................................................................................................................................................................3 Advanced Search Run a Query info-support@sjsu.edu, 408-924-1530 Page 4 Advanced Search 4. To do an advanced search, click the Advanced Search link. The Advanced Search parameters display. Notes: The other most commonly

Su, Xiao

45

he Web, as we know it, is a collec-tion of human-readable pages that  

E-Print Network [OSTI]

of languages such as the Resource Description Framework (RDF), DAML+OIL, and the more recent Web OntologyT he Web, as we know it, is a collec- tion of human-readable pages that are virtually Web and proposed industry standards for Web services. The SemanticWeb forWeb Services One objective

Yu, Bin

46

Summary We examined the effects of increased transpira-tion demand on xylem hydraulic conductivity and vulnerabil-  

E-Print Network [OSTI]

in response to high evaporative demand and prevent xylem tensions from reaching values that cause catastrophicSummary We examined the effects of increased transpira- tion demand on xylem hydraulic conductivity potential and water potential differences between the soil and the shoot were similar for desert and montane

Maherali, Hafiz

47

The newesT addiTion To The UniversiTy of MinnesoTa's BioMedical  

E-Print Network [OSTI]

The newesT addiTion To The UniversiTy of MinnesoTa's BioMedical discovery disTricT is designed The BUilding's collegial and physical relaTionship To neighBoring faciliTies in The U's BioMedical discovery in the U's Biomedical Discovery District. "The brick, precast concrete, and curtain wall vocabulary

Weiblen, George D

48

Contact Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt

49

PHYS 113 General Physics I Fall 2012 KSU -4 credits Section: Room Instructor: Contact Info.  

E-Print Network [OSTI]

introductory physics course dealing with the topics of mo- tion, mechanics, matter and energy. Emphasis #12;Laboratory The laboratory is a required and integrated part of the course, and counts 20% towards your grade. A passing grade (60%) in the laboratory is required to pass the course. See the lab manual

Wysin, Gary

50

Hotel Info in Los Alamos There are many wonderful places to stay in Santa Fe as well as the surrounding  

E-Print Network [OSTI]

Alamos, NM 87544 505-672-3838 Holiday Inn Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505Hotel Info in Los Alamos There are many wonderful places to stay in Santa Fe as well as the surrounding areas but the following is a list of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma

51

Company City State Contact Info 21st Century Plastics Corporation Potterville MI www.21stcpc.com  

E-Print Network [OSTI]

Company City State Contact Info 21st Century Plastics Corporation Potterville MI www.21stcpc.com A. Schulman, Inc. Akron OH www.aschulman.com A.M.A. Plastics Riverside CA www.accordindustries.com Airlite Plastics Co. Omaha NE www.airliteplastics.com Alco Plastics, Inc. Romeo MI www

McGaughey, Alan

52

SJSU Information Support Services Send Messages by Instructor info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

, and Expiration Date for the message. 10. Enter the Term number for the class. To select from a list of terms, use-924-1530 Page 2 The Sign In page displays. 3. Enter your SJSU ID and Password. 4. Click the Sign In button. 5 by Instructor info-support@sjsu.edu, 408-924-1530 Page 3 The SJSU Messaging Search page displays. 6. Click

Su, Xiao

53

Campus Sustainability Planetary Health Ecological Design Social and Environmental Enterprise Incuba-tion EcoVillages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model Energy  

E-Print Network [OSTI]

Villages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model Energy Conservation, Efficiency1 Campus Sustainability Planetary Health Ecological Design Social and Environmental Enterprise Incuba- tion EcoVillages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model

Hayden, Nancy J.

54

CUSSSFIC4TION CMUXLLq  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou areDowntown Site -MiamiYVE r.x-L* d! CT NC0 - i

55

The SpallaTion  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up from theDepartment of Energy TechnicalFlowNationTheDepartmentDepartmentGrid:

56

8/8/12 Environmental Health Perspectives: Accounting for Nature's Benefits: The Dollar Value of Ecosystem ... 1/12ehp03.niehs.nih.gov/article/info%3Adoi%2F10.1289%2Fehp.120-a152  

E-Print Network [OSTI]

of Ecosystem ... 1/12ehp03.niehs.nih.gov/article/info%3Adoi%2F10.1289%2Fehp.120-a152 Accounting for Nature Value of Ecosystem ... 2/12ehp03.niehs.nih.gov/article/info%3Adoi%2F10.1289%2Fehp.120-a152 Healthy: The Dollar Value of Ecosystem ... 3/12ehp03.niehs.nih.gov/article/info%3Adoi%2F10.1289%2Fehp.120-a152

57

Towards an InTerdIscIplInary approach To nexT-GeneraTIon BIofuels EnvironmEntal, tEchno-Economic, and GovErnancE  

E-Print Network [OSTI]

Towards an InTerdIscIplInary approach To nexT-GeneraTIon BIofuels EnvironmEntal, t. 2010. The Ecological Impact of Biofuels. Pages 351-377 in D. J. Futuyma, H. B. Shafer, and D. Huffer, S., Roche, C.M., Blanch, H.W., and Clark, D.S. (2012). Escherichia coli for biofuel production

Iglesia, Enrique

58

This paper proposes a method for classification and discrimina-tion of textures based on the energies of image subbands. We  

E-Print Network [OSTI]

, the dimension of the discriminant space and number of energy mea- sures used for classification. We hopeAbstract This paper proposes a method for classification and discrimina- tion of textures based on the energies of image subbands. We show that even with this relatively simple feature set, effective texture

Chang, Shih-Fu

59

Title Efficient and Reliable Balanced Codes Contact Info Dr. ir. J.H. Weber, j.h.weber@tudelft.nl, tel. 015-2781698, office HB11.300  

E-Print Network [OSTI]

Title Efficient and Reliable Balanced Codes Contact Info Dr. ir. J.H. Weber, j.h.weber. Inf. Theory, vol. 32, no. 1, pp. 51-53, Jan. 1986. [2] J.H. Weber, K.A. Schouhamer Immink, and H. 2012. More Info Upon appointment with dr. Weber #12;

60

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com  

E-Print Network [OSTI]

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com APPLICATION

Lebendiker, Mario

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Proc. SPIE 8396, Geospatial InfoFusion II, 83960N (May 1, 2012); doi:10.1117/12.920878 Modeling spatial uncertainties in geospatial data fusion and mining  

E-Print Network [OSTI]

., Seattle, WA, 98178 ABSTRACT Geospatial data analysis relies on Spatial Data Fusion and Mining (SDFMProc. SPIE 8396, Geospatial InfoFusion II, 83960N (May 1, 2012); doi:10.1117/12.920878 Modeling spatial uncertainties in geospatial data fusion and mining Boris Kovalerchuka* , Leonid Perlovskyb

Kovalerchuk, Boris

62

Title Distributed Multi-Microphone Speech Enhancement Contact Info Dr. ir. R.C. Hendriks (r.c.hendriks@tudelft.nl)  

E-Print Network [OSTI]

Title Distributed Multi-Microphone Speech Enhancement Contact Info Dr. ir. R.C. Hendriks (r and interferences is to use multi- microphone speech enhancement methods like beamforming or multi-microphone Wiener of new multi-microphone speech enhancement algorithms that can run in such a distributed setup. The goal

63

H:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin Milwaukee  

E-Print Network [OSTI]

June 2013 June 2014 June 2015 June 2016 H:\\INST\\AUXBGT\\FY13UWM\\Internal Aux Financing\\Fund 128 ProjH:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin ­ Milwaukee 201213 Auxiliary Budget Kickoff Meeting October 12, 2011 10:00 ­ 11:30 Regents

Saldin, Dilano

64

Country Name Address Town State Postcode Telephone Email ARGENTINA CW International Education Piso 6 A, Ciudad Buenos Aires 1425 54 11 48010867 info@cwinternationaleducation.com  

E-Print Network [OSTI]

Country Name Address Town State Postcode Telephone Email ARGENTINA CW International Education Piso 6 A, Ciudad Buenos Aires 1425 54 11 48010867 info@cwinternationaleducation.com ARGENTINA Latino Australia Education - Buenos Aires Riobamba 972 4C Buenos Aires 11 37931600 argentina

Chen, Ying

65

Northwest Straits Commission, 10441 Bayview Edison Rd., Mt. Vernon WA 98273 phone: 360.428-1064 e-mail: info@nwstraits.org web: www.nwstraits.org  

E-Print Network [OSTI]

Ocean acidification is a change in seawater chemistry due to the absorption of carbon dioxide. It is a local and global problem; a consequence of man-made carbon emissions. In Puget Sound, shellfish-mail: info@nwstraits.org web: www.nwstraits.org Ocean Acidification: Local action in the Northwest Straits

66

Voici donc le dernier numro de Gosciences-Infos avant l't. Un t sans rapport AERES rdiger... Mais avec quelques devoirs de vacances tout de mme, de faon tre tout--fait  

E-Print Network [OSTI]

édito Voici donc le dernier numéro de Géosciences-Infos avant l'été. Un été sans rapport AERES à

Demouchy, Sylvie

67

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7/23/2007 2:06 PM  

E-Print Network [OSTI]

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7 the PMU on a Mac mini and it still isn't displaying video or turning on, contact Apple technical support (1-800-APL-CARE in the U.S.) or take your computer to your local Apple Retail Store or Apple

California at Santa Barbara, University of

68

MHK Technologies/CoRMaT | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revision hasInformation Earth's Heat JumpIncMAKGalway Bay IE <AirWEC < MHK< MHK

69

CLASSIFICdTION CAWXL~ DAm  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou areDowntown Site -MiamiYVE r. awC'COLUMBIA$f

70

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe C en LI2)  

E-Print Network [OSTI]

M= parcours maths MI= parcours math-info ( groupe C en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M M MI MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI Anglais MI mercredi MA TD Variable Complexe M 3.2 MA M M MI MI jeudi MA MA M M MI MI

Berger, Clemens

71

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe A en LI2)  

E-Print Network [OSTI]

M= parcours maths MI= parcours math-info ( groupe A en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M Anglais* M MI TP Programmation C PV202 MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI TP Projet Scientifique PV214 MI mercredi MA TD Variable

Parusinski, Adam

72

MA 366 Info  

E-Print Network [OSTI]

I thought that it was more useful to spend additional time on series solutions. Hence, you should ignore problems (11)-(15) on last fall's final and problems...

73

Exam #3 Info Sheet  

E-Print Network [OSTI]

The volume/surface area formulas for a cone, cylinder, and/or sphere will also be ... Lesson 24: (page 206) 51, 84. Lesson 25: (page 206) 39, 40, 50, 57, 59, 60,...

Devlin, Patrick M

2014-11-14T23:59:59.000Z

74

Newspaper Info Sunday Tribune  

E-Print Network [OSTI]

CharityCars.org General Jobs Motors Property Motors (7401) Property (4393) Jobs (4088) Place an Ad Online science and engineering at the University of Illinois. He said the devices are meant to showcase a new way chips. The researchers teamed up with radio frequency electronics engineers at Northrop Grumman Corp

Rogers, John A.

75

Past Restoration Fund Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 - September 2006 TheSteven AshbyDepartment of Energynalcal.GIFHallAskRates >

76

XRAYOPS Info Page  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL Home SRNL main campusMoreXRAYOPS -- APS Experiment

77

Invoicing, Payments Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area.PortaldefaultIntroducing AuroraInvestor

78

FMAPropInfoStat  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series toESnet4:Epitaxial ThinFOR IMMEDIATE RELEASE JimFAQsFESTopg

79

07/14/2005 03:15 PMEBSCOhost Page 1 of 9https://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2  

E-Print Network [OSTI]

.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2 11 page://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN

Spirtes, Peter

80

INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG  

E-Print Network [OSTI]

INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG OSTEOPOROSIS woman' released for World Osteoporosis Day shows urgent action must be taken to safeguard the quality

Shihadeh, Alan

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Gschwind Benot, Lionel Mnard, Thierry Ranchin, Lucien Wald, Paul Stackhouse, 2007. A proposal for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski and M. Romaniuk (Eds), Shaker Verlag,  

E-Print Network [OSTI]

for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski in Solar Radiation Benoît Gschwind1 , Lionel Ménard1 , Thierry Ranchin1 , Lucien Wald1 and Paul Stackhouse2 energies. This communication focuses on solar energy and more specifically on aspects in solar radiation

Boyer, Edmond

82

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info@ssci.com  

E-Print Network [OSTI]

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel. Founded in 1976 and headquartered in the metro-Boston area, SSCI has built a reputation for delivering Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info

Plotkin, Joshua B.

83

Bogs are a specialized wetland community with saturated, acidic, peat soils that have low concentra-tions of minerals (e.g., calcium, magnesium) and essential nutrients (phosphorus, nitrogen). They  

E-Print Network [OSTI]

, acidic, peat soils that have low concentra- tions of minerals (e.g., calcium, magnesium) and essential of living Sphagnum mosses growing over a layer of saturated, acidic peat. Sedges, forbs and/or the low), pitcher plant (Sarracenia purpurea) and sundew (Drosera rotundifolia). SOILS: Fibric peat (Histosols

US Army Corps of Engineers

84

quera que le coefficient )'2 de la formule (2) n'a pas la mme significa-tion que ~ de la formule (1). ~,z n'existe que s'il y a chute de tempra-  

