Powered by Deep Web Technologies
Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Fundamentals of RMA  

Science Journals Connector (OSTI)

The purpose of this chapter is to review briefly the fundamental principles and methods of RMA. We assume that you have prior knowledge of RMA and require only a refresher. If you require more than a refresher...

Mark H. Klein; Thomas Ralya; Bill PollakÖ

1993-01-01T23:59:59.000Z

2

Investigating High Performance RMA Interfaces for the MPI-3 Standard  

SciTech Connect

The MPI-2 Standard, released in 1997, defined an interface for one-sided communication, also known as remote memory access (RMA). It was designed with the goal that it should permit efficient implementations on multiple platforms and networking technologies, and also in heterogeneous environments and non-cache-coherent systems. Nonetheless, even 12 years after its existence, the MPI-2 RMA interface remains scarcely used for a number of reasons. This paper discusses the limitations of the MPI-2 RMA specification, outlines the goals and requirements for a new RMA API that would better meet the needs of both users and implementers, and presents a strawman proposal for such an API. We also study the tradeoffs facing the design of this new API and discuss how it may be implemented efficiently on both cache-coherent and non-cache-coherent systems.

Tipparaju, Vinod [ORNL; Gropp, William D [University of Illinois, Urbana-Champaign; Thakur, Dr. Rajeev [Argonne National Laboratory (ANL); Traff, Jesper [NEC Europe Ltd; Ritzdorf, Hubert [NEC Europe Ltd

2009-01-01T23:59:59.000Z

3

MHK Technologies/CoRMaT | Open Energy Information  

Open Energy Info (EERE)

CoRMaT CoRMaT < MHK Technologies Jump to: navigation, search << Return to the MHK database homepage CoRMaT.jpg Technology Profile Technology Type Click here Axial Flow Turbine Technology Readiness Level Click here TRL 5 6 System Integration and Technology Laboratory Demonstration Technology Description The CoRMat employs two closely spaced contra rotating rotors driving a contra rotating electrical generator The first rotor has three blades rotating in a clockwise direction while the second rotor located directly behind the first has four blades rotating in an anti clockwise direction The turbine directly drives a flooded permanent magnet contra rotating generator without a gearbox The flooded generator is cooled passively by the water eliminating parasitic energy losses associated with gearbox driven water tight active oil based gearbox generator cooling systems and power absorbing shaft seals

4

CUSSSFIC4TION CMUXLLq  

Office of Legacy Management (LM)

CUSSSFIC4TION CMUXLLq CUSSSFIC4TION CMUXLLq RITE AUG 1 7 1962 Fcx the Atomic. Energy Commisaion~ Chief. Declaseifle@tlon Brar\qh F-mm A. B. Grsaingsr (Other ends tifmtioel) The die wae foutq3 to workvery satiafactorilywiti thlanew Qpeof incert, andncm,of tbepmvLouedsfeotaofeoo+tH&' iOitYwaslmd. D&e& ._: . . ..YG ~Kl.3. i>ro;rid3 -&I:: clcsuro on bct.k.mds of the .plece m & Die #l, is also to be tried outoo 4zgust22. Barr~l~or~~~Die~~hadalaobeenawlLfiedta' plwidesd~do~- rwrdaM,thatSibs.of~~oouldbe~etoflow~gbtheLliearoundtbe surface of the wend overf'lo~lnto abarrel lvcatedundemeath the die. Under th?3e conditions "b8rre.l type' aaatjngs sere made with hardly any plvmure at all andrefaulthg ooatiiage were,of mums, vergporousand~eot. However, the

5

The SpallaTion  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

SpallaTion neuTron Source projecT When the Department of Energy (DOE) set out in the 1990s to develop a neutron scattering research facility that was ten times more powerful than the state of the art, the concept for the project that it chose was as ambitious as the scientific capability it sought to deliver. The Spallation Neutron Source (SNS) Project called for unprecedented collaboration among six national laboratories as well as significant

6

Course info Machine Learning  

E-Print Network (OSTI)

Course info Machine Learning Real life problems Lecture 1: Machine Learning Problem Qinfeng (Javen) Shi 28 July 2014 Intro. to Stats. Machine Learning COMP SCI 4401/7401 Qinfeng (Javen) Shi Lecture 1: Machine Learning Problem #12;Course info Machine Learning Real life problems Table of Contents I 1 Course

Shi, Qinfeng "Javen"

7

Advertisements Info for Advertisers  

E-Print Network (OSTI)

Advertisements Info for Advertisers Browse By Issue Select Decade Select Volume Select Issue Stay Current Get your research ASAP. e-Alerts | RSS Feeds Advertisements Thematic Collection on Chemistry://pubs.acs.org/page/crtoec/thematic/dna-damage.html 1 of 4 11/10/09 11:51 AM #12;Info for Advertisers Proteomic Analysis of DNA-Protein Cross

Gates, Kent. S.

8

pine (mail utility info)  

NLE Websites -- All DOE Office Websites (Extended Search)

pine (mail utility info) pine (mail utility info) Basics, FAQ, etc, On our UNIX machines, module load pine The line module load pine should ALSO be in the file ~/.rc/user_modules (The pine module also includes pico) pine usage with IMAP4 (UNIX) Moving pine email files into IMAP4 LBNL UNIX info on pine links to Pine Information Center Pine 4.2.1/Solaris: Forwarding as attachment; the following procedure has proved successful for at least some users: Check the option "enable-full-header-cmd". To get to this option, 1. M (Main Menu) 2. S (Setup) "Choose a setup task from the menu below :" 3. C (Configure) 4. Scroll down to "Advanced Command Preferences", and press "X" to set "enable-full-header-cmd". It looks like this: ================================================================

9

CONTACT INFO BUILDING SHELTER  

E-Print Network (OSTI)

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.