E-Print Network [OSTI]

~~~ia- tion. Ces observations prouvent que l'effet Peltier au contact Bi-Cu n'est pas modifi par le champ and available at http://dx.doi.org/10.1051/jphystap:0190100100069101 #12;692 que celles de la rflexion totale

Paris-Sud XI, Universit de

85

9/18/09 2:44 PMThunderbolts Forum View topic -Dark Energy may not actually exist Page 1 of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d  

E-Print Network [OSTI]

http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553 Forum · View topic - Dark Energy may not actually exist Page 3 of 12http://www.thunderbolts.info/forum/php

Temple, Blake

86

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM  

E-Print Network [OSTI]

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM Visit the Apple Store online (1-800-MY-APPLE), visit a retail location on an iMac (Early 2006), iMac (Mid 2006), iMac (Late 2006), or Mac mini (Early 2006): From the Apple menu

California at Santa Barbara, University of

87

LD Didactic GmbH . Leyboldstrasse 1 . D-50354 Huerth / Germany . Phone: (02233) 604-0 . Fax: (02233) 604-222 . e-mail: info@ld-didactic.de Kinetic theory of gases  

E-Print Network [OSTI]

LD LD Didactic GmbH . Leyboldstrasse 1 . D-50354 Huerth / Germany . Phone: (02233) 604-0 . Fax: (02233) 604-222 . e-mail: info@ld-didactic.de P2.5.3.1 Physics Leaflets Heat Kinetic theory of gases of degrees of freedom of the gas molecules: Rf 2 1 CV = (VI) ©by LD Didactic GmbH Printed in the Federal

Allen, Roland E.

88

UTICA 4, NEW YORK COFIPOR~TION  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545 OCTTO: FILEWAWINQTON, 0. C.JournalDROf

89

ch1_General_Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

technology for the reuse of Carbon dioxide (CO 2 ) emissions from industrial sources for green energy products. This project would use CO 2 to grow algae for the production of...

90

Microsoft Word - info.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment SurfacesResource Program Preliminary Needs535:UFC5,OverviewMultilayeredof

91

Microsoft Word - info.html  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment SurfacesResource Program Preliminary Needs535:UFC5,OverviewMultilayeredofOctober 2,

92

Microsoft Word - info.html  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment SurfacesResource Program Preliminary Needs535:UFC5,OverviewMultilayeredofOctober

93

Microsoft Word - info.html  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment SurfacesResource Program Preliminary

94

info disclosure-rocky mts  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South Valley Responsible DOE Office: Office of Environmental

95

MINERvA Engineering Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund Las ConchasTrail of aMEEM Energy

96

ch1_General_Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture and Storage CleanDiscovery of θ 13 at Daya Bay using5 5R

97

Aps_notify Info Page  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to someone by E-mailRadioimmunotherapy EA15PC3041-3-0

98

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted Samson 17/04/2008 08:44:53 PMhttp://weblog.infoworld.com/archives/emailPrint.jsp?R=printThis&A=http://weblog.in...  

E-Print Network [OSTI]

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted SamsonPrint.jsp?R=printThis&A=http://weblog.in... Back to article Print this Where will Microsoft's green path lead? For months now, many of the hardware lengths to highlight their green products, plans, and corporate visions. Now the software behemoth

Loke, Seng W. - Loke, Seng W.

99

HealtHyCows-RMaMeeting tHuRsday,FebRuaRy14,2013  

E-Print Network [OSTI]

Service Agency, USDA Risk Management Agency, NOFA New Hampshire and private crop insurance agencies. Thank Services, New England Area Office. Some of the programs and services provided include: health certificate and parts of MA. The University of New Hampshire Cooperative Extension is an equal opportunity educator

New Hampshire, University of

100

Casper: An Asynchronous Progress Model for MPI RMA on Many-Core  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to someone6Energy,MUSEUM DISPLAYCareers TheEmail

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

MHK Projects/Contra Rotating Marine Turbine CoRMaT | Open Energy  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revision hasInformation Earth's Heat JumpIncMAK Technologies Jump to:BW2 Tidal <CETOCohansey River

102

Joshua Gomez INFO 247 Information Visualization  

E-Print Network [OSTI]

are required to build a network of cellular towers and backhaul wire line networks. But the greatest barrier only allowed voice transmission. Later spectrum allocations, such as PCS (Personal Communication a greater number of towers to service a given area, putting the operators using these frequencies

Hearst, Marti

103

TwitInfo: Aggregating and Visualizing Microblogs  

E-Print Network [OSTI]

traveled to the ASEAN conference and to NATO to work on issues in those parts of the world. He then spent

Pratt, Vaughan

104

Constructing a Cleaner Economy Info Graphic  

Broader source: Energy.gov [DOE]

An overview of the impact that the clean energy economy is having on the U.S. construction industry.

105

MEPC 2014 Info Session Peter A. Beerel  

E-Print Network [OSTI]

performance #12;MEPC 2010 Winner Abtum, Inc · Completed 2nd generation a 2x2 MIMO reconfigurable radio development on diesel engines. · General Atomic expressed interest in development work with TPS for the Predator drone and others. · Awarded Phase I SBIR on August 27, 2013 Sells pulsed-power systems

Zhou, Chongwu

106

OSU Contact Info Stores Service Center  

E-Print Network [OSTI]

, and guestroom renovations in 2008 24 hour in-room dining Complimentary Business Center Complimentary WIFI in all public areas of the hotel Westin Workout Center and Westin Workout guestrooms Heavenly Beds in all guestrooms Laptop safes and refreshment centers in all guestrooms Starwood Preferred Guest

Jones, Michelle

107

Jurisdiction Members Contact Info Key Staffers  

E-Print Network [OSTI]

Legislative authorizing / oversight for: · Air pollution, including the Clean Air Act · Environmental research and development · Environmental regulation · Transportation policy · Water resources Majority: · Barbara Boxer (D (R-NE) · John Boozman (R-AR) Majority (Democrats): · Dirksen Senate Office Building, SD-410

108

Info-Greedy Sequential Adaptive Compressed Sensing  

E-Print Network [OSTI]

] (Ct)/H(F) and P[M = O(H(F))] = 1 - o(1). #12;k-sparse signal: windfarm example n wind turbines more general signal and noise model new algorithms: sparse measurement #12;Information theoretical in Algorithm 5. The following theorem shes the error bound. em V.1 (White Gaussian noise added prior

Xie, Yao

109

Magellan Info Session Professor Shahrokh Valaee  

E-Print Network [OSTI]

­ Provides student counselling support 3September 24, 2014 #12;Who Are We? Linda Espeut (Manager Mechanics Area 2 Electromagnetics and Energy Systems ECE314 ­ Fund. Of Electrical Energy Systems ECE320 Electronics: Switch-Mode Power Supplies BME595 ­ Medical Imaging ECE413 ­ Energy Systems & Distributed

Prodiæ, Aleksandar

110

Assessments InfoCenter | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orA BRIEFApril 2015 Project DashboardArleneAssessments

111

Enforcement InfoCenter | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelinesProvedDecember 2005DepartmentDecember 2011District |DepartmentEnergy.gov

112

Microsoft Word - Badging and Facility Info  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EMAZ AUTOMOTIVE Submitted by:Microsoftof

113

<RatesMiscInfo>  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered‰PNGExperience hands-onASTROPHYSICSHe β- DecayBe GeneralHeatingMontana -

114

Microsoft InfoPath - nepa_19496.xml  

Broader source: Energy.gov (indexed) [DOE]

67 Title: Replace Brine Disposal System Header to WH Brine Tanks Description: Subcontractor shall shall provide all labor, materials, tools, equipment, and supervision required to...

115

Microsoft Word - Shipping Info_2015.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment SurfacesResource Program Preliminary Needs Assessment March 20090InTHShipping

116

Property:HydroInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration Jump to:FieldProceduresFY JumpThis is a property of

117

Property:LithologyInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County,ContAddr2 Jump to: navigation,PVYearsDisplay/GraphicsLength (m)

118

Property:ThermalInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: EnergyPotentialUrbanUtilityScalePVCapacity Jump to: navigation,WebsiteRenewableBiofuelTechnology Property

119

Template:ContactInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia:FAQ < RAPID Jump to:Seadov Pty LtdSteen,Ltd Jump to:Taos County,TeesAtlasTabs Jump to:CommunityWind Jump

120

InfoPower | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revision hasInformation Earth's Heat JumpInc Place: Eden Prairie,Infield Capital Jump to:

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Microsoft Word - Shipping Info_2014.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

your shipment by the Career Fair: LANL Attn: Jeanette GallegosMary Anne With Bikini Atoll Road, SM-30 MS M714 TA-00, Bldg. 199 Los Alamos, NM 87545-0001 Questions:...

122

Changes in the cytosolic concentra-tions of Ca2+  

E-Print Network [OSTI]

-malignant cells. Knockdown of SPCA2 in MCF-7 cells (a human breast adenocarcinoma cell line) led to inhibition+ levels in SPCA2-knockdown MCF-7 cells were reduced com- pared with control MCF-7 cells that SPCA2 localizes to the plasma membrane in MCF-7 cells, suggesting that it might interact with plasma

Kenny, Paraic

123

Post-translational histone modifica-tions influence gene regulation,  

E-Print Network [OSTI]

methylation at Oct4. This system, which is called chromatin in vivo assay (CiA), enables inductionK9me3 domains in the mouse genome. The authors propose that their novel CiA system is adaptable

Richardson, David

124

48 Extracurricular Activities Sec-tion, Student Division2  

E-Print Network [OSTI]

musical instrument] [acoustic music] Egoist Dancers [dance] KUES [music] [chorus] [matsuri dance] [city pollution study] R [environment network] [environment] [machine study] E.S.S. [English Speaking

Takada, Shoji

125

he Bush administra-tion has listed myriad  

E-Print Network [OSTI]

SURVEILLANCE: By dissembling random nuclear weapons in the stockpile and closely inspecting and testing explosives and nuclear materials at the Nevada Test Site to gather diagnostic information about weapons Nuclear Security Ad- ministration (NNSA), a division of the Energy Department, to scrutinize the nuclear

Rhoads, James

126

Sandia National Laboratories: pretreatment for biomass deconstruc-tion of  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1developmentturbine bladelifetimepower-to-gas applications

127

Mediated urban civic space : info deck of the Hong Kong SAR Government Info-tainment Headquarters  

E-Print Network [OSTI]

After being a British colony for more than hundred years, Hong Kong's final handover back to China took place 1st July 1997. There are tremendous demands on the new government to reflect her status during this critical ...

Louie, Tak-Wing, 1973-

2001-01-01T23:59:59.000Z

128

info401 : Programmation fonctionnelle Contr^ole des connaissances 2  

E-Print Network [OSTI]

de commentez votre code. Un point est r´eserv´e pour la pr´esentation. Partie 1 : questions de cours (25 min) (2) Question 1. Suite `a ce morceau de code Caml, quelles sont les valeurs de x1, x2, x3 et x derni`ere expression, c'est parce que la fonction toute seule est de type int -> int -> float*int et qu

Hyvernat, Pierre

129

INFO-FINANCES dition : Juin 2011 BULLETIN 25  

E-Print Network [OSTI]

://www.sf.ulaval.ca/ AApppprroovviissiioonnnneemmeenntt Contrat d'approvisionnement des gaz comprimés (gaz en cylindre) Le contrat actuel avec Praxair'exécutera une prise d'inventaire des cylindres sur le campus. La prise d'inventaire sera coordonnée par Praxair

Laval, Université

130

Important Broomball Dates Wednesday, August 25 -Orientation Info Session  

E-Print Network [OSTI]

, with around 2,000 students participating. Today, Broomball is played on three outdoor ice rinks in front - Booth w/ IRHC @ K-Day Friday, September 24 - Rink Staff & Referee applications available* Friday Huskies Hockey) Friday, October 15 - Rink Staff & Referee applications due* Sunday, October 17 - Captain

131

Important Broomball Dates Wednesday, August 24 -Orientation Info Session  

E-Print Network [OSTI]

. The snow will be flying as the ice will be slick, As each player jumps on a rink with a new broomstick, Broomball is played on three outdoor ice rinks in front of Douglass Houghton Hall. There are currently 6:00-8:50pm in Fisher 135 Friday, September 9 - Booth w/ IRHC @ K-Day Monday, October 3 - Rink Staff , Referee

Endres. William J.

132

2008 Wesleyan University Baseball 3 Wesleyan Quick Facts / Info  

E-Print Network [OSTI]

...........................................................Red and Black President ................................................Douglas Bennet `59 Director

Royer, Dana

133

Novembre -Dcembre 2013 -N 251 SUBAQUA InfosRecherche  

E-Print Network [OSTI]

's University de Belfast (Irlande du Nord), nous révèlent. On s'en doutait. Fallait-il encore le prouver. En- loureuse les conduisant à changer de stra- tégie, de parcours. L'expérience ayant été menée sur 90

Jacquet, Stéphan

134

InfoCrystal: A visual tool for information retrieval  

E-Print Network [OSTI]

of interest. The lnfocrystal allows users to specify Boolean as well as vector- space queries graphically C r y s t a l T M ,that can be used as a visualization tool as well as a visual query lan- guage more readily than a direct analysis of the numbers would. Similarly, information visualization seeks

Spoerri, Anselm

135

SDS/forms/student info STUDENT CONTACT INFORMATION  

E-Print Network [OSTI]

: __________________________________________________________________ Residence Address: _______________________________________________________________ Cell Phone: _________________________________________________________________ _________________________________________________________________ _________________________________________________________________ Home Phone Number: _____________________________________________________ Cell Phone Number: _____________________________ Home Phone: ________________________ Email

Massachusetts at Lowell, University of

136

Megan Oakleaf, MLS, PhD www.meganoakleaf.info  

E-Print Network [OSTI]

exactly are the goals of your organization? #12;Data, Evidence, & Proof Not only do stakeholders count difference do you make for the user? Who is your user? #12;What difference do you make for the organization & Continuous Improvement #12;Military Users · Active/deployed/ returning/retired service members · Families

Oakleaf, Megan

137

Open Energy Info (OpenEI) (Fact Sheet)  

SciTech Connect (OSTI)

The Open Energy Information (OpenEI.org) initiative is a free, open-source, knowledge-sharing platform. OpenEI was created to provide access to data, models, tools, and information that accelerate the transition to clean energy systems through informed decisions.

Not Available

2010-12-01T23:59:59.000Z

138

Alternative Fueling Station Locator App Provides Info at Your...  

Broader source: Energy.gov (indexed) [DOE]

Fueling Station Locator website. It provides information on more than 15,000 public and private alternative fueling stations throughout the United States. The app lists where...

139

Info Vis Comp5048 lecture August 13 Tutorial: when?  

E-Print Network [OSTI]

in upper case are fixed and spaced regularly around a circle), and b. the Hooke's law spring method. A B,C,d,B,c f C,d,e,g g d,e,f 2. Find some code that computes force-directed layout. Test in on graphs with 10

Hong,Seokhee

140

Sapienza Universit di Roma Centro InfoSapienza  

E-Print Network [OSTI]

'APPALTO Il valore contrattuale dell'appalto è pari a 2.093.000,00 (euro duemilioninovantatremila/00), IVA pari ad 3.000,00 (iva esclusa) di cui al "Documento Unico di valutazione dei rischi standard da sono ammesse offerte in aumento. Al Fornitore potrà essere richiesto un incremento o una diminuzione

Guidoni, Leonardo

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Draft RCRA Permit Workshop Info for HAB Presenters  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed Newcatalyst phasesDataTranslocationDiurnalCommittee Draft Advice -IntegratedV0,RCRA

142

4-ID-C User Info (Under Development)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered‰PNGExperience hands-onASTROPHYSICS H.CarbonMarch Value4 3.P D ATFOR

143

Purdue Extension 1-888-EXT-INFO  

E-Print Network [OSTI]

as a burndown before planting; used in-crop on Roundup Ready® soybeans, corn, alfalfa, cotton, and canola

144

Evaluation & Contact Info Building NOAA's Weather & Water Social Science Program  

E-Print Network [OSTI]

Observation Systems (GEOSS) Autonomous Underwater Vehicles (AUVs) Unmanned Aerial Systems (UAS) Environmental

145

Home Fruit Spray Schedule Education Center & Info LIne  

E-Print Network [OSTI]

is followed, trees and small fruit plants should be reasonably free from insect and disease injury. This spray certain aphids, mites, scales, and pear psyllas on fruit trees. Copper soap (copper octanoate and situations where supplementary sprays or sanitation may be helpful. Diseases Black Knot of Plum and Cherry

New Hampshire, University of

146

Information for Development Program (infoDev) | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector GeneralDepartmentAUDIT REPORTOpen EnergyBoard"Starting a newIGUSLLCDivision of Oilfor

147

DVZ_Remediation_Technology_Tables_Info_Exchange.xlsx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed Newcatalyst phases onOrganizationElectronic2005-2007 Budget

148

InfoDev Incubator Support Center | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of InspectorConcentrating Solar Power BasicsGermany:InformationInformationInformation

149

JSON shows incomplete info | OpenEI Community  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of InspectorConcentrating Solar Powerstories on climate compatibleInformation offApproach toJSON shows

150

Property:GBIG/NeighborhoodInfo | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration Jump to:FieldProcedures JumpGreenButtonID Jump to: navigation,

151

MINERvA Engineering Info for Director's 3b review  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund Las ConchasTrail of aMEEM Energy Before construction can

152

Microsoft Word - 2015_LAHotel-Info-3.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTAL IMPACT STATEMENT

153

Microsoft Word - Contact info and Privacy Act Advisory _2_.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTAL IMPACTApproved:GEORGE W.COMPACT POWER,76D 12 -Us:

154

Alternative Fueling Station Locator App Provides Info at Your Fingertips |  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartment ofEnergy Natural Gas:Austin, T X S9-0s) All27,Alternative

155

Template:InfoForPlace | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia:FAQ < RAPID Jump to:Seadov Pty LtdSteen,Ltd Jump to:TaosISGANAttribution Jump to: navigation, search

156

Visitor Info | NEES - EFRC | University of Maryland Energy Frontier  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert SouthwestTechnologies | Blandine Jerome VelenciaNews Careers Work

157

Info-Exch 2012 - Shirley Olinger Presentation | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department ofHTS CableDepartment ofDepartment20112014TechnicalShirley

158

Info-Exch 2012 - Thomas Johnson Presentation | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department ofHTS CableDepartment

159

shiprock info sheet 08.20.13.cdr  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545 OCTTO:March_ ,' .'

160

Information for Development Program (infoDev) Feed | Open Energy  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revision hasInformation Earth's Heat JumpInc Place: Eden Prairie,Infield Capital Jump to:Información

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Introduction to PsycINFO PsycINFO, published by the American Psychological Association (APA), is the most  

E-Print Network [OSTI]

, first search media, then search eating disorders. Do not enter the search as "media AND eating: Auto Explode searches for all narrower terms of your subject heading. Focus limits your search. It may be useful to review the thesaurus to discover other related terms you may also want to search