10

Past Restoration Fund Info  

NLE Websites -- All DOE Office Websites (Extended Search)

Rates > Past Restoration Rates > Past Restoration Fund Info Past Restoration Fund Info FY 2013 Restoration Fund SNR Letter to Customers Regarding Revision to FY13 Restoration Fund Obligation Mid-Year Adjustment (June 19, 2013) (PDF - 1146 KB) SNR Letter to Customers Regarding FY13 Restoration Fund Obligation Mid-Year Adjustment (April 15, 2013) (PDF - 829 KB) SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2013 (August 8, 2012) (PDF - 325 KB) FY 2012 Restoration Fund SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2012 (August 9, 2011) (PDF - 340 KB) Mid Year Adjustment to the FY 2012 Restoration Fund Payment (April 18, 2012) (PDF - 174 KB) FY 2011 Restoration Fund SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2011 (August 20, 2010) (PDF - 705 KB)

11

MHK Projects/Contra Rotating Marine Turbine CoRMaT | Open Energy  

Open Energy Info (EERE)

Contra Rotating Marine Turbine CoRMaT Contra Rotating Marine Turbine CoRMaT < MHK Projects Jump to: navigation, search << Return to the MHK database homepage Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"350px","centre":false,"title":"","label":"","icon":"File:Aquamarine-marker.png","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":55.6655,"lon":-4.93682,"alt":0,"address":"","icon":"http:\/\/prod-http-80-800498448.us-east-1.elb.amazonaws.com\/w\/images\/7\/74\/Aquamarine-marker.png","group":"","inlineLabel":"","visitedicon":""}]}

12

Field studies of wildlife at Rocky Mountain Arsenal (RMA): Relevance to risk assessment  

SciTech Connect

Field studies of wildlife at contaminated sites can provide information about past and present effects, but are limited in spatial and temporal resolution. They cannot be used to predict future risks without utilizing risk assessment methodologies, including exposure-response relationships. RMA is unusual among Superfund sites in that its large size permits the existence of diverse wildlife populations in peripheral areas, despite high levels of contamination in central areas. Risk assessments conducted at RMA predict steep gradients in severity of effects from high in the central areas to low in peripheral areas. The population effects of such gradients will vary among species, depending on their exposure ranges and dispersal behavior. Effects on survival or reproduction in core areas may be partly or wholly offset by immigration from peripheral or offsite areas. Most field studies of wildlife populations at RMA have been conducted at scales inappropriate for ecological risk characterization, and have not been integrated with information on patterns of contamination or exposure. Hence, they do not provide much useful information to complement or modify the results of risk assessments. More focused field studies are needed to provide useful information on wildlife effects before and after remediation.

Nisbet, I.C.T. [I.C.T. Nisbet and Co., Inc., N. Falmouth, MA (United States); Swain, W.R. [ECO Logic, Inc., Ann Arbor, MI (United States); Star, I. [GeoTrans, Inc., Boulder, CO (United States)

1994-12-31T23:59:59.000Z

13

InfoSpi Inc | Open Energy Information  

Open Energy Info (EERE)

InfoSpi Inc InfoSpi Inc Jump to: navigation, search Name InfoSpi Inc. Place Ft. Lauderdale, Florida Zip 33309 Sector Biofuels, Carbon Product Florida-based, OTC-quoted firm that plans to get involved in biofuels project development and has said it plans to start a hedge fund focused on carbon markets. References InfoSpi Inc.[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. InfoSpi Inc. is a company located in Ft. Lauderdale, Florida . References ‚ÜĎ "InfoSpi Inc." Retrieved from "http://en.openei.org/w/index.php?title=InfoSpi_Inc&oldid=346906" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes Special pages

14

info  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3 3 AUDIT REPORT REVIEW OF THE U.S. DEPARTMENT OF ENERGY'S INFORMATION MANAGEMENT SYSTEMS U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF AUDIT SERVICES AUGUST 1998 August 10, 1998 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman Acting Inspector General SUBJECT: INFORMATION : Audit Report on "Review of the U.S. Department of Energy's Information Management Systems" BACKGROUND The Federal emphasis on reinventing Government and the end of the Cold War have driven change at the Department of Energy. In the midst of this change, the Department' s Information Architecture Program was initiated. Over the past several years, the Department realized that information management and strategic planning efforts must focus on the utility and management of information,

15

Template:ContactInfo | Open Energy Information  

Open Energy Info (EERE)

ContactInfo ContactInfo Jump to: navigation, search This is the ContactInfo template. It is designed for use by Companies, Organizations and Government Agencies. To specify the contact info for an arganization, go to that organization's page and click Edit with Form. Parameters For - The branch of the organizations or specialty with which this contact is associated. (i.e. "Biomass", "New Applications", etc. Default is "GeneralInfo".) This will be used to differentiate this contact from others associated with the same organization. Name - The name Topics this page discusses. (optional) When a person's name is unknown, a position name will often suffice. Phone - The contact's phone number. Website - A web page URL with additional contact info.

16

Contact Info | Occupational Medicine Clinic  

NLE Websites -- All DOE Office Websites (Extended Search)

Occupational Medicine Clinic Occupational Medicine Clinic Promoting optimal physical and emotional health through quality care that is convenient, confidential & individualized. Home Health Promotion Program Employee Assistance Program Contact Contact Info Occupational Medicine Joseph Falco, M.D. 344-3666 OMC Manager/Supervising Physician Staff Physicians Carol Davis, D.O. 344-3667 Board Certified - Occupational Medicine Eva Erens, M.D. 344-3668 Board Certified - Internal Medicine Jaishree Subramani, M.D. MPH 344-3669 Board Certified - Internal Medicine Health Promotion Program Michael Thorn, RN, MBA 344-8612 Health Promotion/Disease Prevention Program Employee Assistance Program (EAP) Nancy Losinno, LCSW, CEAP 344-4567 EAP Manager Linda DiPierro 344-2733 Senior Occupational Medicine Assistant

17

Property:GBIG/NeighborhoodInfo | Open Energy Information  

Open Energy Info (EERE)

NeighborhoodInfo Jump to: navigation, search This is a property of type String. Retrieved from "http:en.openei.orgwindex.php?titleProperty:GBIGNeighborhoodInfo&oldid509342"...

18

Sustainability Double Degree Double Degree Info  

E-Print Network (OSTI)

Sustainability Double Degree Double Degree Info: · 36 credits in B for graduation. Sustainability Core: Take each course below for a total of 17 -20 credits. Term/Grade Course _____ ____ *NR 350 (4) Sustainable

Gr√ľnwald, Niklaus J.