Saskatchewan, University of

162

Agronomic Information 2008 Burley ToBacco ProducTion Guide  

E-Print Network [OSTI]

an adequate water supply and protected by windbreaks on the north and west sides. 2. Seed 75 to 100 square The production of an ample supply of uniform, healthy plants that are available reasonably early inches higher than the surrounding area. In the later stages of plant-bed preparation, do not use heavy

Liskiewicz, Maciej

163

WATER QUALITY DATA AND COLLECTION SUMMARY Water Monitorin site Descri tion  

E-Print Network [OSTI]

-ionized ammonia nitrogen, ammonia nitrogen, Total ~jeldahl Nitrogen, nitrate nitrogen, pH, total phosphorous seasonal concentrations were reported for carbon dioxide and six for bicarbonate alkalinity. Graphs were alkalinity, biochemical oxygen demand, carbon dioxide, chlo- rophyll a, chlorophyll b, chloride, color

Soerens, Thomas

164

More than 200 effects in growth, reproduc-tion, osmoregulation, and immunology  

E-Print Network [OSTI]

documented for prolactin (PRL). Although PRL seems to be an omnipotent hor- mone ("omnipotin"), it is best known for its role in the production of milk proteins. However, PRL is not only essential for 2 days show maternal care and an increase in plasma PRL level (13). Nulliparous, hypophysec- tomized

Allman, John M.

165

2010 shanghai ExPo EDiTion soCiology graDUaTE Daisy  

E-Print Network [OSTI]

life for all. #12;1 06 13 ConTEnTs 02 BUilDing BriDgEs To China: Professor John hearn writes about Goodman's research into German adventurers in China, including architect Walther Frey who designed some at the Shanghai expo 16 whaT nExT for China: Chinese Ambassador Zhang Junsai and historian John Wong write about

Du, Jie

166

STATEMENT OF C01 SIDER.!;.TIONS RE Q UE ST BY INVENTOR FOR THE...  

Broader source: Energy.gov (indexed) [DOE]

Pc itio n and in 'Je w or th objectives and con;-; idcrat ions set forth in I 0 CFR 784, all of wl-:: ch have 'JCcn considered . it is n:commendcd that the requested...

167

STATEMENT OF CON SID ERA TIONS REQUEST BY ABENGOA SOLAR INC....  

Broader source: Energy.gov (indexed) [DOE]

of the waiver petition and in view of the objectives and considerations set forth in 10 CFR 784, all of which have been considered, it is recommended that the requested waiver be...

168

The end of the book offers recommenda-tions and suggestions for running and docu-  

E-Print Network [OSTI]

also use this book to ana- lyze the impact of innovations in their soft- ware development practices at the Fraunhofer Institute for Experimental Software Engineering in Kaiserslautern. Germany. Contact her at lopez of application systems tailored toward a particular prob- lem domain. We can express variability within

van Deursen, Arie

169

THE CETACEAN EAR: FORM, FREQUENCY, AND EVOLuTION Darlene R. Ketten  

E-Print Network [OSTI]

condylarths, a cat-like, hooved carnivore, during the mammalian radiation, an explosive period of species, navigating, and finding mates. Once protocetes entered the ocean, these functions had to be accomplished

170

the YD triggered an equatorward reorganiza-tion of zonal circulation over North America  

E-Print Network [OSTI]

, which they in- terpret as a glacial advance and then correlate it to the Waiho Loop sequence. Carbon isotope data show strong revegetation at about 13,000 radio- carbon years ago with no signal of a YD

Miyashita, Yasushi

171

RESOLUTION NO. 2013 -110 RESOLUTION AMENDING THE TURLOCK IRRIGA TION DISTRICT'S  

E-Print Network [OSTI]

Owned Electric Utilities and the Turlock Irrigation District Renewable Resources Procurement Plan. NOW) with the TID Renewable Resources Procurement Plan. The TID Renewable Resources Procurement Plan, at minimum Compliance Period 1, January 1, 2011 to December 31,2013, TID shall procure renewable energy resources

172

FOR STUDENTS // FEbRUaRy 2012 FOR EDUCaTION  

E-Print Network [OSTI]

basic Search (autocomplete) 10 Full Search 11 browsing Menus 12 PERFORMING aNaLySIS 12 Navigating Functions 13 Stock/Company Screening 14 analyzing a Company 15 analyzing an Index, bond or Currency 16 Ex sectors. It features company financials, market data spanning more than 20 years, charts, statistics

Banaji,. Murad

173

2013NatureAmerica,Inc.Allrightsreserved. nature immunology aDVaNCE ONLINE PUBLICaTION  

E-Print Network [OSTI]

. 6Core Technology and Research Center, Tokyo Metropolitan Institute of Medical Science, Tokyo, Japan signals leading to the release of allergic mediators that induce immediate hypersensitivity1. Anaphylaxis including the respiratory and circulatory systems, often leading to life-threatening episodes

Gelb, Michael

174

The PneumaTic hybridizaTion concePT for downsizing and  

E-Print Network [OSTI]

that are based on exotic energy carriers. Compared to conventional fuels, pressu- rized air exhibits an extremely

Lygeros, John

175

AMENDMENT OF SOLICIT ATION/MODIFICA TION OF CONTRACT 1. CONTRACTID CODE  

E-Print Network [OSTI]

must acknowledge receipt of this amendment prior to the hour and date specified in the solicitation of the amendment; (b) By acknowledging receipt of this amendment on each copy of the offer submitted; or (c OF YOUR ACKNOWLEDGEMENT TO BE RECEIVED AT THE PLACE DESIGNATED FOR THE RECEIPT OF OFFERS PRIOR TO THE HOUR

176

Social housing policies under changing framework condi-tions in Santiago de Chile  

E-Print Network [OSTI]

unifamiliares en modalidad de autoconstrucción o bloques de viviendas plurifamiliares. Con ello los campamentos de vi- viendas irregulares disminuyeron considerablemente. La política de vivienda social fue

Borsdorf, Axel

177

tion. Human or mouse intestinal epithelial cells that express the poly-Ig receptor were  

E-Print Network [OSTI]

. Antibodies specific for Clostrid- ium difficile toxin A and Helicobacter pylori urease have been generated, Glauser M et al (1995) Oral immunization with Helicobacter pylori urease as a treatment against Helicobacter infection. Gas- troenterology (in press) Haneberg B, Kendall D, Amerongen HM, Apter FM

Boyer, Edmond

178

Keywords: Agents, Cellular models, Discrete event simula-tion, DEVS, human agent models, Mediterranean landscape.  

E-Print Network [OSTI]

- plained by climate change or human-caused degradation of the landscape. Finally, by placing model villages, Mediterranean landscape. ABSTRACT The Mediterranean Landscape Dynamics (MEDLAND) pro- ject seeks to better an- other while providing flexibility for either model to be changed in a systematic fashion

179

MEMORANDUM FOR SCOTI L. SAMUELSON MANAGER OFFICE OF RIVER PROTE~TION ~  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and InterfacesAdministration -Lowell L. Wood,3, BPADepartmentMarch

180

The Beverley Taylor SorenSon arTS & educaTion complex  

E-Print Network [OSTI]

. & Patricia W. Child Taft & Mary Jane Price Pat & Boyer Jarvis The Church of Jesus Christ of Latter-day Saints Funds Michael L. Hardman & Monica Ferguson John & Andrea McDonnell Rebecca Meadows Anderson & Nathan Anderson Anonymous Anonymous Anonymous David & Susan Carlebach Willa's Workshop Ivory Homes Bill Evans

Tipple, Brett

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

High-Risk Groups The CenTer for TransporTaTion safeTy  

E-Print Network [OSTI]

measures of protection. Motorcyclists Ongoing careful analysis of motorcycle crash trends has provided a foundation for a statewide campaign to improve motorist awareness of motorcycles. The CTS also conducts professionals as well as motorcycle users. In the wake of these efforts, data suggest that motorcycle crashes

182

Exploration of Complex Objects structure for Knowledge Discovery  

E-Print Network [OSTI]

8 e­mail : valtchev@info.uqam.ca, missaoui.rokia@uqam.ca Abstract The evolution of database management systems (DBMS) leans towards an increasing structura­ tion of the data models used. Recent in object­ relational DBMS, we believe that there is an urgent need to investigate that topic. In this paper

Valtchev, Petko

183

A Polysilicon Active Matrix Organic Light Emitting Diode Display with Integrated Drivers R.M.A. Dawson, Z. Shen, D.A. Furst, S. Connor, J. Hsu, M.G. Kane, R.G. Stewart, A. Ipri  

E-Print Network [OSTI]

A Polysilicon Active Matrix Organic Light Emitting Diode Display with Integrated Drivers R.S.A. Abstract The design of an active matrix organic light emitting diode (AMOLED) display using a polysilicon. Introduction Organic light emitting diodes (OLEDs) are presently of great interest due to their potential

184

Clim. Past Discuss., 2, 657709, 2006 www.clim-past-discuss.net/2/657/2006/  

E-Print Network [OSTI]

September 2006 Correspondence to: R. Marsh (rma@noc.soton.ac.uk) 657 Abstract A new Earth System Model

Williamson, Mark

185

tions (Fig. 4). The layer thicknesses observed (a 0.90 m for the 400-m fibers; a  

E-Print Network [OSTI]

(1999). 17. Z. U. Borisova, Glassy Semiconductors (Plenum, New York, 1981). 18. A. K. Varshneya, J. Non (1970). 22. M. Bass, Ed., Handbook of Optics (McGraw-Hill, New York, 1995). 23. J. E. Mark, Ed., Polymer

Romanowicz, Barbara

186

tions (www.aip.org/pas). One of its pro-grams is suited for examining the phe-  

E-Print Network [OSTI]

in an electromagnetic analog of the spring oscillator--that is, in a series LCR circuit containing an inductor (a coil oscil- lations of a mechanical torsion-spring pendulum whose moment of inertia is subject to periodic- ments this article describes deal with a fa- miliar mechanical system--the torsion- spring oscillator

Butikov, Eugene

187

Summary Human activities are increasing the concentra-tions of atmospheric carbon dioxide ([CO2]) and tropospheric  

E-Print Network [OSTI]

to forest soils. Because the quality and quantity of labile and recalcitrant carbon (C) com- pounds, soluble phenolics and condensed tannins. Elevated [CO2] significantly increased lit- ter biomass] and tropospheric [O3] that we observed, combined with changes in litter biomass production, could significantly

188

tion (21) and protonation state (22) of TyrL162 may be important for the mechanism of electron  

E-Print Network [OSTI]

oxygen from water. Crystal structures of photo- system II (30) reveal that TyrZ lies between the oxygen-evolving center and the special pair in a position functionally analogous to that occupied by TyrL162 of RCvirL162 may have aided the spontaneous formation of tyrosine radicals in an ancient reaction center

Blumberg, Bruce

189

The beaver is nature's original wetland creation and restora-tion expert. Stimulated by the sound of running water, the  

E-Print Network [OSTI]

and Beschta 2008; Diefenderfer and Montgomery 2009), southeastern U.S. blackwater streams (Snodgrass and Meffe

190

ment of robust recognition in diverse environmental condi-tions through the formulation of a series of speech enhance  

E-Print Network [OSTI]

of a series of speech enhance Speech Recognition System ment and stress compensationpreprocessingalgorithms iterative speech enhancement [1,2]. Stress compensation al- gorithms are based on formant location, bandwidth, and in- tensity. Enhancement preprocessingincreases recognition by +34% for neutral speech, 18

Texas at Dallas, University of

191

Abstract In the present study, soil C and N mineraliza-tion and nutrient availability were compared: (1) in  

E-Print Network [OSTI]

losses of SOM can only be replenished in the short-term by application of organic matter such as ma- nure

Lehmann, Johannes

192

form processing specifically for use by vision applica-tions. The most fundamental of the planned extensions  

E-Print Network [OSTI]

, J. Brolio, A. Hanson, and E. Riseman, "The Schema System," International Journal of Computer Vision, "Detecting Runways in Complex Airport Scenes," Computer Vision, Graphics, and Image Processing, Vol. 51, No:McGraw Hill, 1975, Chapter 5. #12;Figure 10 Los Angeles International -- Excellent runway only. #12;Figure 9

Southern California, University of

193

nparticulier consulte un architecte pour la construc-tion d'une maison. Plusieurs options lui sont offertes  

E-Print Network [OSTI]

sont offertes : une maison de plain-pied ou à un étage, un patio, une terrasse et un garage. Ses goûts et son ban- quier lui dictent plusieurs contraintes : il faut qu'il y ait un étage ou une terrasse, mais pas les deux ; il faut qu'il y ait un garage ou un patio, mais pas les deux ; s'il y a un patio

Monasson, Rémi

194

Full field investigation of salt deformation at room temperature: coopera-tion of crystal plasticity and grain sliding  

E-Print Network [OSTI]

Halite has been extensively studied both as a rock forming mineral with industrial applications (storage) and cyclic loading, owing to a new projected use of salt cavities as storage for com- pressed air, which of pure laboratory salt powder (99,9 %). First, the pow- der was cold pressed during 48 hours

Paris-Sud XI, Université de

195

thorie, rnais plutt l'emploi des tubes qui modifient les condi-tions de l'vaporation. E. HAUDI.  

E-Print Network [OSTI]

possible l'effet Peltier ; elles ont conlirm la loi de Thomson. Celles de NI. Jahn, au contraire, duraient loi de Thomson relative l'effet Peltier dans le cas de deux mtaux diffrentes, d'un mtal et d semblable celui qui a t dj dcrit (1 ). Les valeurs moyennes de l'efl'et Peltier, lorsqu'on fait

Paris-Sud XI, Universit de

196

FIGURE 1 Map of Britain and Ireland showing the main islands men-tioned in the text.  

E-Print Network [OSTI]

Publishing Group). Rautner, M., M. Hardiono, and R.J. Alfred. 2005. Borneo: Treasure Island at risk. Status

Gillespie, Rosemary

197

tion using complexes formed with 32 mRNA and found that the mRNA segregated  

E-Print Network [OSTI]

, and thereby contribute to ribosome recycling during termination. Treatment of termi- nation complexes (with 35 S-Metlabeled peptidyl- tRNA) with catalytically inactive eRF1(AGQ): eRF3 led to the formation specificity, taking place only when a stop codon was presented in the A site (Fig. 4C). Canonical recycling

Rockman, Matthew

198

absorption properties of leaf with minimum scattering contribu-tion. In order to minimize the scattering contribution due to air  

E-Print Network [OSTI]

, FLORIDA Florida State University Tom Thumb, a useful popcorn --Bass, HW, Kang, LC, Eyzaguirre, A We have mother cells and found them to be suitable for FISH and immunocytochemical analysis of meiotic prophase. Figure 2 shows that telomeres and several knobs can be detected by 3D FISH carried out as previously

Bass, Hank W.

199

Tweets as data: Demonstration of TweeQL and TwitInfo  

E-Print Network [OSTI]

Microblogs such as Twitter are a tremendous repository of user-generated content. Increasingly, we see tweets used as data sources for novel applications such as disaster mapping, brand sentiment analysis, and real-time ...

Marcus, Adam

200

Continuing Education examination available at http://www.cdc.gov/mmwr/cme/conted_info.html#weekly.  

E-Print Network [OSTI]

-pod laundry detergent exposures. Parents and caregivers should keep laundry detergent pods, as well as other was discharged 24 hours after the exposure. Poison center staff members fol- lowed up with the child's parents 4 of Potential Life Lost from Unintentional Injuries Among Persons Aged 0­19 Years -- United States, 2000

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Custom Visual Exploration of the InfoVis Dataset Kyle Hatcher Mike Bailey  

E-Print Network [OSTI]

year, and seeing if the dot-com bubble became apparent. At first, we just set the year to the most dots which can be filtered based on numerous criteria set with the GUI. Our GUI is shown here. The GUI of the dots. In Section C, the user can control what color mapping is used to the display the variable

Bailey, Mike

202

Organization Industry Majors Positions Info Sessions Job Fair Application Process/Interviews Baker Hughes  

E-Print Network [OSTI]

& Gas Service Company All Engineering majors, Engineering Technology, Geology, Mathematics, Physics Services Civil Engineering, Computer Science, Mechanical Engineering, Petroleum Engineering Full Time, Part Hughes Oilfield Service Company Internships, Full Time Sept 23, 8:30 PM Wood Center C/D Yes See job

Ickert-Bond, Steffi

203

Universite Claude Bernard Lyon 1 UFR de Mathematiques Ecole doctorale InfoMaths  

E-Print Network [OSTI]

Universit´e Paris Descartes Soumaya Boujena Universit´e Hassan II, Maroc Directeurs de thèse : Vitaly Universit´e Hassan II, Maroc Directeurs de thèse : Vitaly Volpert Universit´e Lyon 1 St´ephane G

204

Molecular Methods in Microbial Ecology Contact Info: Julie Huber, jhuber@mbl.edu  

E-Print Network [OSTI]

DNA Partial genomes 2012 Pearson Education, Inc. #12;Head et al. 1998 #12;Head et al. 1998 #12;DNA Mix 10 l of your DNA with 5 l loading buffer Load in well on gel I'll load the ladder Run

Vallino, Joseph J.

205

For Office Use Only Form Info Entered on CSS: (check mark indicates "yes") BY: ______________ DATE  

E-Print Network [OSTI]

: Initials of BGSU employee Brsr Revised 7/27/10 Bowling Green State University Student's Authorization), and University policy allows Bowling Green State University to disclose information from a student's financial consent to the Office of the Bursar and the Student Financial Aid Office at Bowling Green State University

Moore, Paul A.

206

Land Universitet Sprk OBS! Mer info Argentina Instituto Tecnologico de Buenos Aires Spanska Ej fr F  

E-Print Network [OSTI]

/Engelska Endast A Finland Tampereen Teknillinen Korkeakoulu Engelska / Finska Finland University of Lapland Engelska/Finska Endast ID Finland Oulun Yliopisto Finska/Engelska Finland ?bo Akademi Svenska Finland Aalto yliopisto Finland Lahti University of Applied Sciences (Lahti Yrkeshögskola) Endast ID Finland Vaasan

207

EERE Information Center 1-877-EERE-INFO (1-877-337-3463)  

E-Print Network [OSTI]

exposed to hydrogen. Hydrogen-powered vehicles offer many operating advantages. They are highly fuel wind turbines and photovoltaic arrays to power electrolyzer stacks that split water into hydrogen. Advantages of Hydrogen-Powered Vehicles · Hydrogen can be made using a wide variety of domestic resources

208

Where's My Bus Stop? Supporting Independence of Blind Transit Riders with StopInfo  

E-Print Network [OSTI]

in the Seattle area with information entered by the community, primarily as they waited at these stops and Society]: Social Is sues--Assistive technologies for persons with disabilities General Terms Design]. They often search for physical landmarks such as the bus shelter, benches, or transit sign as a cue

Manchak, John

209

Spatial Science Lab Account Info Sheet Teaching and Open Computer Laboratories Spring 2012  

E-Print Network [OSTI]

CONTACT ME (SEE BELOW) BEFORE THE SEMESTER ENDS! Open Access SSL Lab The HFSB124 lab functions. These schedules are also listed on the SSL web site. Please see ssl.tamu.edu for this information. Using and teaching labs in the SSL, you must have an ESSMTEACHING account. These accounts are created based

210

E-Print Network 3.0 - advanced info-communications infrastructure...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Definition - Interplay of Storage within the "Bigger Picture" Lack of Systems Optimization... : Advanced Concepts Advanced Materials Codes & Standards Studies &...

211

[info:lanl-repo/lareport/LA-UR-14-27140] Proceedings of the Workshop...  

Office of Scientific and Technical Information (OSTI)

Library A permalink (or permanent link) is a URL that points to a specific record or resource. Permalinks remain unchanged indefinitely Permalinks are considered the best way to...

212

2013 Globex Summer Program (July 1-31, 2013) COURSE INFO TABLE PARTICIPATING UNIVERSITY / ORGANIZATION  

E-Print Network [OSTI]

University, China Yr 2 8-10 AM, M-F Classroom 2 University of Toronto Canada Manufacturing Engineering Photovoltaics: Solar Energy July 1 19, 2013 Upper Level UG & GR Upper Level UG & GR 8-11 AM, M-F Classroom 3 University, China Peking University, China 15 11 13 1 2 3 4 5 6 7 8 9 Course (3 Credit Hours) Start-End Dates

Ge, Zigang

213

www.eandp.info E&P | November 2006 To realize the value of an Intelligent  

E-Print Network [OSTI]

of oilfield automation. From the wave of ERP implementations around the turn of the millennium, the difference with the powerful new ERP tools. Similarly, most engineers have been associated with oilfield automation projects

214

Veterans and STEM Mentoring Programs- Info Session and Brown Bag Networking  

Broader source: Energy.gov [DOE]

January is National Mentoring Month. Join the Veterans Mentoring Program and the STEM Mentoring Program at DOE for information distribution and networking to meet current and potential mentors and...

215

info710 : Complements de bases de donnees TD 6 : decompositions et forme normale  

E-Print Network [OSTI]

) ; - R(A, B, C, D, E), avec F = {AC E, B D, AE BCD, DC} et = (ABC, CDE) ; Question 2. Est-ce que les 1 1 1 1 1 0 1 2 1 0 1 3 2 2 2 2 avec = (AB, BCD) ; - R A B C D E n n + 1 n + 2 n + 1 n + 3" : code unique de d´esignation d'un livre publi´e) - le Prix du livre. Les d´ependances impos´ees sont G

Hyvernat, Pierre

216

2014-2015 DYF Awardees' Info and Abstracts 1. Name (Last, First): Liu, Chao  

E-Print Network [OSTI]

the design of novel photocatalysts for efficient solar energy conversion. 2. Name (Last, First): Mensching all, requiring countless dollars to rehabilitate the roadway (or your own car!). My research

New Hampshire, University of

217

Convergence of Bio Info Nano Eco: Global Public Goods and Economic Growth  

E-Print Network [OSTI]

This article is about convergence and why not. How about a ride to space in an elevator? Why not? A single nanotube could stretch from earth to the stratosphere and be able to support its own weight. This fact spurred NASA ...

Datta, Shoumen

2008-07-31T23:59:59.000Z

218

www.ConferenceOnSustainableRealEstate.com info@ ConferenceOnSustainableRealEstate.com  

E-Print Network [OSTI]

for the highest energy consumption and carbon emissions. Instead, the single largest consumer of energy that many in the public and private sectors have adopted to achieve the objectives of Sustainable Real, and global geographic scales. Energy prices are volatile. Both increase risk of investment and risk

Dasgupta, Dipankar

219

Provided by the WSU Visitor Center 509-335-INFO (4636)  

E-Print Network [OSTI]

., Colfax, WA 9 RV spots Palouse Empire Fairgrounds (509) 397-3753, Colfax, WA 99111 Electricity, Water, Restrooms, Showers Seasonal (509) 397-6263 Palouse RV Park (509) 878-1811 490 W Main 10 Full Hook-ups Palouse, WA 99161 Wawawai County Park (509) 397-6238 16 miles from Pullman via Wawawai Rd. Open all year

Collins, Gary S.

220

OpenEI: Datasets in the OpenEnergyInfo Data Repository  

DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

The Open Energy Information initiative (OpenEI) is a platform to connect the world's energy data. It is a linked open data platform bringing together energy information to provide improved analyses, unique visualizations, and real-time access to data. OpenEI follows guidelines set by the White House Open Government Initiative , which is focused on transparency, collaboration, and participation. OpenEI strives to provide open access to this energy information, with the ultimate goal of spurring creativity and driving innovation in the energy sector.[Copied from the OpenEI Wiki main page]. It features a wiki, a blog, a list of information gateways, and a browsing list of deposited data sets.

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

1 Health Gov Info.doc HEALTH-RELATED GOVERNMENT INFORMATION & STATISTICS  

E-Print Network [OSTI]

.gc.ca/publicat/sars-sras/naylor/index-eng.php · Building on Values: The Future of Health Care in Canada (Romanow report) http://dsp-psd.pwgsc.gc.ca/Collection/CP32-85-2002E.pdf · A Framework for Reform: Report of the Alberta Premier's Advisory Council on Health listing, check out the `publications' list at URL: http://www.health.alberta.ca/newsroom/pub-health-care

Abolmaesumi, Purang

222

Informacin durante o despus de una emergencia : Llame al nmero 459-INFO (4636)  

E-Print Network [OSTI]

cabeza con los brazos. · Valla al punto designado por su edificio. Sismo / Temblor E · Llame al número

California at Santa Cruz, University of

223

1http://info.anu.edu.au/hr/ Career Development GuiDe  

E-Print Network [OSTI]

and facilitator · career consultant · staff development consultant Hr Generalists Workforce planning · college/division Hr officer · college/division Hr consultant · workforce planning consultant · workforce planning · identifying appropriate professional development · creating a career development plan · improving your

Botea, Adi

224

Microsoft Word - info quality guidelines updated 3-7-11.docx  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehicles »Exchange Visitorsfor ShadeProject ManhattanMentorp DEPARTMENT OF

225

OpenEI.org: A wealth of renewable energy info at your fingertips | OpenEI  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoading map...(UtilityCounty, Michigan: EnergyOpenBarter Jump to: navigation,Community

226

Want the latest info on JLab's public, educational events? | Jefferson Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched Ferromagnetism inS-4500IIVasudhaSurface.Laboratory30,WP-07 powerWalter H. Zinn,Want

227

Microsoft Word - GSA Schedule 84 ESPC Program Contact Info.docx  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribalthe Nativeof the Fuel CycleDocument - Submitted

228

V-058: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment of EnergyProgram2-26TheUtility-Scale Wind & SolarDepartment ofRemote Users

229

Lab-Corps Program Info. Session - Jan. 20, 2015 | Argonne National  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and Interfaces Sample6, 2011 LOSEngineering |Lab

230

Microsoft Word - info quality guidelines updated 3-7-11.docx | Department  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergySAR.doc More Documents &U.S.of

231

Online.Academy.edu/BuildingInfo Ads by Google August 1, 2010  

E-Print Network [OSTI]

According to a poll released July 27 America has nine of the most important green buildings in the world publication Architect Magazine listing the 'most important green buildings since 1980' were released on July 28. The poll was conducted amongst 150 leading green building experts including architects, engineers

232

InfoDev and DFID Climate Technology Program | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of InspectorConcentrating Solar Power BasicsGermany:InformationInformationInformationDFID Climate

233

DOE Science Showcase - DOE Nuclear Physics R&D Info | OSTI, US Dept of  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to UserProduct: Crude OilPublicDNALostPlasmaReviews »ofUSOffice ofEnergy,

234

Recording Available for Viewing of Newport News Info Meeting Conducted at  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared at 278, 298,NIST 800-53 Revision 3 + DraftJLab on March 31 |

235

MINERvA Engineering Info for DOE 1,2,3a review  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and InterfacesAdministration -Lowell L. Wood,3,MarchMFRC65-OCT.Re view

236

MIT Plasma Science & Fusion Center: research>alcator>facility info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region serviceMissionreal-time information Tour Alcator

237

Get your Tsunami info here | OSTI, US Dept of Energy, Office of Scientific  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinan antagonist Journal Article: Crystal structureComposite--FORRemarks IGPPSDo-It-Yourselferand

238

http://www.sord.nv.doe.gov/MEDAStationInfo-tng.htm  

National Nuclear Security Administration (NNSA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart of the Reviewwill help prepareA ReviewManualREMSCareers | Contact

239

MIT Plasma Science & Fusion Center: research>alcator>facility info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund Las ConchasTrail of aMEEMreal-timeFacility Information

240

[info:lanl-repo/lareport/LA-UR-14-27140] Proceedings of the Workshop on the  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformation In closing, an National Carbon Capture Center at2/316 Photovoltaic

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Info-Exch 2012 - Sites Lessons Learned Presentation | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department ofHTS CableDepartment ofDepartment20112014TechnicalShirleySites

242

Staff Info - People - Center for Plasma in the Laboratory and Astrophysics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatus Tom Fletcher,FutureNanostructuredSPRINGCornellStaff- UW

243

Observer Name(s) & contact info Circle the zone you are in  

E-Print Network [OSTI]

Peltandra viginica 75 Common Reed Phragmites australis 76 Pokeweed Phytolacca americana 77 Eastern White

Columbia University

244

When Pfizer Met McDreamy: A Classic American Love Story Between Medicine and the Media  

E-Print Network [OSTI]

Jordan, 2003 Pharmaceutical Industry. In Companion toPhRMA the pharmaceutical industrys lobbying organization.loosened for the pharmaceutical industry but the information

Bodoh-Creed, Jessica Anne

2013-01-01T23:59:59.000Z

245

The purpose of this file (always under construction) is to provide correc-tions and references to further developments regarding the material in the  

E-Print Network [OSTI]

, Dammame, Allouche, Berthe, Denis takes the results further. 3. (3) (Gauss, Inv 88): (Updates) For A

Zakharov, Vladimir

246

The purpose of this file (always under construction) is to provide correc-tions and references to further developments regarding the material in the  

E-Print Network [OSTI]

, Dammame, Allouche, Berthe, Denis takes the results further. 3. (3) (Gauss, Inv 88): (Updates) For A, other volume, Anderson's papers in Duke, JNT, Dammame's thesis a

Zakharov, Vladimir

247

1197 South Lumpkin Street Athens Georgia 30602-3603 weddings@georgiacenter.uga.edu 706.542.2654 recePTion service inFormaTion  

E-Print Network [OSTI]

] Chef's Selection of Cookies, Brownies, and Other Bakery Sweets, Snack Baskets, Orange-Cranberry, and Sliced Fresh Strawberries. Cookies, Pretzels, Orange-Cranberry Punch, and Hot Coffee Punch service [3091] Orange-Cranberry Punch BeFore-dinner deluxe social hour wiThouT alcohol [3095] Snack Baskets, Potato

Arnold, Jonathan

248

Volume 25. tionScrvica,Univeraity of B.C., Number 21. , Vancouver, B.C. VtX 1W5,  

E-Print Network [OSTI]

of transport phenomena in metallurgicalprocesses." Earlier this year the institute presented him with its of the chemical engineering department. Cancer agents in food subject of UBC research UBC scientists and the establishmentof guidelines for student evaluationof courses and teaching, and for the use and distribution

Farrell, Anthony P.

249

In ~~olution, L~arning, gogn!tion, and Advanced Architectures, Y.C. Lee (Ed.). Hong Kong: World  

E-Print Network [OSTI]

Scientific Publishers, 1988. SPEECH PERCEPTION AND PRODUCTION BY A SELF-ORGANIZING NEURAL NETWORK Michael A perception, invariant speech perception, word superiority, and phonemic restoration. 1. The Learning of Language Units During a human's early years, an exquisitely subtle and sensitive speech recognition

Grossberg, Stephen

250

A MILD OXIDJ.TION OF ALDEHYDES TO ir,B-LMATURATEU ALDEHYDES David K. Willm~s"' and Klyoshl Nishltani  

E-Print Network [OSTI]

led to mixtures. - Notably enol acetates and ethers have been recognized as excellent substrates-hydroxy selenldes which are conven- iently transformed into vinyl selenides, epoxldes, olefins, and allylic alcohols

Williams, David R.

251

Hydrolysis of DFP and the Nerve Agent (S)-Sarin by DFPase Proceeds Along Two Different Reaction Pathways: Implica-tions for Engineering Bioscavengers  

SciTech Connect (OSTI)

Organophosphorus (OP) nerve agents such as (S)-sarin are among the most highly toxic compounds that have been synthesized. Engineering enzymes that catalyze the hydrolysis of nerve agents ( bioscavengers ) is an emerging prophylactic approach to diminishing their toxic effects. Although its native function is not known, diisopropyl fluorophosphatase (DFPase) from Loligo vulgaris catalyzes the hydrolysis of OP compounds. Here, we investigate the mechanisms of diisopropylfluorophosphate (DFP) and (S)-sarin hydrolysis by DFPase with quantum mechanical/molecular mechanical (QM/MM) umbrella sampling simulations. We find that the mechanism for hydrolysis of DFP involves nucleophilic attack by Asp229 on phosphorus to form a pentavalent intermediate. P F bond dissociation then yields a phosphoacyl enzyme intermediate in the rate-limiting step. The simulations suggest that a water molecule, coordinated to the catalytic Ca2+, donates a proton to Asp121 and then attacks the tetrahedral phosphoacyl intermediate to liberate the diisopropylphosphate product. In contrast, the calculated free energy barrier for hydrolysis of (S)-sarin by the same mechanism is highly unfavorable, primarily due to the instability of the pentavalent phosphoenzyme species. Instead, simulations suggest that hydrolysis of (S)-sarin proceeds by a mechanism in which Asp229 could activate an intervening water molecule for nucleophilic attack on the substrate. These findings may lead to improved strategies for engineering DFPase and related six-bladed -propeller folds for more efficient degradation of OP compounds.

Wymore, Troy W [ORNL] [ORNL; Langan, Paul [ORNL] [ORNL; Smith, Jeremy C [ORNL] [ORNL; Field, Martin J. [Institut de Biologie Structurale Jean-Pierre Ebel] [Institut de Biologie Structurale Jean-Pierre Ebel; Parks, Jerry M [ORNL] [ORNL

2014-01-01T23:59:59.000Z

252

inverter. He is the author or co-author of more than 300 publica-tions in his research fields including the book `Control in Power  

E-Print Network [OSTI]

W, the induction generator is favored for small hydro and wind power plants. More recently, with the widespread use Power Electronics Society NEWSLETTER 19 Induction Generators for Small Wind Energy Systems M. Godoy solution for such applications [1]. For its simplicity, robustness, and small size per generated k

Simões, Marcelo Godoy

253

Clemson University Preservation master Plan ParT I: InTroducTIon chaPTer one February 2009 JMa, Inc. 1  

E-Print Network [OSTI]

cultural landscape as surveyed in 2008, including historic landscape and building elements. Part IV for campus-wide planning, as well as for the alteration of historic landscape and building elements. Part V: Treatment Recommendations provide specific recommended treatments and preservation maintenance practices

Duchowski, Andrew T.

254

IEEE TRANSACTIONS ON BIOMEDICAL ENGINEERING, VOL. BME-23, NO. 3, MAY 1976 tion of Bayluscide and sodium Pentachlorophenate in the Egypt-  

E-Print Network [OSTI]

and sodium Pentachlorophenate in the Egypt- 49 project area," Bull. World Health Org., vol. 35, pp. 357 mansoni infections in the Egypt- 49 project area, 1. sampling techniques and procedures for mea- suring. Mallah, "The behavioural pattern of social and religious water-contact activities in the Egypt-49

255

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

256

. +7 (499) 488-03-54, info@astra-partners.ru, www.astra-partners.ru , ..., MBA, /  

E-Print Network [OSTI]

Pathway NOA (UK). ­ IBM SSME (Service Science, Management and Engineering), ITIL Management ­ IBM SSME (Service Science, Management and Engineering), ITIL/ITSM, etc. Leading Experts

Kaplan, Alexander

257

Scitation | AIP Journals | Purchasing Info | Librarians | Alerts | Top 20 Articles | Contact | Help | Exit Copyright 2009 American Institute of Physics  

E-Print Network [OSTI]

: Permitted/Prohibited Uses Enter Your Search Run Search in 6This Journal Search AIP Conf. Proc. / Volume 24 metals · YEAR: 1975· PUBLICATION DATA Home About Authors Conf Organizers Permissions Terms of Use Volume: Page/Article: Retrieve Search Browse Page 1 of 1Magneto-optical studies of ferromagnetic metals 10

Erskine, James L.

258

Pouze informativn! Zvazn podmnky pijmacho zen viz https://is.cuni.cz/studium/podprij/index.php?do=info&fakulta=11320  

E-Print Network [OSTI]

Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php/2012 Praha 2010 #12;2 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php ISBN 978-80-7378-125-5 #12;3 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php

Cerveny, Vlastislav

259

L:\\RHtoUGRD\\transfer general info\\RHAG-UGRD Procedures December 2012 RATCLIFFE HICKS SCHOOL OF AGRICULTURE  

E-Print Network [OSTI]

OF AGRICULTURE TRANSFER PROCEDURES Ratcliffe Hicks students may apply to transfer into the College of Agriculture degree requirements to graduate from the Ratcliffe Hicks School of Agriculture (RHAG) to transfer School of Agriculture Office of Academic Programs #12;

Alpay, S. Pamir

260

Organizing Off-Campus Networking/Recruiting Info: 3 Popular Approaches (Tips compiled from Erb and other SNRE students)  

E-Print Network [OSTI]

: Create a folder on your hard drive for each company to track notes from each conversation, your exact and networking priorities for each company · Each company on a diff tab in greater depth · Field headings: firmMind, , MindMapping, MindJet, plenty of other free and online tools via a google search on "Mind Mapping" o

Edwards, Paul N.

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

NCBI Handout Series | SRA | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov SRA: Sequence Read Archive  

E-Print Network [OSTI]

the Roche 454 plat- form) using BLAST, a link is listed under the "Specialized BLAST" section on the BLAST homepage: blast.ncbi.nlm.nih.gov/ . Finding NextGen data through PubMed's SRA links The interest- set that have alignment to master genome assemblies. The filtering effect is indicat- ed

Levin, Judith G.

262

Quick Contact info for selected DP/Center Administration (see Center pages for a more inclusive list of contacts)  

E-Print Network [OSTI]

................ bickham@purdue.edu Black, Nancy ......................48675 ................... blackn@purdue.edu Brown ...............wburgess@purdue.edu Campbell, John ..................41289 .......john-campbell@purdue.edu Childress, Amy

Jiang, Wen

263

Forschen und Wissen info44 2/2011 Forschen und Wissen 45 Etwa 40 Prozent der Deutschen sind  

E-Print Network [OSTI]

chronisch mit Helicobacter pylori infi- ziert. Das Bakterium kann unter anderem Magengeschwüre verursachen Verbundvor- habens ,,ERA-NET PathoGenoMics3: Di- versität von Helicobacter pylori: Rolle in Pathogenese genetische Vielfalt aus, sodass fast jeder Infizierte ,,seinen" indi- viduellen Helicobacter-Stamm trägt. Wis

Manstein, Dietmar J.

264

NCS Shot Sync Info Three shot-sync'd timing pulses are sent to the Real-time system's  

E-Print Network [OSTI]

Sh19 http://cadd-web2.pppl.gov/dwgtopdf/0BAE4005_19.pdf The DITS used for the timestamp/crate). Reference dwgs A-AE7006 and A-AE7007. http://cadd-web2.pppl.gov/NSTX/ListAE7.htm #12;Ref Dwg #12;

Princeton Plasma Physics Laboratory

265

IEEE TRANSACTIONS ON COMPUTERS, VOL. 47, NO. 10, OCTOBER 1998 1073 The InfoPad Multimedia Terminal: A Portable  

E-Print Network [OSTI]

designed for portable stand-alone operation. The requirements to reduce the weight and energy consumption- sary to reduce the energy consumption, weight and cost of the end-user device as much a the terminal to have the port- ability of a paper notebook (1 lb, 8.5" x 11") while still being able to support

Han, Richard Y.

266

\\\\Info & Training\\Briefings\\CLINICALBRIEF1-07.DOC 1 of 2 The University of Edinburgh Estates & Buildings  

E-Print Network [OSTI]

by inhalation R 36/37/38 Irritating to eyes, respiratory system and skin R 68 Possible risk of irreversible-hazardous, or less hazardous, before moving further down the hierarchy to mechanical controls and lastly Personal if swallowed, it is very toxic by inhalation and, in powder form is irritating to the upper respiratory tract

Barton, Nick

267

http://www.illegal-logging.info/item_single.php?item=document&item_id=21&approach_id=26  

E-Print Network [OSTI]

change, 1990-2000 Annual change (%) Global total 3,963,429 3,869,455 -9,391 -0.22 Source: FAO 2001 #12 of deforestation, compiled by the FAO, suggests global forests are disappearing at a rate of 0.2% per annum accounted for 25-50% of global imports for several important timber products in 2000. A large, though

268

AIAA Paper No. 2005-6982 InfoTech@Aerospace Conference, American Institute of Aeronautics and Astronautics, Sept., 2005  

E-Print Network [OSTI]

and Astronautics, Sept., 2005 1 An Undergraduate Course in Unmanned Air Vehicles Lyle N. Long* , Scott D. Hanford of unmanned air vehicles. A two semester course at the senior-level in the Aerospace Engineering Department wing loading. In the second semester, teams of students worked together to build a larger aircraft from

269

Student Portal : Info For Faculty/Staff : FAQ : Announcements : Contact Us UCSC General Catalog Updates 2007-08  

E-Print Network [OSTI]