19

UTICA 4, NEW YORK COFIPOR~TION  

Office of Legacy Management (LM)

DROf fORGE & TOOL DROf fORGE & TOOL UTICA 4, NEW YORK COFIPOR~TION PHONE 3- 2331 July 5, 1955 ?:r. E. J. Block Director of Production Division United Staton Atomic ::norgy Commission Yiashington, D. C. Dear Xr. 1310~1~: Xe had a visit last Thursday from Kr. R. C. Sale11 of the: Atomic Energy Commission who inspected our vacuum melting facilities. EIz suggested that we should get in touch with you and that you r+ht be interested in the use of our facilities for the i>roduction of uranium fuel elements. Xe have at the present time the largest coxnercial vacuum installation in the country and m have been producin; high tc~poraturc alloys for the aircraft industry for over txro 'years. ;Is have produced to date Over 400,000 pounds of mtal. Our present rate of production is of the order

20

ICREC and InfoEd Approval Procedure Flowchart Researcher ticks "Does this research include any aspects that may have ethical  

E-Print Network (OSTI)

implications can relate to health or non- health issues, and to proposals that will be sent to ICREC or COREC aspects that may have ethical implications?" on the InfoEd cover page, fills in and attaches the ICREC this research include any aspects that may have ethical implications?" on the InfoEd cover page, fills

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

InfoPower | Open Energy Information  

Open Energy Info (EERE)

InfoPower InfoPower Jump to: navigation, search Name InfoPower Place Madrid, Spain Zip 28039 Product Information provider for the power sector in Spain Coordinates 40.4203¬į, -3.705774¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.4203,"lon":-3.705774,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

22

Property:LithologyInfo | Open Energy Information  

Open Energy Info (EERE)

LithologyInfo LithologyInfo Jump to: navigation, search Property Name LithologyInfo Property Type Text Subproperties This property has the following 93 subproperties: 2 2-M Probe Survey A Active Seismic Methods Active Sensors Aerial Photography Aeromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Chemical Logging Compound and Elemental Analysis Conceptual Model Controlled Source Frequency-Domain Magnetics Cross-Dipole Acoustic Log D Data Acquisition-Manipulation Data Collection and Mapping Data Techniques Data and Modeling Techniques Drilling Methods E Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Fault Mapping Field Techniques Flow Test Fluid Inclusion Analysis Fluid Lab Analysis Formation Testing Techniques

23

Property:StratInfo | Open Energy Information  

Open Energy Info (EERE)

StratInfo StratInfo Jump to: navigation, search Property Name StratInfo Property Type Text Subproperties This property has the following 82 subproperties: 2 2-M Probe Survey A Active Seismic Methods Airborne Electromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Chemical Logging Compound and Elemental Analysis Conceptual Model Controlled Source Frequency-Domain Magnetics Cuttings Analysis D Data Acquisition-Manipulation Data Techniques Data and Modeling Techniques Drilling Methods E Earth Tidal Analysis Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Flow Test Fluid Inclusion Analysis Fluid Lab Analysis Formation Testing Techniques Frequency-Domain Electromagnetic Survey G Gas Geothermometry

24

Property:HydroInfo | Open Energy Information  

Open Energy Info (EERE)

HydroInfo HydroInfo Jump to: navigation, search Property Name HydroInfo Property Type Text Subproperties This property has the following 77 subproperties: 2 2-M Probe Survey A Acoustic Logs Active Seismic Methods Aeromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Conceptual Model Core Analysis Core Holes Cuttings Analysis D Data Acquisition-Manipulation Data Techniques Data and Modeling Techniques Drilling Methods E Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Formation Testing Techniques Frequency-Domain Electromagnetic Survey G Gamma Log Gas Flux Sampling Gas Geothermometry Geochemical Data Analysis G cont. Geochemical Techniques Geodetic Survey Geophysical Methods Geothermal Literature Review

25

Property:ThermalInfo | Open Energy Information  

Open Energy Info (EERE)

Property Property Edit with form History Facebook icon Twitter icon ¬Ľ Property:ThermalInfo Jump to: navigation, search Property Name ThermalInfo Property Type Text Subproperties This property has the following 93 subproperties: A Acoustic Logs Active Seismic Methods Active Sensors Aeromagnetic Survey Airborne Electromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Conceptual Model Controlled Source Frequency-Domain Magnetics Cross-Dipole Acoustic Log Cuttings Analysis D Data Acquisition-Manipulation Data Collection and Mapping Data Techniques Data and Modeling Techniques Density Log Direct-Current Resistivity Survey Drilling Methods E Earth Tidal Analysis Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion

26

Dale Meade Some promised international collaboration info  

E-Print Network (OSTI)

Dale Meade Some promised international collaboration info 1 message Glen Wurden to the German tokamak (fast imaging equipment to study pellets). The collaboration was possible, because I met was my collaborator then later in Germany. There I met, and became integrated with the entire ASDEX team

27

V-050: IBM InfoSphere Information Server Multiple Vulnerabilities |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: IBM InfoSphere Information Server Multiple Vulnerabilities 0: IBM InfoSphere Information Server Multiple Vulnerabilities V-050: IBM InfoSphere Information Server Multiple Vulnerabilities December 19, 2012 - 1:00am Addthis PROBLEM: IBM InfoSphere Information Server Multiple Vulnerabilities PLATFORM: The vulnerabilities are reported in versions prior to 9.1. ABSTRACT: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server REFERENCE LINKS: Secunia Advisory SA51605 IBM Support home IBM InfoSphere Information Server, Version 9.1 fix list IMPACT ASSESSMENT: Medium DISCUSSION: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server, where some have an unknown impact and others can be exploited by malicious users to bypass certain security restrictions. 1) An unspecified error exists in the InfoCenter component.

28

V-050: IBM InfoSphere Information Server Multiple Vulnerabilities |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: IBM InfoSphere Information Server Multiple Vulnerabilities 0: IBM InfoSphere Information Server Multiple Vulnerabilities V-050: IBM InfoSphere Information Server Multiple Vulnerabilities December 19, 2012 - 1:00am Addthis PROBLEM: IBM InfoSphere Information Server Multiple Vulnerabilities PLATFORM: The vulnerabilities are reported in versions prior to 9.1. ABSTRACT: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server REFERENCE LINKS: Secunia Advisory SA51605 IBM Support home IBM InfoSphere Information Server, Version 9.1 fix list IMPACT ASSESSMENT: Medium DISCUSSION: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server, where some have an unknown impact and others can be exploited by malicious users to bypass certain security restrictions. 1) An unspecified error exists in the InfoCenter component.

29

Template:InfoForPlace | Open Energy Information  

Open Energy Info (EERE)

InfoForPlace InfoForPlace Jump to: navigation, search This is the 'InfoForPlace' template. It should be called in the following format: {{InfoForPlace |place= |target= |var= |heading= |label= }} For example: {{InfoForPlace |place={{SUBJECTPAGENAME}} |target=Category:Research Institutions |var=num_institutions |heading=Registered Energy Research Institutions in {{SUBJECTPAGENAME}} |label=Institutions }} Edit the page to see the template text. Retrieved from "http://en.openei.org/w/index.php?title=Template:InfoForPlace&oldid=325497" Category: Experimental Templates What links here Related changes Special pages Printable version Permanent link Browse properties 429 Throttled (bot load) Error 429 Throttled (bot load) Throttled (bot load) Guru Meditation: XID: 1863773880 Varnish cache server

30

Info-Exch 2012 - Shirley Olinger Presentation | Department of...  

Office of Environmental Management (EM)

and Lessons Learned Workshop: Field Manager's Top Issues More Documents & Publications EM Recovery Act Lessons Learned (Olinger) Info-Exch 2012 - Thomas Johnson Presentation...

31

NETL: Contact Info and Privacy Act Advisory  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Info and Privacy Act Advisory To contact us: National Energy Technology Laboratory 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh, PA 15236-0940 Phone: 412-386-6167 PRIVACY ACT ADVISORY: Authority: 5 U.S.C. 301, 5 U.S.C. 552, Freedom of Information Act (FOIA); and Title 10, Code of Federal Regulations, Part 1004. Purpose: To allow individuals to file electronic FOIA requests; to track all FOIA requests from receipt to response to compile statistics for the Annual FOIA Report; to research and respond to FOIA requests; to maintain case files to comply with records disposal requirements; and to maintain an administrative record to support any litigation. Routine Use: Records related to the FOIA request will be maintained in DOE-55 "Freedom of Information and Privacy Act (FOIA/PA) Requests for Records." A record

32

Connecting ARC/INFO and SNACTor Project Report  

E-Print Network (OSTI)

Connecting ARC/INFO and SNACTor Project Report June 1991 Stuart C. Shapiro, Hans Chalupsky;Connecting ARC/INFO* and SNACTor --- Project Report1 Stuart C. Shapiro2 , Hans Chalupsky2 and Hsueh and reasoning system developed by Stuart C. Shapiro et al. at the State University of New York at Buffalo

California at Santa Barbara, University of

33

The Comparative Logistics Project www.ed-w.info  

E-Print Network (OSTI)

The Comparative Logistics Project www.ed-w.info The Impact of e-Commerce on the Japanese Raw Fish Supply Chain Edmund W. Schuster and Kazunari Watanabe #12;The Comparative Logistics Project www in the Japanese market #12;The Comparative Logistics Project www.ed-w.info 1. Introduction (continued) · E

Brock, David

34

Information for Development Program (infoDev) | Open Energy Information  

Open Energy Info (EERE)

Development Program (infoDev) Development Program (infoDev) Jump to: navigation, search Logo: Information for Development Program (infoDev) Name Information for Development Program (infoDev) Place Washington DC Coordinates 38.8951118¬į, -77.0363658¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.8951118,"lon":-77.0363658,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

35

SANDIA COKPOK4TION SANDIA BASE, .QLDUQUERQUE. N. M.  

Office of Legacy Management (LM)

SANDIA COKPOK4TION SANDIA COKPOK4TION SANDIA BASE, .QLDUQUERQUE. N. M. To : DISTRIBUTION Re: Disposition of t h e Shoal S i t e Attached herewith i s a study which has been made s w g e s t i n g p o s s i b l e f u r t h e r uses of t h e Shoal S i t e . I - ! e have a l s o b r i e f l y described how permanent d i s p o s i t i o n might be made. The study has been made with t h e hope t h a t it w i l l evolce f u r t h e r considerc~tion of t h e s i t e and l e a d t o a plan f o r continued use and eventual d i s p o s i t i o n . W i l l you please review t h e study and forward your comments and any o t h e r suggestions f o r t h e s i t e . Your r e p l i e s w i l l be used t o help formulate a f i n a l d i s p o s i t i o n plan. Copy t o : Brig. Cen. D. L. Crowson, D M , \.lash., D. C. Attn: Lt. Col. W . C. H a l l < < J. 3. Reeves, ivkr. I ' A C - W O O R. E. Piiller, P S C - W O O : a ! . W . t

36

EERE PROJECT MANAGEMENT CENTER NEPA DETTIUlIIN .... TION PROJECT  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Chicago Chicago u.s. DEP .... RTIIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETTIUlIIN .... TION PROJECT TITLE: Chicago Climate Action Plan Advanced Transportation Technologies Initiative STATE: IL Funding Opportunity Announcement Number nla Procurement Instrument Number DE-FG3&-060860S2 NEPA Control Number GFO-G086052-001 Page 1 of2 ClD Number G086052 Based on my review oftbe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4S1.1A), I bave made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 65.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical

37

Alternative Fueling Station Locator App Provides Info at Your Fingertips |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Alternative Fueling Station Locator App Provides Info at Your Alternative Fueling Station Locator App Provides Info at Your Fingertips Alternative Fueling Station Locator App Provides Info at Your Fingertips November 15, 2013 - 10:12am Addthis The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department Shannon Brescher Shea Communications Manager, Clean Cities Program Smartphone users are familiar with the prompt, "Would you like this site to use your current location?" If you're looking for somewhere to fuel your

38

Alternative Fueling Station Locator App Provides Info at Your Fingertips |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Alternative Fueling Station Locator App Provides Info at Your Alternative Fueling Station Locator App Provides Info at Your Fingertips Alternative Fueling Station Locator App Provides Info at Your Fingertips November 15, 2013 - 10:12am Addthis The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department Shannon Brescher Shea Communications Manager, Clean Cities Program Smartphone users are familiar with the prompt, "Would you like this site to use your current location?" If you're looking for somewhere to fuel your