Catalog Updates 2007-08 The 2007-08 catalog updates are available on this web site. These updates include below. Quarterly updates to course and program information are also reflected in the Schedule of Classes and Military Affairs General Education Requirements Revised list of 2007-08 courses that fulfill general

California at Santa Cruz, University of

270

HOME NEWS SPORTS BUSINESS OPINIONS ENTERTAINMENT HEALTH TRAVEL INFO CLASSIFIED ADSLong Beach, CA, 12/21/2006 Advertisement  

E-Print Network [OSTI]

, 12/21/2006 Advertisement del.icio.us Digg Reddit YahooMyWeb Google What's this? L.B. Port pollution to be studied Researchers hope to find source of pollutants detected in nearby areas. By Kristopher Hanson agency are teaming up to capture and test the origin of tiny pollution particles floating around harbor

Valero-Cuevas, Francisco

271

postdoc:Postdoc Program:Career Fair:2013:Shipping Info_2013.docx Shipping Information and Display Setup  

E-Print Network [OSTI]

address: Los Alamos National Laboratory (LANL) Attn: Jeanette Gallegos/Mary Anne With Bikini Atoll Road

272

A new generation of marine turbine that can harness energy from the sea is being developed by Nautricity,  

E-Print Network [OSTI]

A new generation of marine turbine that can harness energy from the sea is being developed to develop the concept of this unique contra rotating tidal turbine (CoRMaT). The first fully functional conventional turbines, the CoRMaT design uses two rotors which turn in opposite directions, making it extremely

Mottram, Nigel

273

Designing a High Performance OpenSHMEM Implementation using Universal Common Communication Substrate as a Communication Middleware  

SciTech Connect (OSTI)

OpenSHMEM is an effort to standardize the well-known SHMEM parallel programming library. The project aims to produce an open-source and portable SHMEM API and is led by ORNL and UH. In this paper, we optimize the current OpenSHMEM reference implementa- tion, based on GASNet, to achieve higher performance characteristics. To achieve these desired performance characteristics, we have redesigned an important component of the OpenSHMEM implementation, the network layer, to leverage a low-level communication library designed for imple- menting parallel programming models called UCCS. In particular, UCCS provides an interface and semantics such as native atomic operations and remote memory operations to better support PGAS programming models, including OpenSHMEM. Through the use of microbenchmarks, we evaluate this new OpenSHMEM implementation on various network metrics, including the latency of point-to-point and collective operations. Furthermore, we compare the performance of our OpenSHMEM imple- mentation with the state-of-the-art SGI SHMEM. Our results show that the atomic operations of our OpenSHMEM implementation outperform SGI s SHMEM implementation by 3%. Its RMA operations outperform both SGI s SHMEM and the original OpenSHMEM reference implemen- tation by as much as 18% and 12% for gets, and as much as 83% and 53% for puts.

Welch, Donald A [ORNL] [ORNL; Shamis, Pavel [ORNL] [ORNL; Gorentla Venkata, Manjunath [ORNL] [ORNL; Poole, Stephen W [ORNL] [ORNL; Tony, Curtis [University of Houston, Houston] [University of Houston, Houston

2014-01-01T23:59:59.000Z

274

SLU, Box 58, SE-230 53Alnarp, Sverige tel: +46 (0)40-4150 00 Org.nr 202100-2817 info@slu.se  

E-Print Network [OSTI]

to such questions of sustainable urban development, for instance, when it comes to the importance of green areas continually threatened by building development. Conflicts over land use are expected to increase further sustainable development. The exchange of experiences with other key future research areas has thus far been

275

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

276

NCBI Handout Series | NCBI Overview | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov National Center for Biotechnology Information  

E-Print Network [OSTI]

, biochemists, computer scien- tists, mathematicians, research physi- cians, and structural biologists. The NCBI from thousands of biomedical journals. In November of 2011 the PubMed database enabled the searching of over 21 million citations and abstracts from over 27,600 national and international medical

Levin, Judith G.

277

G:\\Insurance\\WPS14-15\\Info\\Web\\Healthmain.Docx Rev 5-12-14 Medical College of Wisconsin Affiliated Hospitals  

E-Print Network [OSTI]

Subscriber" 2. Enter your Member # 3. Click "continue" and Start your Provider Search Or, Call WPS Customer a standardized template utilizing a uniform glossary of terms and can be used to compare this benefit plan to other benefit plans available to you. Note: Exact details and coverage are subject to the terms

278

Info sheet : Social and ethical standards and product labelling schemes Credible and accessible voluntary standards and certification schemes can be effective  

E-Print Network [OSTI]

developed the ICTI Care programme to promote ethical manufacturing in the toy industry supply chain development whereas RugMark concentrates the elimination of child labour in the rug-weaving industry in South and identified a number of specific activities and tools. www.gesi.org International Council of Toy Industries

279

05.09.2013, 2013_EnviroInfo_espinar_QC_full.doc An OGC Web Processing Service for assessing the quality of solar  

E-Print Network [OSTI]

or equivalently, means of global irradiance. Being the basis of decision for large investment or for maintenance, Frances hal-00858226,version1-5Sep2013 Author manuscript, published in "27th International Conference on Informatics for Environmental Protection, Hambourg : Germany (2013)" #12;05.09.2013, 2013_Enviro

Paris-Sud XI, Université de

280

Pacific Institute 654 13th Street, Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org  

E-Print Network [OSTI]

). Including air pollution as a screening criterion acknowledges the health impacts borne by Californians pollution and reducing public health impacts. Including air pollution as a screening criterion provides will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

SJSU Information Support Services Create Contracts for 12-Month Appointment info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

. Note Data about the position will populate. Term Enter the fall term of the current year in a four demonstrates how to create a contract for a 12-month appointment by entering effective dates that encompass hyperlink. 3. Click the CSU Contract Data hyperlink. The CSU Contract Data search page displays. 4. Click

Su, Xiao

282

SJSU Information Support Services Run Batch Contracts for Temporary Faculty info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

page displays. 5. Term: Use the lookup button to search the appropriate term. 6. Due Date: (optional data that exists in the system for the temporary faculty will appear on the Contract Appointment letter/Terms. 2. Click Batch Contracts for T. Faculty. The Batch Process for TF Contract search page displays. 3

Su, Xiao

283

SJSU Information Support Services Hire a Teaching Associate or Graduate Assistant info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

displays. 1. From the Main Menu, click the CSU ID Search hyperlink. 2. Enter any known search criteria. 3 Name Description Enter the Position Click the lookup icon to perform search, if unknown. When you click the tab or outside of the field, position data will populate. Term Enter term in a four-digit format

Su, Xiao

284

SJSU Information Support Services SR102: Basic Records Processing II info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

this option, skip step 11. The Enter Search Criteria page displays. 9. Enter the Course Subject-924-1530 Page 5 The Enter Search Criteria page displays. 11. Enter at least two criteria and then click. Once students are term activated and assigned a registration appointment time, they can enroll

Su, Xiao

285

SJSU Information Support Services Rehire a Part-Time Temporary Faculty, TA or GA info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

of the contract. Contract Desc Enter a name for the contract. Include the Last Name, Dept Name and Term. Example of the field, position data will populate. Term Enter term in a four-digit format. Example: 2054 = Fall 2005 if the person is a Late Start or Early Termination. (Enter L for Late Start. Enter E for Early Term). Number

Su, Xiao

286

Destination Palo Alto -Lodging http://www.destinationpaloalto.com/pages/lodging.php?visitor_info_id=8[7/27/2011 10:00:32 AM  

E-Print Network [OSTI]

, restaurant, bar Complimentary: parking, Internet in guest rooms $99-$399 AAA Each furnished guestroom has

Quake, Stephen R.

287

LASLO EVERS | Change Password | Change User Info | CiteTrack Alerts | Subscription Help | Sign Out Editors' Choice: Highlights of the recent literature  

E-Print Network [OSTI]

-barometer to reduce noise from atmospheric wind. Evers and Haak report detection on 8 November 1999 of a discrete 0 that such propellers or turbines can be integrated into more complex devices. As an example, they prepare a light

Evers, Läslo G.

288

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 14th Annual ARC Conference  

E-Print Network [OSTI]

Eaton Corporation Peter J. Savagian Director of Hybrid Powertrain Engineering GM Powertrain, General Motors Corporation Rani Finstad Global PT Director Manufacturing Design Simulation & Support, General Motors Corporation Question and Answer Session 11:45 - 1:15pm Lunch 14th Annual ARC Conference - Day 1

Papalambros, Panos

289

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 15th Annual ARC Conference  

E-Print Network [OSTI]

. Army TARDEC Kevin D. Beaty Business Unit Manager ­ Eaton Corporation Question and Answer Panel Session

Papalambros, Panos

290

In Proceedings of the IEEE Symposium on Information Visualization 2000 (InfoVis 2000). 167-172. Salt Lake City, Utah: IEEE Creativity, Complexity, and Precision: Information  

E-Print Network [OSTI]

of building standards or plant specifications; technical detail drawings; rough sketches and concept drawings, ecologists, or manufacturing specialists; photographs of, for example, the existing surroundings for a new Visualization. The World Wide Web has been a spur to innovative imagination with a view to visualizing

Mogensen, Preben Holst

291

Suggested Search Terms Try searching a few of the phrases provided in PsycINFO and ABI/INFORM, and use appropriate  

E-Print Network [OSTI]

fit and Empirical organizational change and resistance learning organization organizational learning organizational learning job satisfaction motivation and employees personality traits and job

Abolmaesumi, Purang

292

MyUCSC : Info For Faculty/Staff : FAQ : Announcements : Contact Us Publications and Scheduling : Enrollment : Fees : Transcripts : Special Programs : Graduation  

E-Print Network [OSTI]

Educational Opportunity Programs (EOP) Academic Excellence Program Multicultural Engineering Program (MEP to the detailed discussion of each program, including its courses, later in the catalog. Undergraduate Education : Enrollment : Fees : Transcripts : Special Programs : Graduation UCSC General Catalog Welcome Introducing UCSC

California at Santa Cruz, University of

293

-A monthly listing of teaching & learning news and events, published by the Centre for Leadership in Learning (CLL) -Featured Events & Info  

E-Print Network [OSTI]

progresses. __________________ New Book - Taking Stock: Research on Teaching and Learning in Higher Education symposium that was held in the spring of 2008. The symposium brought together leading experts to "take stock

Haykin, Simon

294

HowTo-update-MyAccess-personal-info.docx:06/19/2012 1 of 2 How to update your personal information in MyAccess ...  

E-Print Network [OSTI]

. Below are a few steps that will help you. 1. go to web site: http://myaccess.wvu.edu/ - click on "Login

Mohaghegh, Shahab

295

Source: U.S. Energy Information Administration, based on DrillingInfo Inc., New York State Geological Survey, Ohio State Geological Survey, Pennsylvania Bureau of  

U.S. Energy Information Administration (EIA) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia:FAQ <Information Administration (EIA) 10 MECS Survey Data9c : U.S. RegionalAndyFuture ofSetting-Source:

296

NASA Space Craft Contest -Artist Info -2D Original, Pg. 1 Information includes title of artwork, artist name and Etsy shop  

E-Print Network [OSTI]

ROBOTS Dylan Strzynski dylanS.etsy.com Orrery Alisha Gould alishagould.etsy.com Moon Tile Kelly Cook horsedrawncarriage.etsy.com Space Odyssey Stained Glass Alla Sharkova FleetingStillness.etsy.com Solar System Tara

297

Visit our website at: https://info.ornl.gov/sites/sbpo Acquisition Management Services Director: LeAnne Stribley 865-576-0274  

E-Print Network [OSTI]

541990 May 2014* *Qualification Criteria: Must have experience supporting SLD Program 2014 Aug Stacey No $25M 541990 May 2014* *Qualification Criteria: Must have experience supporting SLD Program 2014 Aug Stacey Johnson 865-576-0718 johnsonsl@ornl.gov Fabricated Equipment CS Structure Tie Plates WBS 1

298

Resilience by design for cloud services  

E-Print Network [OSTI]

adapted from the industry-standard technique known as Failure Mode and Effects Analysis (FMEA)1 the industry-standard process known as FMEA have been adapted to create a Resilience Modeling and Analysis (RMA

Chaudhuri, Surajit

299

MA 16600  

E-Print Network [OSTI]

Course Info. Syllabus (Ground Rules) Assignment Sheet (Rev. 3/6) Grading Scheme. Resources. Past Exam Archive Supplemental Materials. Exam Info.

300

V I R G I N I A P O L Y T E C H N I C I N S T I T U T E A N D S T A T E U N I V E R S I T Y A n e qua l op portu ni ty , a ffi rma ti ve ac t io n i ns ti tu tio n  

E-Print Network [OSTI]

Science and Management · Natural Resources and Conservation Chemistry · Chemistry · Polymer Chemistry Classifications Agricultural Sciences · Animal Sciences · Food Science and Technology · Soil Sciences · Agriculture, Agriculture Operations and Related Sciences · Natural Resources/Conservation · Natural Resources

Liskiewicz, Maciej

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

V I R G I N I A P O L Y T E C H N I C I N S T I T U T E A N D S T A T E U N I V E R S I T Y An e q u al o p p or t un it y, af fi rma t iv e ac ti o n in st it u ti on  

E-Print Network [OSTI]

of Risk Management has responsibility to administer the property, general liability, automobile, boiler. These programs do not relate to personal employee benefits and medical/life insurance coverage, which, please contact Risk Management. Size restrictions for truck rentals may apply. Insurance for property

Buehrer, R. Michael

302

08853010/$25.00 2010 IEEE 1673IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 57, no. 7, jUly 2010  

E-Print Network [OSTI]

. Introduction Minimizing the size of electrical servo-drives used in small-scale actuation has become for the dynamics of a thin piezoelectric plate in an electric field is presented. This PDE model is discretized via of an intuitive inter- pretation in terms of electrical circuits, may be a better choice in control situations. I

Pugh, Mary

303

ECEEE 2011 SUMMER STUDY EnERgY EffiCiEnCY fiRST: ThE foUnDaTion of a low-CaRbon SoCiETY 2037 The significance of difference  

E-Print Network [OSTI]

The significance of difference: Understanding variation in household energy consumption Janine Morley School@comp.lancs.ac.uk Keywords socio-technical, energy behaviour, interaction, consumption dynamics, demand patterns, domestic energy, electricity use, households, end-use consumption, practices, practice theory Abstract Studies

Hazas, Mike

304

EIHereu as second class matter at New York, N. Y., Jail. 7. 1928. Evol\\1tion P\\1b!. Corp., 96-Sth Ave., N. Y. GREAT SPIRAL STAR-CLOUD IN ANDROMEDA  

E-Print Network [OSTI]

the universe. The first scientific theory of the origin of our solar system goes back to the philosophers Kant was first conceived, it was thought to have two kinds of evidence in its favor, first, features in our solar attraction of each particle for every other. Thus the outermost planet was first formed. In the same way

305

08853010/$25.00 2009 IEEE 213IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 56, no. 1, JanUary 2009  

E-Print Network [OSTI]

. Introduction quarter-wavelength acoustic matching layers be- tween the piezoelectric ceramic to obtain a homogeneous composite thin matching layer with high powder loading using submicron powders pro- cess using metal particles dispersed in a polymer matrix cannot be used for the fabrication

Cao, Wenwu

306

08853010/$25.00 2008 IEEE 2312 IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 55, no. 10, ocTobEr 2008  

E-Print Network [OSTI]

challenge to supply energy for the electronic devices embedded inside sealed vessels, which are widely used harvesters [2][4]; the other is to convey power into sealed solid metallic structures without dam- aging energy from outer sourc- es and transforms it into mechanical vibrations through the direct

Wang, Ji

307

TECHMRT The Center for Multidisciplinary Research in Transportation (TechMRT) at Texas Tech University is dedicated to serving as a focal point for communica-tion between Texas Tech University and various transportation research funding organizations and  

E-Print Network [OSTI]

TECHMRT The Center for Multidisciplinary Research in Transportation (TechMRT) at Texas Tech and various transportation research funding organizations and programs. A genuinely multidisciplinary facility, Department of Plant and Soil Science, Department of Landscape Architecture, the TTU Library

Gelfond, Michael

309

e-mail: inikol@aueb.gr : 210 8203121  

E-Print Network [OSTI]

International Airport, Schneider Electric, Siemens, TOYTA, Citibank, Info ­ Quest, HSBC, Direct Services

Chatziantoniou, Damianos

310

31 JANUARY 2003 VOL 299 SCIENCE www.sciencemag.org660 CREDIT:WESTANDPACKER  

E-Print Network [OSTI]

melanin production and nutri- tion. Melanin synthesis depends on the oxida- tion of tyrosine by tyrosinase

McGraw, Kevin J.

311

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 2  

SciTech Connect (OSTI)

During TVA's visit and survey of RMA's GB facility, sample points were identified (Table A-1). The sample points initially identified were from Buildings 1501, 1503, 1603, 1506, 1601, 1601A, and 1602. Piping isometrics were produced for each sample point identified and are shown in Appendix B. After a careful review of each sample point and discussions with RMA personnel, 67 of the original sample points were eliminated. The sample points eliminated consisted of all ventilation points and process equipment/piping that is open to the atmosphere.

Not Available

1988-10-01T23:59:59.000Z

312

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network [OSTI]

> ayn> üniversiteden 1953'te ald>. 1960'da Ege ?niversitesi T>p Fakültesi'nde "yabanc> ma- tematik ve- l>flt>. Ege ?niversitesi'nde doçent (1965) ve profe- sör (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde görev ald>. 1997

Sertöz, Ali Sinan

313

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network [OSTI]

, conduit metaphor, representation, context, communications theory, cognitive science, hermeneutics of humanistic inquiry as Epistemology, Phenomenology, Semiotics, Hermeneutics, and Aesthetics. This dialogue

314

Laboratoire d'InfoRmatique en Image et Systmes d'information LIRIS UMR 5205 CNRS/INSA de Lyon/Universit Claude Bernard Lyon 1/Universit Lumire Lyon 2/Ecole Centrale de Lyon  

E-Print Network [OSTI]

! Ververidis et al (2004, 2005): Anger, happiness, neutral, sadness, surprise Pitch, spectrum and energy six" Anger, Happiness, Fear, Neutral, Sadness, Surprise... !Dimensional theory [Wie05a] 2 or 3 Dimensional emotions: helps in building classifiers 5 #12;State of the art: Acoustic correlates ! Emotion may

Dellandréa, Emmanuel

315

Universit degli Studi di Roma "La Sapienza": menugrave; http://php4.cineca.it/lasapienza/menu.php?info=... 1 of 1 04/22/2004 12:32 PM  

E-Print Network [OSTI]

nascita 07/07/1957 Facoltà SCIENZE MATEMATICHE FISICHE e NATURALI Dip. FISICA Indirizzo Piazzale Aldo Moro. FISICA 2. MARIANI Carlo PO SCIENZE MATEMATICHE FISICHE e NATURALI DIP. FISICA 3. RICCI TERSENGHI Federico RU SCIENZE MATEMATICHE FISICHE e NATURALI DIP. FISICA Altro personale dell'Università di Roma "La

Roma "La Sapienza", Università di

316

PsycINFO is one of three databases on the APA PsycNET platform: PsycARTICLES A full-text database of 80+ peer-reviewed journals from the  

E-Print Network [OSTI]

the search boxes. Enter the author's last name, a space, and their first name, or the initial e.g. Griffin in a specific journal, select the Journals Lookup option, beneath the search boxes. Enter the words of a journal to Search. TERM FINDER SEARCH You can search for documents using one or more of the index terms

Rzepa, Henry S.

317

Cet article est disponible en ligne l'adresse : http://www.cairn.info/article.php?ID_REVUE=ANNA&ID_NUMPUBLIE=ANNA_595&ID_ARTICLE=ANNA_595_0971  

E-Print Network [OSTI]

. c.) et ya¯sa¯ lorsqu'il s'agit de sources en persan et en arabe, car c'est sous cette forme que le terme apparaît le plus souvent. Pour la translittération des mots arabes et persans, nous suivons le

Boyer, Edmond

318

01.07.2013, 2013_EnviroInfo_wald_hc1_short.doc HelioClim-1: 21-years of daily values in solar radiation in one-click  

E-Print Network [OSTI]

manuscript, published in "27th International Conference on Informatics for Environmental Protection, Hambourg as the main use of these data relates to investment decision in solar plants and selection of appropriate

Paris-Sud XI, Université de

319

This paper was published in Optics InfoBase and is made available as an electronic reprint with the permission of OSA. The paper can be found at the  

E-Print Network [OSTI]

to classify the elements of a scene is a convenient and efficient solution to many image-processing tasks daylight. Estimates of the mean number of distinguishable colored surfaces were

Foster, David H.

320

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BESK/VISIT: LILLA FRESCATIVGEN 4A, STOCKHOLM, INFO@KVA.SE HTTP://KVA.SE  

E-Print Network [OSTI]

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BES?K by Patricia K. Kuhl, University of Washington, Seattle, WA, USA and Hon. Dr., Stockholm University, Sweden will be followed by a panel discussion including Hugo Lagercrantz, Karolinska Institutet, Solna, Sweden, Andrew

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network [OSTI]

to Enrich Co-Presence Information." In: Adjunct Proceedings of the Seventh International Conference to Enrich Co-Presence Information Bibliographic Reference: Rahul Nair and Marc Davis. "Bluetooth Pooling on Ubiquitous Computing (UbiComp 2005) in Tokyo, Japan, 2005. #12;Bluetooth Pooling to Enrich Co

322

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network [OSTI]

Garage Cinema Research Berkeley Institute of Design Computer Science Division University of California at Berkeley Berkeley, CA 94720 anar@cs.berkeley.edu Marc Davis Garage Cinema Research School of Information

323

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network [OSTI]

Science Division University of California at Berkeley anar@cs.berkeley.edu Marc Davis Garage Cinema Capture and Folk Computing Ana Ramrez Garage Cinema Research Group for User Interface Research Computer

324

The Engineer Online -[News: engineering news, engineering info, lat... http://www.e4engineering.com/Articles/294518/Power+though+goo.htm 1 of 2 5/12/2006 2:29 PM  

E-Print Network [OSTI]

though goo Published: 11 May 2006 07:00 AM Industry Channel: Electrical & Electronics Source of the University of Massachusetts Amherst, suggests that efficient technologies for generating electricity at the meeting of the Electrochemical Society in Denver. A typical fuel cell converts fuels to electricity

Lovley, Derek

325

Lindab Buildings s.r.o. | Kojetnsk 71 | CZ-75002 Perov Tel.: +420 581 250 222 | E-mail: info.cz@astron.biz | Internet: www.astron.biz  

E-Print Network [OSTI]

: Opportunity to work for a successful international company Professional growth / carem opportunities

Krupka, Michal

326

Lindab Buildings s.r.o. | Kojetnsk 71 | CZ-75002 Perov Tel.: +420 581 250 222 | E-mail: info.cz@astron.biz | Internet: www.astron.biz  

E-Print Network [OSTI]

as advantage We offer: Opportunity to work for a successful international company Professional growth / carem

Krupka, Michal

327

APS Beamline 6-ID-D  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

MM-Group Home MMG Advisory Committees 6-ID-D Home Recent Publications Beamline Info Optics Instrumentation Software User Info Beamline 6-ID-D Beamline 6-ID-D is operated by the...

328

COMMUNITY CHOICE AGGREGATION PILOT PROJECT  

E-Print Network [OSTI]

GOVERNMENT AFFAIRS REPRESENTATIVE]; Under SDG&E's tariff Schedule CCA-INFO, a local government considering under tariff Schedule CCA-INFO, section SPECIAL CONDITIONS, subsection 7, Confidential Information

329

The Case for an Informed Path Selection  

E-Print Network [OSTI]

Université catholique de Louvain IP Networking Lab - http://inl.info.ucl.ac.be April 24th, 2008 1 #12 of IDIPS is available - http://inl.info.ucl.ac.be 14 #12;15 #12;

Bonaventure, Olivier

330

O. Bonaventure, 2007ISP-model 1 Issues in modelling ISP networks  

E-Print Network [OSTI]

François Bruno Quoitin Université catholique de Louvain Louvain-la-Neuve, Belgium http://inl, available form http://inl.info.ucl.ac.be Totem toolbox : http://totem.info.ucl.ac.b

Bonaventure, Olivier

331

Experimenting with Multipath TCP Sebastien Barre*, Olivier Bonaventure*  

E-Print Network [OSTI]

selection heuristics To download MPTCP for Linux: http://inl.info.ucl.ac.be/mptcp Acknowledegments in this document. http://inl.info.ucl.ac.be/mptcp sebastien.barre@uclouvain.be #12;

Bonaventure, Olivier

332

E-Print Network 3.0 - abstracts search period Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the period you wish to search. 12;2 PsycINFO user guide September 2002 Enter your search term or terms... PsycINFO user guide citations summaries abstracts journal...

333

Rock Chalk Report, May 15, 2013  

E-Print Network [OSTI]

in the process . . . Read more ? Baseball NCAA Championships May 22-26 Oklahoma City, Okla. Event Info ? Kansas Football Preview Party May 14-22 St. Louis, Chicago, Kansas Event Info ? Track NCAA West Preliminary May 23...

2013-05-15T23:59:59.000Z

334

SCHOLARSHIP AND FELLOWSHIP BULLETIN ACADEMIC TRAINING FELLOWSHIP (ATF)  

E-Print Network [OSTI]

year, not renewable. more info WAYNE BROWN SCHOLARSHIP The Wayne Brown Scholarship is awarded Award duration: one year, not renewable More info CAMPBELL FELLOWSHIP The Campbell Fellowship is awarded

van den Berg, Jur

335

Presented by Steven J. Gitomer  

E-Print Network [OSTI]

R, GOALI, CAREER, PIRE, CREATIV, SAVI, Mid Scale [see NSF web site for more info ... www.nsf.gov] #12; HED NSF web site for more info www.nsf.gov #12; MRI Major Research Infrastructure NSF 1337831 - MRI

336

CONTINUING AND PROFESSIONAL EDUCATION Business and  

E-Print Network [OSTI]

cover FREE CERTIFICATE PROGRAM INFO SESSIONS Find out how continuing education through UC Davis.................................................................................................. 12 ENERGY RESOURCE m

Ferrara, Katherine W.

337

Charles Sturt University CRICOS 00005F (NSW), 01947G (VIC) and 02960B (ACT) International Agents  

E-Print Network [OSTI]

Consultancy (AEC) Hong Kong info@aecl.com.hk www.aecl.com.hk AIS Education Centre Australia, South Korea

Thomas, Richard C.

338

MA 26100  

E-Print Network [OSTI]

Course Info. Syllabus (Ground Rules) Emergency Preparedness Course Calendar Assignment Sheet. Resources. Past Exam Archive; Including completed...

339

MA 16100  

E-Print Network [OSTI]

MA 16100, Spring 2015. Plane Analytic Geometry And Calculus I. Course Info. Syllabus Assignment Sheet Emergency Prepardness Daily Course Calendar

340

Taubman College Media Center  

E-Print Network [OSTI]

,unsecureditemsmaycomeoff,ortear/ damagethedocumentbeingscanned. Self-servelargeformatscanning-Coming soon 3D PRINTING Coming soon-more info to follow EQUIPMENT

Papalambros, Panos

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

pvmfaddhost( pvmfdelhost(  

E-Print Network [OSTI]

, nitem, stride, info ) Pack/unpack and Reduce type options STRING 0 REAL4 4 BYTE1 1 COMPLEX8 5 INTEGER2 2 pvmfbcast( group, msgtag, info ) call pvmfreduce( op, xp, nitem, type, tag, group, root, info ) op options pvmfsetrbuf( bufid, oldbuf ) call pvmfinitsend( encoding, bufid ) Encoding options MEANING PvmDataDefault 0

342

CMAD IV 11/14/96 Information Security  

E-Print Network [OSTI]

utilities, power pools, vendors etc.. #12;CMAD IV 11/14/96 #12; #12; GridCo LineCo PoolCo Energy Merchant INFO INFO INFO $ $ $ PWR PWR PWR #12;CMAD IV 11/14/96 "Future" Is At Hand · Federal Energy Regulatory protection and audit practices inadequate. · Internal priorities limiting attention to security concerns

California at Davis, University of

343

Between Text and Sect: Early Nineteenth Century Shifts in the Theology of Ram  

E-Print Network [OSTI]

manda manda baju b?ta basa sune su n?cai mora// damakatahai kali agha yuta loga/ kahe sune dou nase rase r?ma rasaout for special favor: kahe sune dou u?he parih?r? ko lena/

Paramasivan, Vasudha

2010-01-01T23:59:59.000Z

344

xiaoye@nersc.gov demmel@cs.berkeley.edu  

E-Print Network [OSTI]

Ajj endif 5. Solve A \\Delta x = b using the L and U factors, followed by iterative refinement [Arioli log n) Page 6 #12; Iterative Refinement ffl Newton's method applied to f (x) = b \\Gamma A \\Delta x, ex11, fidapm11, garon2, graham1, inv­extrusion­1, lnsp3937, lns 3937, mixing­tank, raefsky3, rma10

Li, Xiaoye Sherry

345

(mobile ) (xml ) 2001 12 ------  

E-Print Network [OSTI]

Act HIPAA 21CFR 11 RMA DOD 5015.2-STD - Sarbanes-Oxley Gramm-Leach-Bliley #12;(Gramm HIPAA Protected Health Information PHI PHI PHI PHI HIPAA PHI HIPAA #12; HIPAA 25 10 1.2.4. FDA FDA (Food and Drug Administration) 21 CFR (Code of Federal Regulations) Part 11

346

Prof. Dr. Metin Heper (Siyaset Bilimi Blm), doktoras>n> 1971'de Syracuse  

E-Print Network [OSTI]

üniversitelerinde araflt>rmac>l>k yapm>flt>r. Bilkent ?niversitesi'nde >rma Müdürlü¤ü'nde dan>flmanl>k, Michigan State ile Ball State üniversitelerinde ö¤retim üyeli¤i yapm>fl olan Dr. Aydo¤an, Bilkent ?niversitesi'nde ¤> ile

Gürel, Levent

347

Folk Song 3  

E-Print Network [OSTI]

Open???? ?????????? Notes and context (include reference to any related documentation, such as photographs) ?????? ????????????????? ???????????????? 1????????????????????????????? 2??????????????????????????????? 3???????????????????????????? 4??????... ??????????????????????? ????????????????? ???????????????? 5??????????????????????????? 6?????????????????????????????????? 7?????????????????????????? Wylie O ye/ ye zhang nga la la la mo/ gdong nga glu ngas len/ 1'brug sing sing rma rgyal sbom nas grags// 2char sam...

Tshe ring bsam 'grub

348

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records  

E-Print Network [OSTI]

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records for canola agent will help you request protection from RMA (Risk Manage- ment Agency) to transfer a canola crop

Goodman, Robert M.

349

Survival and mammalian predation of Rio Grande Turkeys on the Edwards Plateau, Texas.  

E-Print Network [OSTI]

survival results during 2002 were counterintuitive with turkey trend data. Scent-station transects were established on non-paved ranch roads within study regions. Scent-station indices revealed higher (H = 19.653, P ? 0.001) RMA of opossum (Didelphis...

Willsey, Beau Judson

2004-09-30T23:59:59.000Z

351

College of Engineering Oregon State University, 101 Covell Hall, Corvallis, Oregon 97331-2409  

E-Print Network [OSTI]

-737-3101 or 1-877-257-5182 | F 541-737-1805 | E info@engr.oregonstate.edu | http://engr.oregonstate.edu Follow

Escher, Christine

352

Bioengineering Undergraduate Curriculum Bioengineering Health Care Informatics (BHI)  

E-Print Network [OSTI]

Bioengineering Undergraduate Curriculum Bioengineering Health Care Informatics (BHI) Semester 1 Health Data Challenges 3 STAT 344 Prob & Statistics for Engr. 3 HAP 360 Intro to Healthcare Info. Systems

353

Abatement of Air Pollution: Control of Carbon Dioxide Emissions...  

Broader source: Energy.gov (indexed) [DOE]

Savings Category Fuel Cells Photovoltaics Program Info State Connecticut Program Type Environmental Regulations Provider Department of Energy and Environmental Protection Any...

354

Air Pollution Control Regulations: No.27 - Control of Nitrogen...  

Broader source: Energy.gov (indexed) [DOE]

Commercial Industrial Investor-Owned Utility MunicipalPublic Utility Rural Electric Cooperative Utility Program Info State Rhode Island Program Type Environmental Regulations...

355

Air Pollution Control Regulations: No. 6 - Continuous Emissions...  

Broader source: Energy.gov (indexed) [DOE]

Commercial Industrial Investor-Owned Utility MunicipalPublic Utility Rural Electric Cooperative Utility Program Info State Rhode Island Program Type Environmental Regulations...

356

Air Pollution Control Regulations: No. 9 - Air Pollution Control...  

Broader source: Energy.gov (indexed) [DOE]

Fed. Government Industrial Institutional Investor-Owned Utility Local Government MunicipalPublic Utility Rural Electric Cooperative Tribal Government Utility Program Info State...

357

Air Pollution Control Regulations: No. 41 - Nox Budget Trading...  

Broader source: Energy.gov (indexed) [DOE]

Savings Category Fuel Cells Program Info State Rhode Island Program Type Environmental Regulations Provider Department of Environmental Management These regulations establish a...

358

Abatement of Air Pollution: Control of Particulate Matter and...  

Broader source: Energy.gov (indexed) [DOE]

Savings Category Fuel Cells Photovoltaics Program Info State Connecticut Program Type Environmental Regulations Provider Department of Energy and Environmental Protection These...

359

Alliant Energy Interstate Power and Light (Electric) - Business...  

Broader source: Energy.gov (indexed) [DOE]

Multi-Family Residential Nonprofit State Government Savings Category Heat Pumps Lighting Maximum Rebate See program web site Program Info State Iowa Program Type Utility Rebate...

360

Alliant Energy Interstate Power and Light (Electric)- Residential...  

Broader source: Energy.gov (indexed) [DOE]

Construction Residential Savings Category Lighting Heat Pumps Maximum Rebate See program web site Program Info State Minnesota Program Type Utility Rebate Program Rebate Amount...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Alliant Energy Interstate Power and Light (Electric) - Residential...  

Broader source: Energy.gov (indexed) [DOE]

Multi-Family Residential Residential Savings Category Heat Pumps Lighting Program Info State Iowa Program Type Utility Rebate Program Rebate Amount Central Air Conditioners: 100 -...

362

Argonne OutLoud: "Computation, Big Data, and the Future of Cities...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Videos Lab-Corps Program info. session - Jan. 20, 2015 Employee Spotlight: Ali Erdemir Argonne OutLoud public lecture series: "Invisible Influence: A Bacterial Guide to Your...

363

Cheap acoustics as a learning methodology London South Bank University, FESBE, Borough Road, SE1 0AA London, UK  

E-Print Network [OSTI]

, Revit:Ecotect, Google Sketchup, ARTA, and winMLS. Through info4education.co.uk the students have access

Paris-Sud XI, Université de

364

V-149: Microsoft Internet Explorer Object Access Bug Lets Remote...  

Broader source: Energy.gov (indexed) [DOE]

CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary...

365

3-D printed Shelby Cobra highlights ORNL R&D at Detroit Auto...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and vehicle technologies including displays on energy absorption, composite tooling, printed power electronics and connected vehicles. For more info, visit http:...

366

UWE Bristol News and Media Coverage w/c 22 April 2013 Press Releases  

E-Print Network [OSTI]

://info.uwe.ac.uk/news/UWENews/news.aspx?id=2530 UWE Bristol student wins E.ON Engineering Undergraduate of the Year Award http

Aickelin, Uwe

367

E-Print Network 3.0 - algimantas gradeckas lilija Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sciences and Ecology 6 Werner Lehne, 10.5.2010 StudienbroInfo Mai2010 Summary: .Sc.M.Sc.Dipl. Wirtschaftsmathematik: StudienkoordinatorinStudienfachberaterin...

368

Achieving Total Employee Engagement in Energy Efficiency  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

recognized with InfoWorld Green 15 award - Named one of Uptime Institute's 2009 "Global Green 100 Environmental, Health and Safety (EHS) - Earth Day events, employee contests...

369

E-Print Network 3.0 - analysis code trac Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

University of - Advanced Traffic and Logistics Algorithms and Systems Research Center (ATLAS) Collection: Energy Storage, Conversion and Utilization 24 InfoTraffic Teaching...

370

MA 15300  

E-Print Network [OSTI]

PowerPoints, Video Lessons and Outlines Supplemental Instruction Info Tutoring/Assistance Opportunities Chapter 1 of Textbook Even Answers to Book...

371

Aquatic Supplement Hood River Subbasin  

E-Print Network [OSTI]

.7 (10 cfs) 50 powerhouse discharge river mile 4.51 (20 cfs) Upper Lenz or Odell cr no info Davis water

372

MSTC - Web Development Team  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Web Maintenance Microsystems Home Custom Microsystems Solutions Microsystems R&D Services Capabilities and Technologies Facilities Trusted Microsystems General Info About Us Awards...

373

E-Print Network 3.0 - agilent dna microarrays Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Microarray experiments aim Source: Laforest, Frdrique - Laboratoire d'InfoRmatique en Image et Systmes d'information, Universit Claude Bernard (Lyon I) Collection: Computer...

374

Scheduling in Multiprocess Systems  

E-Print Network [OSTI]

In RTSS, Lisbon, Portugal, [46] Facebook. Facebook. http://www.facebook.com. [47] Facebook.Facebook info.php? statistics, 2011. statistics. http://

Dou, Ji Adam

2011-01-01T23:59:59.000Z

375

Alliant Energy Interstate Power and Light (Electric) - Business...  

Broader source: Energy.gov (indexed) [DOE]

State Government Savings Category Heat Pumps Lighting Maximum Rebate See program web site Program Info State Minnesota Program Type Utility Rebate Program Rebate Amount New...

376

Alliant Energy Interstate Power and Light - Residential Renewable...  

Broader source: Energy.gov (indexed) [DOE]

Residential Savings Category Photovoltaics Solar Water Heat Maximum Rebate Solar Thermal Water Heater: 750 Program Info State Iowa Program Type Utility Rebate Program Rebate...

377

APPENDIX A:  

National Nuclear Security Administration (NNSA)

Watson Submitted to Sandia Site Office, Gorn, Caughey Info Copy Only Albuquerque - Local Air Pollution Control RegulationsAir Permits No Change - Report is sent through the...

378

E-Print Network 3.0 - air pollutants occupational Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

info@pacinst.org www.pacinst.org Summary: will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific......

379

Department of Mathematics: Course Page  

E-Print Network [OSTI]

Course Info. Ground Rules Syllabus. Resources. Past Exam Archive. Assignments. WebAssign Login WebAssign Help Connection Errors. Course...

380

E-Print Network 3.0 - advance planning briefing Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(NSF InfoBrief, 2006) The World is Flat: A Brief History of the Twenty... -first Century, Thomas L. Freidman (2006) Plans for Postdoctoral Research Appointments ......

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

STOCHASTIC ION HEATING BY A PERPENDICULARLY PROPAGATING ELECTROSTATIC WAVE  

E-Print Network [OSTI]

Plasma Research Report , PRR 76/24 July 1976 Link: http://charles.karney.info/biblio/karney77c.html #12

Karney, Charles

382

Microsoft PowerPoint - 6_Andy IMboden_Presentation to 2013 NMMSS...  

National Nuclear Security Administration (NNSA)

Impacts Path Forward Opportunities for Participation Contact Info and Resources 2 Waste Confidence Generic "Findings" on Spent Fuel Storage and Repository...

383

E-Print Network 3.0 - activation state insights Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

- ment the state of the visualization at the time an insight occurs. Of course, an exploration process... Evaluating an InfoVis Technique Using Insight Reports Markus...

384

--No Title--  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Missouri and University of Tennessee have identified the genes required for bacterial mercury methylation. Image by Thomas Splettstoesser info@scistyle.com Researchers from Oak...

385

applied information sciences: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Berlin Heidelberg 2011 info.scichina.com www Xia, Xiang-Gen 5 Master of Science Applied Physics Engineering Websites Summary: Master of Science Applied Physics Programme Guide...