39

Secondary Energy InfoBook | Open Energy Information  

Open Energy Info (EERE)

Secondary Energy InfoBook Secondary Energy InfoBook Jump to: navigation, search Tool Summary Name: Secondary Energy Infobook and Secondary Infobook Activities Agency/Company /Organization: United States Department of Energy Sector: Energy Focus Area: Renewable Energy Resource Type: Training materials User Interface: Website Cost: Free Language: English Fact sheets about the major energy sources, electricity, efficiency, conservation,transportation, and emerging technologies. The teacher's infobook contains dozens of fact sheets about the major energy sources, electricity, energy efficiency, energy conservation, transportation, and emerging technologies. Detailed information covers an introduction to energy, the forms of energy, global climate change, the history of electricity, and information about the major energy sources. The

40

Donnerstag, 24. Juli 2003 Biomasse Info-Zentrum  

E-Print Network (OSTI)

Centre Biogas - fuel cell Dust engine/-turbine ORC--process Hot Gasturbine Gasification - engine-engine Steamprocess Bioethanol - engine Methanol - engine* Methanol - fuel cell* Co- Combustion Biogas Methan - fuel 8 Biomasse Info-Zentrum Biomass Information Centre Internal Combustion Engine, Biogas #12;Donnerstag

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Chemistry in Higher What's available and where is the info?  

E-Print Network (OSTI)

Chemistry in Higher Education What's available and where is the info? What does studying chemistry? Where does it lead and what might a chemistry career look like? Dr. David Read, Director of Outreach 2013 #12;310 (294) HE courses with chemistry offered as a single subject hosted at 53 universities 699

Anderson, Jim

42

Developing the ability to model acid-rock interactions and mineral dissolution during the RMA stimulation test performed at the Soultz-sous-ForÍts EGS site, France  

Science Journals Connector (OSTI)

The Soultz Enhanced Geothermal System (EGS) reservoir's response to chemical stimulation is assessed by numerical simulation of coupled thermo-hydraulic-chemical processes. To assess chemical interactions between host rocks and a mixture of \\{HCl\\} and HF as well as its potential effects on the Soultz EGS reservoir, new modelling efforts using the FRACHEM code have been initiated. This article presents the model calibration and results. Simulations consider realistic conditions with available data sets from the EGS system at Soultz. Results indicate that the predicted amount of fracture sealing minerals dissolved by injection of a mixture of acids Regular Mud Acid (RMA) was consistent with the estimated amount from the test performed on GPK4 well at Soultz EGS site. Consequently reservoir porosity and permeability can be enhanced especially near the injection well by acidizing treatment.

Sandrine Portier; FranÁois D. Vuataz

2010-01-01T23:59:59.000Z

43

Information for Development Program (infoDev) Feed | Open Energy  

Open Energy Info (EERE)

for Development Program (infoDev) Feed for Development Program (infoDev) Feed Jump to: navigation, search Home | About | Inventory | Partnerships | Capacity Building | Webinars | Reports | Events | News | List Serve CLEAN Member Feeds Center for Environment and National Security at Scripps Centro de Energías Renovables (CER) The Children's Investment Fund Foundation (CIFF) Climate and Development Knowledge Network (CDKN) Climate Technology Initiative (CTI) ClimateWorks Foundation Coalition for Rainforest Nations (CfRN) Ecofys Energy Research Centre of the Netherlands (ECN) Energy Sector Management Assistance Program of the World Bank (ESMAP) Environment and Development Action in the Third World (ENDA-TM) German Aerospace Center (DLR) German Agency for International Cooperation (GIZ) Global Village Energy Partnership (GVEP)

44

Info-F-205 : Solutions TP1 Introduction  

E-Print Network (OSTI)

Info-F-205 : Solutions TP1 Introduction Matlab : Matrix Laboratory Interpr√©teur avec une structure Possibilit√©s graphiques commande plot(x,y) 2 s√©ries de valeurs de m√™me taille 1 graphe. Exemple : x = -pi:0 apr√®s dans un m√™me graphe. On peut voir le r√©sultat dans la Figure 1. 2 #12;Structures de contr√īle pour

Bontempi, Gianluca

45

JSON shows incomplete info | OpenEI Community  

Open Energy Info (EERE)

JSON shows incomplete info JSON shows incomplete info Home > Groups > Utility Rate I pointed this out this bug a while ago, but I'm re-posting since it still hasn't been resolved. I have found several rates where the JSON file doesn't show all of the information shown in the web interface. This is not an approval issue since I see it on both rates that say "This is the approved revision of this page, as well as being the most recent." and "No revision has been approved for this page. It is currently under review by our subject matter experts." Here is an example: http://en.openei.org/wiki/Data:0a897297-e17e-42c0-8f40-8db41b44b004 http://en.openei.org/services/rest/utility_rates?version=latest&format=json_plain&detail=full&getpage=Data:0a897297-e17e-42c0-8f40-8db41b44b004

46

MAGENCO: A map generalization controller for Arc/Info  

SciTech Connect

The Arc/Info GENERALIZE command implements the Douglas-Peucker algorithm, a well-regarded approach that preserves line ``character`` while reducing the number of points according to a tolerance parameter supplied by the user. The authors have developed an Arc Macro Language (AML) interface called MAGENCO that allows the user to browse workspaces, select a coverage, extract a sample from this coverage, then apply various tolerances to the sample. The results are shown in multiple display windows that are arranged around the original sample for quick visual comparison. The user may then return to the whole coverage and apply the chosen tolerance. They analyze the ergonomics of line simplification, explain the design (which includes an animated demonstration of the Douglas-Peucker algorithm), and discuss key points of the MAGENCO implementation.

Ganter, J.H.; Cashwell, J.W.

1994-06-01T23:59:59.000Z

47

M.Sc.Info-Veranstaltung, 21. Juni 2011 M.Sc. Chemie und Molecular Science  

E-Print Network (OSTI)

M.Sc.Info-Veranstaltung, 21. Juni 2011 M.Sc. Chemie und Molecular Science an der FAU Erlangen-N√ľrnberg Rainer Fink - Studiendekan Chemie / Mol.Sci. - #12;M.Sc.Info-Veranstaltung, 21. Juni 2011 Grundz√ľge der Masterstudieng√§nge Chemie und Molecular Science Qualifikation zu den Masterstudieng√§ngen Modulwahl (Chemie

Stummer, Wolfgang

48

InfoDev and DFID Climate Technology Program | Open Energy Information  

Open Energy Info (EERE)

DFID Climate Technology Program DFID Climate Technology Program Jump to: navigation, search Logo: InfoDev Climate Technology Program Name InfoDev Climate Technology Program Agency/Company /Organization World Bank, Information for Development Program (infoDev) Partner UK's Department for International Development (DFID) Sector Energy, Land Focus Area Energy Efficiency, Renewable Energy, Biomass, Solar, Wind, Buildings, Transportation, Forestry, Agriculture Topics Implementation, Market analysis, Policies/deployment programs Resource Type Workshop Website http://www.infodev.org/climate Program Start 2009 Country Kenya, India Eastern Africa, Southern Asia References Climate Technology Program [1] infoDev's Climate Technology Program (www.infoDev.org/climate) is conducting country-specific projects aimed at accelerating the development,

49

LinShim6 -Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6  

E-Print Network (OSTI)

LinShim6 - Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6 Documentation at http://inl.info.ucl. ac.be/publications/shim6-masterthesis. Like the whole project, this documentation

Bonaventure, Olivier

50

Cooperative Spectrum Sensing and Localiza-tion in Cognitive Radio Systems using Com-  

E-Print Network (OSTI)

Cooperative Spectrum Sensing and Localiza- tion in Cognitive Radio Systems using Com- pressed features in cog- nitive radio systems (CRS): spectrum sensing and location awareness in a single compressed implementing a cognitive radio system. The major problem for spectrum sensing arises in wideband radio, when

Gesbert, David

51

China For all ages a MulTi-generaTional exPloraTion  

E-Print Network (OSTI)

China For all ages a MulTi-generaTional exPloraTion The greaT Wall, TerraCoTTa Warriors & The MighCTuresque China Experience the Delights of a Well-Crafted Family Tour Dear Princetonian, Join Princeton Journeys, June 27 ­ July 9, 2013, for a comprehensive tour of China designed with families in mind. Explore

Rowley, Clarence W.

52

SEASONAL V A R IA TIONS IN STRUCTURE AND CIRCULATION IN THE RED SEA  

E-Print Network (OSTI)

SEASONAL V A R IA TIONS IN STRUCTURE AND CIRCULATION IN THE RED SEA A DISSERTATION SUBMITTE D and surface circulation in the Red Sea, occur r ing along the north-south axis of the Sea and extending fr om on in the northern Red Sea is frorn the nor th-northwest throughout the year' during the winter ( fr om October

Luther, Douglas S.

53

Tag der InnovaTIon Fokus WerksToFFWIssenschaFTen  

E-Print Network (OSTI)

Tag der InnovaTIon Fokus WerksToFFWIssenschaFTen auFTakTveransTalTung zur MITarbe erfolg. ein beitrag dazu soll der,,Tag der Innovation ¬≠ Fokus Werkstoffwissenschaften" sein, der am 26 des zentralinstitutes f√ľr neue Materialien und Prozesstechnik und des Fraunhofer-Institutes ezr

Fiebig, Peter

54

analogies to proteins as a func-tion of nanoparticle size and  

E-Print Network (OSTI)

analogies to proteins as a func- tion of nanoparticle size and surface charge, and lipid composition and phase state. The focus will be on engineered nanoparticles common to environmental and biomedical applications, and examples will be provided where fundamental knowledge of nanoparticle

Subramanian, Venkat

55

V-058: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw 8: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code V-058: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code December 31, 2012 - 6:58am Addthis PROBLEM: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code PLATFORM: Version(s): 6, 7, 8 ABSTRACT: A vulnerability was reported in Microsoft Internet Explorer. A remote user can cause arbitrary code to be executed on the target user's system. REFERENCE LINKS: SecurityTracker Alert ID: 1027930 Secunia Advisory SA51695 CVE-2012-4792 IMPACT ASSESSMENT: High DISCUSSION: A remote user can create specially crafted HTML that, when loaded by the target user, will trigger a memory corruption error and execute arbitrary

56

Countdown to Solar Decathlon: The Info You Need Before You Go | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Countdown to Solar Decathlon: The Info You Need Before You Go Countdown to Solar Decathlon: The Info You Need Before You Go Countdown to Solar Decathlon: The Info You Need Before You Go September 29, 2009 - 10:44am Addthis Elizabeth Spencer Communicator, National Renewable Energy Laboratory Maybe I'm just not paying enough attention to the date, but this took me a little by surprise: The Solar Decathlon is already less than two weeks away! The Solar Decathlon, if you haven't heard about it, is an event put on once every two years by the U.S. Department of Energy. Essentially, 20 university teams are challenged to construct a house that is 100% powered by solar energy. In early October, the teams will set up their homes in Washington, D.C., on the National Mall, where they'll be judged in ten contests. And those homes

57

Biodiversity, Entropy and Thermodynamics http://math.ucr.edu/home/baez/bio info/  

E-Print Network (OSTI)

Biodiversity, Entropy and Thermodynamics John Baez http://math.ucr.edu/home/baez/bio info/ October(pi ) is fundamental to thermodynamics and information theory. But it's also used to measure biodiversity, where pi. In biodiversity studies, the entropy of an ecosystem is the expected amount of information we gain about

Baez, John

58

Introducing Propositional Logic and Queueing Theory with the InfoTraffic Interactive Learning Environments  

E-Print Network (OSTI)

Environments Ruedi Arnold Institute for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland rarnold of propositional logic when you see traffic lights at intersections? Or do you reason about what the throughput of a street might be while being caught up in a traffic jam? Most people do not, we presume. But as Info

59

www.ConferenceOnSustainableRealEstate.com info@ ConferenceOnSustainableRealEstate.com  

E-Print Network (OSTI)

www.ConferenceOnSustainableRealEstate.com info@ ConferenceOnSustainableRealEstate.com The Conference On Sustainable Real Estate will be held at the University of Memphis campus on March 24, 25, 26 those opportunities. How does Sustainable Real Estate practice benefit investors, developers

Dasgupta, Dipankar

60

Professor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health  

E-Print Network (OSTI)

) ­ Electrical or Biomedical Engineering Setting the standard for wireless health education ­ First ever, reach and cost of care through wireless health solutions. #12;Master of Science ­ Electrical EngineeringProfessor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless

Rollins, Andrew M.