386

E-Print Network 3.0 - autothermal biomass gasification Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Juli 2003 Seite 1 Biomasse Info-Zentrum Biomass Information Centre Technologies... for small scale Biomass CHP-Plants - an actual survey Risoe, ... Source: Ris National...

387

E-Print Network 3.0 - afb biomass gasification Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Juli 2003 Seite 1 Biomasse Info-Zentrum Biomass Information Centre Technologies... for small scale Biomass CHP-Plants - an actual survey Risoe, ... Source: Ris National...

388

STI_Announcement _Web_Services_Manual_2.0.pdf | OSTI, US Dept...  

Office of Scientific and Technical Information (OSTI)

STIAnnouncement WebServicesManual2.0.pdf Document Info Available Downloads for this Document: applicationpdf icon STIAnnouncement WebServicesManual2.00...

389

AN241.1web_ service.pdf | OSTI, US Dept of Energy, Office of...  

Office of Scientific and Technical Information (OSTI)

.1web service.pdf Document Description OSTI's STI Announcement Web Service for 241.1 Information June 2013 Document Info Available Downloads for this Document: applicationpdf...

390

Stoner LBNL's AN 241 1 Web Service Experience.pdf | OSTI, US...  

Office of Scientific and Technical Information (OSTI)

Stoner LBNL's AN 241 1 Web Service Experience.pdf Document Description Document Info Available Downloads for this Document: applicationpdf icon Stoner LBNL's AN 241 1 Web Service...

391

Fron%ers in Biological Sciences Seminar Series  

E-Print Network [OSTI]

Lakes Bioenergy. More info? See http://www.bact.wisc.edu/faculty.php?init=TJD&show=PEP/ https://www.glbrc

392

Sedimentology and environments of deposition of the wildcat group, Northern California  

E-Print Network [OSTI]

SEDIMENTOLOGY AND ENVIRONMENTS OF DEPOSITION OF THE WILDCAT GROUP, NORTHERN CALIFORNIA A Thesis by JAMES ALBERT BONDS Submitted to the Graduate College of Texas A8M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE August 1983 Major Subject: Geology SEDIMENTOLOGY AND ENVIRONMENTS OF DEPOSITION OF THE WILDCAT GROUP, NORTHERN CALIFORNIA A Thesis by JAMES ALBERT BONDS Approved as to style and content by: r. azzu o ' (Chai rma of Committee...

Bonds, James Albert

1983-01-01T23:59:59.000Z

394

05/29/2007 09:55 AMScientist hopes Oregon will catch the wave Page 1 of 6http://www.dailyastorian.info/main.asp?SectionID=2&SubSectionID=398&ArticleID=42662&TM=33888.27  

E-Print Network [OSTI]

. With world energy consumption three times what is was in 1970, new forms of energy are clearly needed, said's untapped energy could be harnessed, it would be enough to supply the entire world with power. ALEX PAJUNAS of ocean energy that is enough to supply the entire world's energy needs," she said. The power of waves

Wright, Dawn Jeannine

395

Z25 Adaptive and Mobile Systems Dr. Cecilia Mascolo  

E-Print Network [OSTI]

to log (eg BlueAware and many others). A basestation would allow the transmission of contacts logged with 3 states: home, work, elsewhere · Use data from bluetooth, cell towers and temportal info collected of position) #12;4 Accurate Location · Difficult to achieve accurate location info using cell towers only

Karp, Brad

396

A.A. 2014/2015 L-30 Fisica  

E-Print Network [OSTI]

A.A. 2014/2015 L-30 Fisica Info Generali Presentazione del Corso INFO Generali Classe L-30 Fisica ed Astronomia Programmazione locale Posti: 120 Sede del corso via Santa Sofia 64 95123 ­ CATANIA laurea in Fisica (Classe L-30 delle lauree in SCIENZE E TECNOLOGIE FISICHE) dell'Università degli Studi

Bella, Giampaolo

397

A.A. 2014/2015 LM-17 Fisica  

E-Print Network [OSTI]

A.A. 2014/2015 LM-17 Fisica Info Generali Presentazione del Corso INFO Generali Classe LM-17 Fisica Nome inglese Physics Lingua in cui si tiene il corso italiano Indirizzo internet del corso di gestione del corso di studio Consiglio di corso di studio Struttura didattica di riferimento Fisica ed

Bella, Giampaolo

398

Virginia Tech Services Student Legal Services  

E-Print Network [OSTI]

)231-6437 Utility Info:www.vtes.vt.edu A complete list of utility numbers can be found at www(231)2603 www.dining.vt.edu Family Support Info: A list of childcare options in the area can be found at: www)961-1185 Check the website for schedules and maps: www.btransit.org Utilities Local Newspaper Licenses & Decals

Buehrer, R. Michael

399

Getting Started Advanced Search for Funding Opportunities  

E-Print Network [OSTI]

Getting Started Advanced Search for Funding Opportunities For Assistance Delete Criteria to Update Search Funding ­ Finding Additional Sources Saving and Printing SPIN Search Results Past funding opportunities can be searched in InfoEd to: · find opportunities that were added prior to your account set

Duchowski, Andrew T.

400

Information Commons Help Desk Internet / Connectivity Wireless Access  

E-Print Network [OSTI]

Information Commons Help Desk Internet / Connectivity » Wireless Access ID #1912 Connecting in the Username and Password fields.5. Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help on this entry Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help

Boonstra, Rudy

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Green (?) datacenter Green Datacenter -TIC et environnement -Institut Mines Telecom -13 mai 2014, boutherin@lpsc.in2p3.fr  

E-Print Network [OSTI]

Green (?) datacenter Green Datacenter - TIC et environnement - Institut Mines Telecom - 13 mai 2014 Sandford Green Datacenter - TIC et environnement - Institut Mines Telecom - 13 mai 2014, boutherin@lpsc.in2 plus d'info sur ces aspects, consulter le site d'EcoInfo http://www.ecoinfo.cnrs.fr Green Datacenter

van Tiggelen, Bart

402

taBLe of Contents 2 Find a Job or Internship  

E-Print Network [OSTI]

spring 2013 program of events #12;taBLe of Contents 2 Find a Job or Internship 4 All Students, 2013 Deadline to accept internship offers from previous summer internships March 15, 2013 Deadline to accept internship offers received during Spring Semester OCR Employer Info Sessions Employer Info

Hone, James

403

A.A. 2014/2015 LM-41 -Medicina e chirurgia  

E-Print Network [OSTI]

A.A. 2014/2015 LM-41 - Medicina e chirurgia Info Generali Presentazione del Corso INFO Generali Classe LM-41 Medicina e chirurgia Nome inglese Medicine and Surgery Lingua in cui si tiene il corso italiano Indirizzo internet del corso di laurea http://www.medicina.unict.it/ Presidente del CdS PALMERI

Bella, Giampaolo

404

Doc'Up, association des doctorants de Sorbonne Universit Sige social : 15 rue de l'cole de mdecine, 75006 Paris  

E-Print Network [OSTI]

Doc'Up, association des doctorants de Sorbonne Universit Sige social : 15 place Jussieu, 75252 Paris cedex 05 Association Doc'Up Site internet : www.doc-up.info Pour nous contacter : contact@doc-up.info Liste Doc'Up pour l'lection des

Arleo, Angelo

405

Dept. of Electrical Engineering and Computer Sciences University of California, Berkeley  

E-Print Network [OSTI]

: 1. Distribution of intelligence Autonomous -- all information within each vehicle Cooperative -- vehicles communicate info to each other Infrastructure supported -- hwy collects info and communi­ cates to vehicles Infrastructure managed -- hwy also commands aggregate traf­ fic Infrastructure controlled -- hwy

Varaiya, Pravin

406

Computer Science ~ BA AFFILIATION PROCEDURES~  

E-Print Network [OSTI]

Technical Electives: 3000+ (3+ crs) from application areas: CS; Bio; Chem; Math; Econ; Psych; etc. [only one Specialization: Three 3000+ courses (3+ crs) from same subject area. CS courses, LING 4474, INFO 4302, INFO 3300, ECON 3130(beginning fall 2013)/ ECON 3190(prior to fall 2013), ENGRD 2700 or MATH 4710 (Taking a 3000

Keinan, Alon

407

ARCHITECTURE Magazine by  

E-Print Network [OSTI]

such exploita- tion if now elusive `clean coal' tech- nologies do not fully materialise. Nuclear energy

Perez, Richard R.

408

RealTime SpatioTemporal Query Processing in Mobile AdHoc Sensor Networks  

E-Print Network [OSTI]

that has multiple sensors (e.g., mo tion sensors, acoustic sensors, infrared light emitting diodes,

409

Original article Genetic influences on growth and partition  

E-Print Network [OSTI]

. The Hubbard had significantly higher relative rates of fat deposi- tion in the thigh, drumstick, breast

Paris-Sud XI, Université de

410

THERMAL ENERGY STORAGE IN AQUIFERS WORKSHOP  

E-Print Network [OSTI]

abandoned. The two-dimensional model gives a rotationally symmetrical approxima- tion to the reservoir.

Authors, Various

2011-01-01T23:59:59.000Z

411

Interview met Ron Eyerman Rogier van Reekum  

E-Print Network [OSTI]

tradi tions (hermeneutics and structuralists in particular), he and others Jeffrey Ale xander, Philip

412

1999 Macmillan Magazines Ltd Chiral nematic order  

E-Print Network [OSTI]

®ca- tion. Inorganic porous networks, such as porous aerogels, Anopore membranes (aluminium oxide membranes

Robbie, Kevin

413

THE RECEPTION OF NEWTON'S PRINCIPIA Abstract. Newton's Principia, when it appeared in 1687, was received with the greatest  

E-Print Network [OSTI]

Tycho Brahe, which summarized most of the astronomical knowledge about planetary mo- tion that was known

Belanger, David P.

414

How Green is Multipath TCP for Mobile Devices? Yeon-sup Lim  

E-Print Network [OSTI]

, but battery storage in- creases slowly by comparison. Thus, power consump- tion is an important area

Kurose, Jim

415

The EMBO Journal Vol.16 No.20 pp.60666076, 1997 Mutations in the 1 subunit of an L-type  

E-Print Network [OSTI]

and strength of contrac- tions (Noble, 1979; Huizinga, 1991). The physiological importance of regulating

Horvitz, H. Robert

416

A fast-response microfiber coupler tip high temperature sensor Ming Ding*a  

E-Print Network [OSTI]

, and electrical sources like power supply noise, electromagnetic interference (EMI), or radia- tion from lightning

417

lthough both computing and communications capabilities are  

E-Print Network [OSTI]

telecommunica- tions and computing. There is an ongoing debate occurring among two main factions within

Yu, Bin

418

Single-Site Vanadyl Activation, Functionalization, and Reoxidation Reaction Mechanism for Propane Oxidative Dehydrogenation on the Cubic V4O10 Cluster  

E-Print Network [OSTI]

, and mixed metal oxide (MMO) catalysts for selective oxidation and ammoxida- tion of propene to acrolein

Goddard III, William A.

419

Reinventing Britain: Constitutional Change under New Labour  

E-Print Network [OSTI]

tion and new public management. New institutionalistsdiplomacy, not the new public management. Institutionalists

McDonald, Andrew

2007-01-01T23:59:59.000Z

420

Self-Powered Processors Andrew Putnam, Luis Ceze Bryna Hazelton  

E-Print Network [OSTI]

-gap configura- tions using Silvaco ATLAS device physics simulation software [1]. The hammer-anvil operates

Ceze, Luis

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Proceedings of the 2000 IEEE InternationalConference on Robotics& Automation  

E-Print Network [OSTI]

, are widely used in scientific and engineering applica- tions. Propeller and turbine blades, or ships, auto

422

Saunders, A.D., Larsen, H.C., and Wise, S.W., Jr. (Eds.), 1998 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 152  

E-Print Network [OSTI]

(Sinton and Duncan, this volume). The lava may be grouped into three main lithostratigraphic forma- tions

423

Concise Synthesis of ()-Smenochromene D (= Likonide B) ConciseSynthesisof()-SmenochromeneDBrooke S. Olson, Dirk Trauner*  

E-Print Network [OSTI]

allylic alcohol 7 obtained from farnesyl acetate 6 through selective oxida- tion of a terminal allylic

Trauner, Dirk

424

M AT E R I A L S S C I E N C E Making Flame  

E-Print Network [OSTI]

, Novozyme-435 had high effi- ciency in catalyzing the reac- tion without inducing unde- sired cross

Blower, Sally

425

A fast-switching light-writable and electric-erasable negative photoelectrochromic cell based on Prussian blue films  

E-Print Network [OSTI]

glazing in response to illumina- tion, with promising applications in smart windows, sunglasses and light

Demir, Hilmi Volkan

426

Atmos. Chem. Phys., 10, 53715389, 2010 www.atmos-chem-phys.net/10/5371/2010/  

E-Print Network [OSTI]

% prompt and 30% slow evapora- tion) at a site northwest from the metropolitan area (PEMEX Correspondence

Meskhidze, Nicholas

427

Introduction Ideally, fishery biologists dream of a  

E-Print Network [OSTI]

vegeta- tion (SAV) on unconsolidated sediments or unconsolidated sediments. Continu- ous coral habitat

428

Images in Cardiovascular Medicine Coronary Embolization of an Intramyocardial Hematoma  

E-Print Network [OSTI]

by percutaneous coronary intervention with balloon angioplasty but without stent implanta- tion. At the end

Boyer, Edmond

429

6, 46734688, 2006 MESSy NCREGRID  

E-Print Network [OSTI]

-dimensional global Earth system modelling the solving of sets of differential equa- tions describing

Paris-Sud XI, Universit de

430

2, 11051153, 2006 The last glacial  

E-Print Network [OSTI]

Maximum climate simula- tions obtained with the Earth System model LOVECLIM, including coupled dynamic

Paris-Sud XI, Universit de

431

JOURNAL OF GEOPHYSICAL RESEARCH, VOL. ???, XXXX, DOI:10.1029/, What is the skill of ocean tracers in reducing uncertainties  

E-Print Network [OSTI]

in current Earth system models and (ii) imperfect knowledge of model parameters. Ocean tracers observa- tions

Haran, Murali

432

VERIFICATION OF A NUMERICAL SIMULATION TECHNIQUE FOR NATURAL CONVECTION  

E-Print Network [OSTI]

on advanced passive cooling techniques. Systems Analysis andand fabrica- tion techniques. Cooling Systems Research. This

Gadgil, A.

2008-01-01T23:59:59.000Z

433

Ris Energy Report 3 Introduction  

E-Print Network [OSTI]

, and biogas can be reformed directly. Efficiencies for hydrogen produc- tion from biomass, biogas and coal

434

Dispersion by chemical reaction of Rocky Mountain Arsenal Basin F waste soils  

SciTech Connect (OSTI)

Many military installations have soil contamination problems that range from heavy metals to petroleum products. Rocky Mountain Arsenal (RMA) Basin F contains high concentrations of salts, heavy metals, ammonia, urea, and organics. The Dispersion by Chemical Reaction (DCR) process leads to a reduction in the mobility of the organic and inorganic constituents by first removing volatile constituents via steam stripping and volatilization, then trapping the nonvolatile contaminants in a nonmobile phase (microencapsulation), and finally compacting the treated material into large soil bodies (macroencapsulation). This report summarizes the results of the DCR testing of soil-amended Basin F sludge from RMA. The primary focus of this study is on pesticide leachability. The DCR process used to treat the Basin F waste soil produced a dry, homogeneous, soil-like material with desirable physical properties that on compaction achieved the following remediation goals: reduction of all leachable volatiles to nondetectable levels, confinement of all metals to below RCRA TCLP levels, and a decrease in pesticide leachability to levels approaching RCRA standards. For example, endrin TCLP concentration was reduced from 74 microgram/L to 20-28 microgram/L (regulatory limit = 20 ug/L). In several cases, reductions in pesticide leachability could be attributed to simple dilution with the calcium oxide (CaO) reagent. However in other cases, microencapsulation and/or macroencapsulation also played a role in reducing pesticide leachability. Additional work is necessary to optimize the amounts of lime-milk, hydrophobic CaO, and benign oil used in the processing of RMA Basin F waste soils. Ideally, the optimum design should achieve the regulatory and client goals, while minimizing materials handling, energy, and reagent inputs.

Payne, J.R.; Marion, G.M.

1997-02-01T23:59:59.000Z

435

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 1  

SciTech Connect (OSTI)

The scope of this site plan safety submission (SPSS), includes: sampling plan to determine if GB is a contaminant in equipment and piping used in the production and demil processes; monitoring plan for personnel involved in the sampling effort; decon plan for personnel, equipment, and piping should contamination be identified. Additional sections and appendices include: historical use of bldg 1501, 1503, 1504, 1506, 1601, 1602, 1603, 1606; chemical information on GB; safety requirements; medical requirements and first aid procedures; piping drawings; rma sop's for sampling, monitoring, and decon.

Not Available

1988-10-01T23:59:59.000Z

436

Rotational micro-CT using a clinical C-arm angiography gantry  

SciTech Connect (OSTI)

Rotational angiography (RA) gantries are used routinely to acquire sequences of projection images of patients from which 3D renderings of vascular structures are generated using Feldkamp cone-beam reconstruction algorithms. However, these systems have limited resolution (<4 lp/mm). Micro-computed tomography (micro-CT) systems have better resolution (>10 lp/mm) but to date have relied either on rotating object imaging or small bore geometry for small animal imaging, and thus are not used for clinical imaging. The authors report here the development and use of a 3D rotational micro-angiography (RMA) system created by mounting a micro-angiographic fluoroscope (MAF) [35 {mu}m pixel, resolution >10 lp/mm, field of view (FOV)=3.6 cm] on a standard clinical FPD-based RA gantry (Infinix, Model RTP12303J-G9E, Toshiba Medical Systems Corp., Tustin, CA). RA image sequences are obtained using the MAF and reconstructed. To eliminate artifacts due to image truncation, lower-dose (compared to MAF acquisition) full-FOV (FFOV) FPD RA sequences (194 {mu}m pixel, FOV=20 cm) were also obtained to complete the missing data. The RA gantry was calibrated using a helical bead phantom. To ensure high-quality high-resolution reconstruction, the high-resolution images from the MAF were aligned spatially with the lower-dose FPD images, and the pixel values in the FPD image data were scaled to match those of the MAF. Images of a rabbit with a coronary stent placed in an artery in the Circle of Willis were obtained and reconstructed. The MAF images appear well aligned with the FPD images (average correlation coefficient before and after alignment: 0.65 and 0.97, respectively) Greater details without any visible truncation artifacts are seen in 3D RMA (MAF-FPD) images than in those of the FPD alone. The FWHM of line profiles of stent struts (100 {mu}m diameter) are approximately 192{+-}21 and 313{+-}38 {mu}m for the 3D RMA and FPD data, respectively. In addition, for the dual-acquisition 3D RMA, FFOV FPD data need not be of the highest quality, and thus may be acquired at lower dose compared to a standard FPD acquisition. These results indicate that this system could provide the basis for high resolution images of regions of interest in patients with a reduction in the integral dose compared to the standard FPD approach.

Patel, V.; Hoffmann, K. R.; Ionita, C. N.; Keleshis, C.; Bednarek, D. R.; Rudin, S. [Toshiba Stroke Research Center, Department of Physics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, Department of Physics, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Computer Science, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physics, and Department of Physiology and Biophysics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States)

2008-10-15T23:59:59.000Z

437

Pasture, Rangeland and Forage Risk Management Insurance Pilot Program Continues  

E-Print Network [OSTI]

costs and coverage: 1) Find your 12x12-mile grid at http://www.rma. usda.gov/policies/pasturerangeforage. Under the Rainfall Index, Grid ID Locator, click on Interactive Map. (NOTE: The initial grids shown are around College Station, Texas.... Confirm the city if more than one option appears. 2) Move the map left/right/up/down with the arrows on the borders of the map to locate your ranch. 3) Center the grid that includes your ranch. For example, center the map on grid #34837, Perrin...

Pena, Jose G.; Bevers, Stan; Thompson, Bill

2007-10-29T23:59:59.000Z

438

A Transformation System for Lazy Functional Logic Programs?  

E-Print Network [OSTI]

over to the transformation process and the transformed programs. We illus- trate the power A Transformation System for Lazy Functional Logic Programs? Mar. gmoreno@info-ab.uclm.es Abstract. Needed narrowing is a complete operational principle

Vidal, Germán

439

Smart Microgrid Demonstrator Dr. Wei-Jen Lee (wlee@uta.edu) (Funded by DOE)  