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Professor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health  

E-Print Network (OSTI)

) ­ Electrical or Biomedical Engineering Setting the standard for wireless health education ­ First everProfessor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health Questions: wirelesshealth@case.edu Professional & Graduate Education in Wireless Health #12;Case Western

Rollins, Andrew M.

62

STATEM ENT OF CONSIDER TIONS CLASS WAIVER OF TH E GOVERNMENT'S DOMESTIC AN  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STATEM STATEM ENT OF CONSIDER TIONS CLASS WAIVER OF TH E GOVERNMENT'S DOMESTIC AN D FO REIGN PATENT RIGHTS AND ALLOCATION OF DATA RIGHTS ARJSING FROM TI-lE:: USE OF DOE FACJLJTIES AND FACIL ITY CONT'l~ACTORS BY OR FOR THIR D PARTY FUND ING SPONSORS UNDER AGREEMENTS FO R COMMERCIALIZING TECHNOLOGY (ACT): DOE WAIVER NO. W(C)-201 l-013 The D..:partrnent of Energ.} (and its predecessor agencies) (col lectively. ''DO E" or · Department") considers each or its DO E Facilities (i.e., Nati onal Laboratories. single-purpose research fac ilities. and other Department facili ties, hereinafter referred to individually as ·'Facil ity" or collect ively as '·Facilities'') to be a unique and valuab le national resource that should be made avail· ble to the extent fea

63

Get your Tsunami info here | OSTI, US Dept of Energy, Office of Scientific  

Office of Scientific and Technical Information (OSTI)

Get your Tsunami info here Get your Tsunami info here From the Science.gov search "tsunami sendai japan" Find out how the U.S. Military Gears Up to Help ... DefenseLINK Web Site Visit NOAA Center for Tsunami Research - Forecast Propagation Database See how NASA Shows Topography of Tsunami-Damaged Japan City, NASA Website S.RES.101 : A resolution expressing the sense of the Senate relating to the March 11, 2011, earthquake and tsunami in Japan.THOMAS, 112th Congress Guidance on Psychological First Aid Field Operations Guide (available in Japanese). MedlinePLUS Earthquake events Figure 1. Locations of the unit sources for pre-computed simulated earthquake events in the Propagation Database. These can be combined to provide a very fast forecast during an actual tsunami event. A WorldWideScience.org search yields:

64

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI sends solar energy info to the public (March OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov June 2007 WorldWideScience.org Listen Now WorldWideScience.org Global Science Gateway Now Open You can now easily access science from around the world via a single Web entry point, WorldWideScience.org. This new global science gateway opened for free public access on June 22, at the public meeting of the International Council for Scientific and Technical Information Annual General Assembly in Nancy, France. WorldWideScience.org currently retrieves research results from more than 200 million pages of information from 15 national portals of 10 countries - Australia, Brazil, Canada, Denmark, France, Germany, Japan, the

65

DOE Science Showcase - DOE Nuclear Physics R&D Info | OSTI, US Dept of  

Office of Scientific and Technical Information (OSTI)

DOE Nuclear Physics R&D Info DOE Nuclear Physics R&D Info While quarks and gluons are fairly well understood, how they fit together to create different types of matter is still a mystery. The DOE Nuclear Physics program's mission is to solve this mystery through theoretical and experimental research; the benefits to society range from fighting cancer to ensuring food safety to border protection. Find DOE research information on this topic from the OSTI databases and read about the Department's Nuclear Physics program. From the Databases Select a database to initiate a search. DOE Information Bridge DOE R&D Accomplishments Energy Citations Database ScienceCinema Science.gov WorldWideScience.org More information Accelerating Innovation: How nuclear physics benefits us all About DOE's Nuclear Physics Program

66

OpenEI.org: A wealth of renewable energy info at your fingertips | OpenEI  

Open Energy Info (EERE)

OpenEI.org: A wealth of renewable energy info at your fingertips OpenEI.org: A wealth of renewable energy info at your fingertips Home > Groups > OpenEI Community Central Graham7781's picture Submitted by Graham7781(1992) Super contributor 15 November, 2010 - 08:46 imported OpenEI Are you looking for information on how to make your home more energy efficient? Want to know what types of government incentives are available in your state if you utilize wind energy to power your business? Or maybe you're an analyst looking for up-to-date data on ARRA-funded geothermal projects in your technology sector. Whether you're a consumer, business owner, analyst or researcher, OpenEI.org puts a wealth of information on renewable energy at your fingertips. And it's all free. OpenEI was created in response to the White House's Open Government

67

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI News Transcripts, OSTI sends solar energy info to the public (March OSTI News Transcripts, OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov May 2007 Listen Now OSTI Celebrates 60 Years of Knowledge Sharing 1947-2007 Whether by print or by pixel, OSTI has long been committed to ensuring appropriate and ready access to government research. Born in 1947 of General Leslie R. Grove's mandate to tell the American people about the formerly secret Manhattan Project and the development of the atomic bomb, the Office of Scientific and Technical Information, or OSTI, rapidly became home to one of the world's most comprehensive collections of energy-related information. Long before the Internet came along, OSTI advanced science by making research information widely available. Located in Oak Ridge, Tennessee,

68

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI sends solar energy info to the public (March OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov March 2007 Solar Energy R&D Listen Now The sun's heat and light provide an abundant source of energy that can be harnessed in many ways. You can read more and find a wide range of solar energy information through OSTI's Solar Energy Web page. From educational materials to radiation resource information, OSTI has pulled together one-stop access to U.S. Department of Energy solar energy resources. In addition, you can search for solar energy research at OSTI's Information Bridge. The U.S. Department of Energy has played a major role in solar energy research and development. As a result of solar R&D, the cost of solar energy has been reduced 100-fold over the past two decades.