E-Print Network [OSTI]

Smart Microgrid Demonstrator Dr. Wei-Jen Lee (wlee@uta.edu) (Funded by DOE) EE www.uta.edu//ee info reliability and efficiency, lower cost of electric power #12;Smart Microgrid Demonstrator Dr. Wei-Jen Lee

Texas at Arlington, University of

440

nanoscience nanoelectronics  

E-Print Network [OSTI]

tags: toRSS nanoscience energy nanoelectronics nanomechanics Nanowires Exhibit Giant.info/#[[Nanowires%20Exhibit%... 1/2 #12;Related news list by date, most recent first: nanoscience energy

Espinosa, Horacio D.

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

MANUALE MATLAB A cura di Giuseppe Ciaburro  

E-Print Network [OSTI]

MANUALE MATLAB A cura di Giuseppe Ciaburro http://www.ciaburro.it info@ciaburro.it #12;Indice 1 Introduzione 4 1.1 Matlab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 2 Fondamenti di Matlab 7 2.1 Capacit`a di Matlab

De Marchi, Stefano

442

Sony Revisited: A new look at contributory copyright infringement*  

E-Print Network [OSTI]

Sony Revisited: A new look at contributory copyright infringement* Lee A. Hollaar Professor, School at http://digital-law-online.info/papers/lah/sony-revisited.htm Introduction Digital technology

Hollaar, Lee A.

443

2008 Annual Merit Review Results Summary - 8. High Efficiency...  

Broader source: Energy.gov (indexed) [DOE]

technically - there was lots of "info" presented but this reviewer didn't see any clear identification of where the target is and how close they are to achieving it. One final...

444

E-Print Network 3.0 - arcview gis extension Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Military Lands (970) 491-2748 cemml@cemml.colostate.edu Summary: using GPS, and spatial data development. ArcInfo, ArcView, ERDAS Imagine, and GRASS are some of the...

445

Logistics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Room 253. There is no official hotel or room block. There is no registration fee. LBNL Visitor Info LBNL Map with Building 15 identified PDF Berkeley Lab Guest House Nearby...

446

Analysis of factor productivity in agricultural systems in Zimbabwe and application of Geographic Information Systems in soil erosion prediction  

E-Print Network [OSTI]

photographs were digitized into an Arc/Info GIS. This was used to determine the area under crops and grazing. Range forage production figures in kilograms per hectare for the area were obtained from Agricultural Technical and Extension Services inventories...

Mugabe, Phanuel

1994-01-01T23:59:59.000Z

447

Department of Materials University of Oxford  

E-Print Network [OSTI]

Objective A report: A detailed design proposal which could be used by a manufacturer/company as the basis with your supervisor. #12;Department of Materials University of Oxford Log book Keep all info in a bound log

Paxton, Anthony T.

448

Academic Science Program Task Force Tuesday, May 24, 2011  

E-Print Network [OSTI]

, federal definition, etc) · Ratios/measures are good at department or college-level; breaks down as correct as source databases and that RADAR info only downloaded periodically · Interesting software

449

Physics Today News Picks: A unified picture of laser ... http://blogs.physicstoday.org/newspicks/2008/05/a_uni... 1 of 4 05/26/2008 10:15 AM  

E-Print Network [OSTI]

Telescope » Request product info COMPANY SPOTLIGHT CCD and TDI free seminar Learn about CCD devices Today on May 6, 2008 10:00 AM | Permalink SEARCH Search this blog: Search #12;

Rotter, Stefan

450

1|NATUREJOBS|23October2008SPOTLIGHTONSINGAPORE Advertiser retains sole responsibility for content.  

E-Print Network [OSTI]

States, Japan, and other scientific powerhouses? "These days, you don't see countries competing, you see-existing strengths in materials, high performance computing, microelectronics, data storage, info

Bustamante, Fabin E.

451

CMPE 185 Spring 1998 Syllabus 1 1 Administrative details  

E-Print Network [OSTI]

CMPE 185 Spring 1998 Syllabus 1 Syllabus 1 Administrative details Location and time Kresge 327, MWF of the quarter, and 10% on in­class work, Karplus & Larrabee Info 1 #12; 2 Syllabus CMPE 185 Spring 1998

Karplus, Kevin

452

CMPE 185 Winter 1999 Syllabus 1 Syllabus  

E-Print Network [OSTI]

CMPE 185 Winter 1999 Syllabus 1 Syllabus 1 Administrative details Location and timePorter 144, MWF 3:30-4:40 (Warning: location Info 1 #12;2 Syllabus CMPE 185 Winter 1999 4

Karplus, Kevin

453

CMPE 185 Winter 1999 Syllabus 1 1 Administrative details  

E-Print Network [OSTI]

CMPE 185 Winter 1999 Syllabus 1 Syllabus 1 Administrative details Location and time Porter 144, MWF). Everything must be turned in by the last day of class, Friday March 12. Karplus Info 1 #12; 2 Syllabus CMPE

Karplus, Kevin

454

CMPE 185 Fall 2000 Syllabus 1 1 Administrative details  

E-Print Network [OSTI]

CMPE 185 Fall 2000 Syllabus 1 Syllabus 1 Administrative details Location and time Kresge 327, MWF 2, and need to do the grading mostly on Dec 2. Karplus Info 1 #12; 2 Syllabus CMPE 185 Fall 2000 4 Special

Karplus, Kevin

455

CMPE 185 Fall 2000 Syllabus 1 Syllabus  

E-Print Network [OSTI]

CMPE 185 Fall 2000 Syllabus 1 Syllabus 1 Administrative details Location and timeKresge 327, MWF 2 Info 1 #12;2 Syllabus CMPE 185 Fall 2000 4

Karplus, Kevin

456

New Clues in Predicting Alzheimer's Disease  

ScienceCinema (OSTI)

Theres a new clue in the search to identify the harbingers of Alzheimers disease. More info: http://newscenter.lbl.gov/feature-stories/2008/12/16/predict-alzheimers-disease/

Jagust, William

2013-05-29T23:59:59.000Z

457

LAKEFRONT CAMPUS Pontchartrain  

E-Print Network [OSTI]

CAMPUS 1. Administration Bldg. 1a. Administration Annex 2. Amphitheater 3. Bicentennial Education Ctr. 4 for Energy Research Management 37. Lindy C. Boggs Conf Center 38. Navy Info Tech Center Leon C. Simon Blvd

Kulp, Mark

458

Relevance of underground natural gas storage to geologic sequestration of carbon dioxide  

E-Print Network [OSTI]

Underground Storage of Natural Gas in the United States andEnergy Information Agency (2002). U.S. Natural Gas Storage.www.eia.doe.gov/oil_gas/natural_gas/info_glance/storage.html

Lippmann, Marcelo J.; Benson, Sally M.

2002-01-01T23:59:59.000Z

459

A tabu search based memetic algorithm for the maximum diversity problem  

E-Print Network [OSTI]

b,, Fred Glover c , Zhipeng L¨u d aSchool of Management, Northwestern Polytechnical University, 127), hao@info.univ-angers.fr (Jin-Kao Hao), glover@opttek.com (Fred Glover), zhipeng

Hao, Jin-Kao

460

Energy Efficiency Targets  

Broader source: Energy.gov [DOE]

In December of 2010, the Arkansas Public Service Commission announced a [http://www.apscservices.info/pdf/08/08-144-U_153_1.pdf Sustainable Energy Resource Action Plan] for Arkansas. Along with...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Project 1640 Palomar Procedures  

E-Print Network [OSTI]

Lesker pressure gauge to the pressure sensor on the dewar (both shown in the photo below), and check you to adjust the settings (need more info here). Figure 1. The P1640 pressure sensor

462

Crude Injustice in the Gulf: Why Categorical Exclusions for Deepwater Drilling in the Gulf of Mexico are Inconsistent with U.S. International Ocean Law and Policy  

E-Print Network [OSTI]

Percentage of Crude Oil Production from Greater than 200and 2010, monthly crude oil production in the Gulf more thanof Mexico Field Production of Crude Oil, U.S. ENERGY INFO.

Hull, Eric V.

2011-01-01T23:59:59.000Z

463

Last Updated 3.22.2013 NIH Activitiesand Resources  

E-Print Network [OSTI]

Measure Up? Speaker: James Marshall, Ph.D., Department of Educational Technology, San Diego State University 1:00- 2:00 p.m. Online Register / More Info 11/15/2012 Converting SMEs (Subject Matter Experts

Rau, Don C.

464

QuickStart: Learn DAX Basics in 30 Owen Duncan  

E-Print Network [OSTI]

. Why is DA It's easy to PivotCharts critical sale inventory d important c data. When line info o it. You can ev AX formulas. Bu date ranges? O mulas provide formulas will he e real business cel

Hunt, Galen

465

NORTH CAROLINA BIOFUEL DISTRIBUTORS & PRODUCERS  

E-Print Network [OSTI]

.blueridgebiofuels.com Asheville, NC 828-253-1034 Woodrow Eaton info@blueridgebiofuels.com Bud's Oil Company Harmony, NC 704 Corporation www.newdixieoil.com Roanoke Rapids, NC Littleton, NC 252-537-4118 Scott Aman scottaman

466

auxerre glossed bibles: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

The Hermitage is one of the most are also here including a sword, hundreds of books, eyeglasses and Bible. For more info check http Ablamowicz, Rafal 178 Wichita State University...

467

High-Performance Scalable Information Service for the ATLAS Experiment  

E-Print Network [OSTI]

makes this facility very attractive for supporting the ATLASIS) facility has been developed in the scope of the ATLASATLAS/is/RunParams/RunParams.RunInfo One has to take into account that this facility

Kolos, S; Boutsioukis, G; Hauser, R

2012-01-01T23:59:59.000Z

468

STAFF SENATE Minutes 120 Randolph  

E-Print Network [OSTI]

with a 20 30 year build-out Metrics for the performance plan: o Campus edge identity o Pedestrian at Southgate Campus wide initiatives: o Way finding ordered presentation of info, family of signs o Bike

Buehrer, R. Michael

469

John Learned, University of Hawaii at Manoa (& other colleagues at UH and elsewhere)  

E-Print Network [OSTI]

Directional (statistical) Resolution: Recoil neutron remembers direction Thermalization blurs the info Gamma Fresnel lens · Proper optics need to be implementedProper optics need to be implemented ·· Sensitivity

Learned, John

470

Be Environmentally Responsible! Minimize the amount of cardboard boxes  

E-Print Network [OSTI]

of incandescent bulbs Use recycled products that are recyclable More info? Visit recycle.ucmerced.edu WHAT resident to access the internet and Wireless Internet WHAT'S INCLUDED? WHAT YOU SHOULD LEAVE AT HOME · Pets

Westerling, Anthony L.

471

University Identity Standards a manual for building a stronger identity  

E-Print Network [OSTI]

Communication and Marketing (UCAM) Rev.10.07 #12;2 UNM brand redesign UCAM (University Communication). quick info #12;1 UNM brand redesign table of contents University Identity Standards Table of Contents..................................................................................................... 2 Image & Identity

New Mexico, University of

472

SYRACUSE UNIVERSITY CLASS OF 2010  

E-Print Network [OSTI]

AFFAIRS 303 UNIVERSITY PLACE, SUITE 235 SYRACUSE, NY 13244 #12;Suite Syracuse Un of 2010 Pla bachelor rcent in 200 University Pla 05 / http://stu E UNIV F STUDENT A reer Services d to present t rovides info

Raina, Ramesh

473

How to assess the Environmental State of EU regions with the global concept of sustainability?  

E-Print Network [OSTI]

on the recognition of the relative im- pact of the pollutants on human health using the DALYs4 parameters, Impact, Response 4 DALY: Disability Adjusted Life Years EnviroInfo 2004 (Geneva) Sh@ring ­ Enviro

Paris-Sud XI, Université de

474

Efficient Emissions Control for Multi-Mode Lean DI Engines  

Broader source: Energy.gov (indexed) [DOE]

for more info on RCCI concept Gasoline Tank Air Exhaust Air HXN Exhaust HXN EGR HXN Turbo Fuel Rail Fuel Pump Fuel Pressure Regulator DRIVVEN Control Conventional Diesel RCCI...

475

1 | T H E A U S T R A L I A N N A T I O N A L U N I V E R S I T Y M I N U T E S  

E-Print Network [OSTI]

Scholarly Info Res Mgmt), David Howse (IT Security), George Lovrincevic (Systems & Desktop Support: MOE report (PIR) template to the OMG for review and discussion. Incidents not treated in a BAU manner should

476

Murdoch University Dixon Road, Rockingham  

E-Print Network [OSTI]

Murdoch University Dixon Road, Rockingham Western Australia 6168 Email: info in Desalination Australia holds a diverse portfolio of 43 research projects, spanning five, and on microbial populations in seawater. Forward osmosis as a low energy and high efficiency pre

477

E-Print Network 3.0 - act arra funding Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2009 Summary: Research Administration 12;2 ARRA Grant Funding Opps and Info at Grants.nih.govRecovery NIH Recovery Web... total amount of ARRA funds received that quarter; how...

478

Sierra Designs, Alpha 3 person, 4 seasons tent: Add door panels and beefy tent pole reinforcements for 4-season use  

E-Print Network [OSTI]

vestibule shelters backpacks and gear · Swift Clips and color-coded webbing for easy set up · Super silicone coating · Floor: 70 denier nylon taffeta with polyurethane coating · PDF file for more info (https

Walker, Lawrence R.

479

alimentos integrales para: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Maths Info et SIG en Geosciences 1. Derivees et integrales Geosciences Websites Summary: gris ci-dessus. (a) Quelle est l'aire A du disque gris de rayon h ? L'aire d'un disque de...

480

1 ACIT Meeting Notes Advisory Committee for Information Technology  

E-Print Network [OSTI]

sets beyond what have been done prior, proprietary info, image manipulation, 3D visualizations, 3D printing for analytic work. · What about support for new faculty? o Expectations are higher. What is being

California at Santa Cruz, University of

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

AEP Appalachian Power - Commercial and Industrial Rebate Programs...  

Broader source: Energy.gov (indexed) [DOE]

150,000 will be reviewed on a case-by-case basis Program Info Start Date 3112011 State West Virginia Program Type Utility Rebate Program Rebate Amount UnitarySplit ACAir...

482

CATASTROPHIC REPAIR REQUEST CHECKLIST Office of Research  

E-Print Network [OSTI]

Not Meet Policy Not Sure Equipment may not be covered by a service contract that provides for repair Contacted: ______________ Amount of Annual Service Contract: $ ___________ Meets Policy Info Pending Does

Schladow, S. Geoffrey

483

E-Print Network 3.0 - angiotensinogen mrna expression Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

3 Outline Plasma Membrane Summary: -25 Gene Expression Genes are lengths of DNA that code for synthesis of RNA mRNA carries info for how... occurs when mRNA sequence is used...

484

CAMPUS TUTORING RESOURCE GUIDE ACCESS Williston Hall Room 100 PH: (815) 753-0203  

E-Print Network [OSTI]

CAMPUS TUTORING RESOURCE GUIDE ACCESS ­ Williston Hall ­ Room 100 PH: (815) 753-0203 http ACCY 206, 207, 288 ACCESS/PAL Tutoring Various Locations and times 753-0203 For Info Williston 100 Mon

Karonis, Nicholas T.

485

E-Print Network 3.0 - air movement impact Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org Summary: ). Including air pollution as a screening criterion acknowledges the health impacts borne by...

486

Nano-Punk For Tomorrow's People  

E-Print Network [OSTI]

Nano-Punk for Tomorrows People By Christopher NewfieldMikhail Rocos NBIC (nano- bio-info-cognitive) convergenceset in a Victorian-style nano era. Why Victorian? Perhaps

Newfield, Chris

2006-01-01T23:59:59.000Z

487

American Society of Mammalogists Movements and Denning Habits of a Badger  

E-Print Network [OSTI]

& Conditions of Use, available at . http://www.jstor.org/page/info/about/policies/terms.jsp JSTOR is a not in the Netherlands. Thesis, Rijks-Univ., Utrecht, Netherlands (from Biolo. Abstracts,1953). DAVIS,W. H. 1966

Minnesota, University of

488

Fault tolerance for Exascale parallel executions: leveraging...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

BuildingRoom: Searle 240A, 5735 S. Ellis Avenue - This talk will be broadcast via Blue Jeans (see new Info below) Location: University of Chicago Speaker(s): Franck Cappello...

489

Brain Networks, Nature and Neighborhoods: Quantifying Internal...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

BuildingRoom: Searle 240A, 5735 S. Ellis Avenue - This talk will be broadcast via Blue Jeans (see new Info below) Location: University of Chicago Speaker(s): Marc G. Berman...

490

Recursive error correction for general Reed-Muller codes  

E-Print Network [OSTI]

for low-rate Reed-Muller codes, IEEE Trans. Info. Theory,of low-rate Reed-Muller codes, Proc. 9 th All-Union Conf.decoding of u|u + v| codes, IEEE Selected Areas Commun. ,

Dumer, I; Shabunov, K

2006-01-01T23:59:59.000Z

491

K&L GATES LLP 1601 K STREET, N.W.  

Broader source: Energy.gov (indexed) [DOE]

July 17, 2014). 10 U.S. ENERGY INFO. ADMIN., Review of Emerging Resources: U.S. Shale Gas and Shale Oil Plays (2011). 8 DC-9824999 v1 No person shall export any natural gas...

492

COLUMBIA UNIVERSITY CLUB OF NEW YORK Now is a great time to join the Columbia University Club of New York!  

E-Print Network [OSTI]

COLUMBIA UNIVERSITY CLUB OF NEW YORK Now is a great time to join the Columbia University Club-719-0380 fax: 212-944-6944 info@columbiaclub.org www.columbiaclub.org Columbia's Social

Hone, James

493

244.ps  

E-Print Network [OSTI]

Dec 9, 2000 ... on a Sun Ultra 2 with two UltraSPARC 300 MHz CPUs and 256 MB .... [5] J.E. Beasley, \\OR-Library," http://mscmga.ms.ic.ac.uk/info.html. [6] D.C....

2000-12-09T23:59:59.000Z

494

Elliott Sites on the Move.pdf | OSTI, US Dept of Energy, Office...  

Office of Scientific and Technical Information (OSTI)

Elliott Sites on the Move.pdf Document Description STI Submission via the AN 241.1 Web Service STI Submission via the AN 241.1 Web Service Document Info Available Downloads for...

495

APBF- DEC Heavy-Duty NOx Adsorber/DPF Project: Catalyst Aging...  

Broader source: Energy.gov (indexed) [DOE]

Shawn D. Whitacre August 30, 2004 Presented at: 10 th Annual Diesel Engine Emission Reduction Conference San Diego, California Contact info: (303) 275-4267 ShawnWhitacre@nrel.go...

496

QUELLE CITOYENNET DANS UNE DMOCRATIE ETHNIQUE ? Alain Dieckhoff  

E-Print Network [OSTI]

QUELLE CITOYENNET? DANS UNE D?MOCRATIE ETHNIQUE ? Alain Dieckhoff L'Harmattan | Confluences.0069 -------------------------------------------------------------------------------------------------------------------- Distribution électronique Cairn.info pour L'Harmattan. © L'Harmattan. Tous droits réservés pour tous pays. La.cairn.info-Institutd'EtudesPolitiquesdeParis--193.54.67.94-08/07/201411h56.©L'Harmattan Documenttéléchargédepuiswww

Boyer, Edmond

497

LE RGLEMENT REACH : UNE POLITIQUE EUROPENNE DE L'INCERTAIN. UN DTOUR DE RGULATION POUR LA GESTION  

E-Print Network [OSTI]

GESTION DES RISQUES CHIMIQUES Jean-Noël Jouzel et Pierre Lascoumes L'Harmattan | Politique européenne 2011-214. -------------------------------------------------------------------------------------------------------------------- Distribution électronique Cairn.info pour L'Harmattan. © L'Harmattan. Tous droits réservés pour tous pays. La.cairn.info-Institutd'EtudesPolitiquesdeParis--193.54.67.94-16/07/201410h15.©L'Harmattan Documenttéléchargédepuiswww

Paris-Sud XI, Université de

498

L'INDIFFRENCE DES FRANAIS ET DES BELGES (FRANCOPHONES) POUR LEURS VOISINS EUROPENS : UNE PICE DE PLUS AU  

E-Print Network [OSTI]

Ingelgom L'Harmattan | Politique européenne 2008/3 - n° 26 pages 143 à 164 ISSN 1623-6297 Article-164. -------------------------------------------------------------------------------------------------------------------- Distribution électronique Cairn.info pour L'Harmattan. © L'Harmattan. Tous droits réservés pour tous pays. La.cairn.info-Institutd'EtudesPolitiquesdeParis--193.54.67.94-10/07/201415h14.©L'Harmattan Documenttéléchargédepuiswww

Paris-Sud XI, Université de

499

IMMIGRATION, MIGRATION ET LIBRE CIRCULATION DANS LA CONSTRUCTION DE L'EUROPE  

E-Print Network [OSTI]

IMMIGRATION, MIGRATION ET LIBRE CIRCULATION DANS LA CONSTRUCTION DE L'EUROPE Adrian Favell L'Harmattan-64. -------------------------------------------------------------------------------------------------------------------- Distribution électronique Cairn.info pour L'Harmattan. © L'Harmattan. Tous droits réservés pour tous pays. La.cairn.info-Institutd'EtudesPolitiquesdeParis--193.54.67.94-15/07/201416h15.©L'Harmattan Documenttéléchargédepuiswww

Paris-Sud XI, Université de

500

L'IDENTIT EUROPENNE, ENTRE SCIENCE POLITIQUE ET SCIENCE Introduction  

E-Print Network [OSTI]

L'IDENTIT? EUROP?ENNE, ENTRE SCIENCE POLITIQUE ET SCIENCE FICTION. Introduction Sophie Duchesne L'Harmattan-16. -------------------------------------------------------------------------------------------------------------------- Distribution électronique Cairn.info pour L'Harmattan. © L'Harmattan. Tous droits réservés pour tous pays. La.cairn.info-Institutd'EtudesPolitiquesdeParis--193.54.67.94-15/07/201412h20.©L'Harmattan Documenttéléchargédepuiswww

Boyer, Edmond