69

Institut Galile L2 info S1 Anne 2008-2009 Administration de Parc Informatique  

E-Print Network (OSTI)

Institut Galilée L2 info S1 ­ Année 2008-2009 Administration de Parc Informatique TP 05 Internet. Dans notre cas de machines virtuelles, nous n'avons besoin que de l'image iso du cédérom : debian-40r4a-i386-netinst.iso Vous la trouverez dans le répertoire /LOCAL/qemulator/images/ Pour débuter l

Messiant, Cédric

70

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network (OSTI)

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 03'ordinateur `a l'aide du Live DVD. Rappel, `a l'invite boot:, il faut taper : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso et il doit s'afficher : knoppix bootfrom=/dev/sda7/LOCAL/ADSY.iso Une fois l'ordinateur d

Messiant, Cédric

71

INFO-F-309 Administration des Systmes TP1: Installation de Linux et gestion des packages  

E-Print Network (OSTI)

virtuelle avant de la lancer pour mon- ter l'image .iso disponible dans le répertoire /serveur/logicielles/tpINFO-F-309 ­ Administration des Systèmes TP1: Installation de Linux et gestion des packages trouverez l(es) image(s) du TP dans le répertoire : /serveur/logicielles/tp-adminsys/partie1 Ce répertoire

Collette. Sébastien

72

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network (OSTI)

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 02 ligne de commande suivante : knoppix bootfrom=/dev/sda7/LOCAL/ADSY.iso ATTENTION ! au d¬īemarrage, le^eme si c'est la ligne ci-dessus qui s'affiche, il faut en fait taper la ligne suivante : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso

Messiant, Cédric

73

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network (OSTI)

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 04 R¬īesolution de noms. Le but de ce TP est d'apprendre aux machines `a se conna^itre par le nom plut^ot que DVD. Rappel, `a l'invite boot:, il faut taper : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso et il doit

Messiant, Cédric

74

Informacin durante o despus de una emergencia : Llame al nmero 459-INFO (4636)  

E-Print Network (OSTI)

Informaci√≥n durante o despu√©s de una emergencia : ¬∑ Llame al n√ļmero 459-INFO (4636) ¬∑ Prenda su emergencia. ¬∑ No regresar al edificio hasta que el personal de emergencia se lo ind√≠que. Evacuaci√≥n LSi usted descubre un fuego: ¬∑ Evacue el √°rea inmediatomente. ¬∑ Active la alarma de fuego mas cercana. ¬∑ Llame al

California at Santa Cruz, University of

75

SJSU Information Support Services Run a Query info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

....................................................................................................................................................................3 Advanced Search Run a Query info-support@sjsu.edu, 408-924-1530 Page 4 Advanced Search 4. To do an advanced search, click the Advanced Search link. The Advanced Search parameters display. Notes: The other most commonly

Su, Xiao

76

The GraduaTe school of educaTion newsleTTer | suMMer 2013 Project learn  

E-Print Network (OSTI)

The The GraduaTe school of educaTion newsleTTer | suMMer 2013 Project learn: Vision to Reality . . . One Project at a Time continued on page 3 f or the second year, Dr. Erin Washburn, from Project LEARN, along with the Windsor Central School District and the Liberty Partnership Program (LPP) at Binghamton

Suzuki, Masatsugu

77

Use of pectino-cellulolytic enzymes for improving extrac-tion of phloem-limited plant viruses as exemplified by  

E-Print Network (OSTI)

Use of pectino-cellulolytic enzymes for improving extrac- tion of phloem-limited plant viruses-persistent manner ; it has been successfully purified using pectino-cellulolytic enzymes. The enzymes (driselaseH 6 along with enzyme or a mixture of enzymes and incubated with shaking. The filtrate was adjusted

Paris-Sud XI, Université de

78

Summary We examined the effects of increased transpira-tion demand on xylem hydraulic conductivity and vulnerabil-  

E-Print Network (OSTI)

in response to high evaporative demand and prevent xylem tensions from reaching values that cause catastrophicSummary We examined the effects of increased transpira- tion demand on xylem hydraulic conductivity potential and water potential differences between the soil and the shoot were similar for desert and montane

Maherali, Hafiz

79

Quand les TIC russissent trop bien dans les organisa-tions : le cas du courrier lectronique chez les managers  

E-Print Network (OSTI)

Quand les TIC réussissent trop bien dans les organisa- tions : le cas du courrier électronique chez dès lors comme un objet de recherche approprié pour étudier la problématique darticulation des TIC un point nodal structurant dans le portefeuille technologique des managers. Mots clefs : TIC

Paris-Sud XI, Université de

80

Volume 83, number 1 CHEMICAL PKYSICS LEZTERS 1 October 1981 BASIS SET CONSIDERATIONS FOR THE CALCULA TION OF GRADIENTS  

E-Print Network (OSTI)

FOR THE CALCULA TION OF GRADIENTS IN THE LCAO FORMALISM Jan ALMLGF and Trygve HELGAKER Department of Ghemist In these expressions, h and g( 1.2) are the one- and &Vo-eleCtrOnparts Of the hamiltonian, `&i and rii,,k[ are the fit

Helgaker, Trygve

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

The newesT addiTion To The UniversiTy of MinnesoTa's BioMedical  

E-Print Network (OSTI)

The newesT addiTion To The UniversiTy of MinnesoTa's BioMedical discovery disTricT is designed The BUilding's collegial and physical relaTionship To neighBoring faciliTies in The U's BioMedical discovery in the U's Biomedical Discovery District. "The brick, precast concrete, and curtain wall vocabulary

Weiblen, George D

82

PHYS 113 General Physics I Fall 2012 KSU -4 credits Section: Room Instructor: Contact Info.  

E-Print Network (OSTI)

introductory physics course dealing with the topics of mo- tion, mechanics, matter and energy. Emphasis #12;Laboratory The laboratory is a required and integrated part of the course, and counts 20% towards your grade. A passing grade (60%) in the laboratory is required to pass the course. See the lab manual

Wysin, Gary

83

STATEMENT OF C01 SIDER.!;.TIONS RE Q UE ST BY INVENTOR FOR THE WAIVER OF DOMESTIC AN  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

C01 SIDER.!;.TIONS C01 SIDER.!;.TIONS RE Q UE ST BY INVENTOR FOR THE WAIVER OF DOMESTIC AN D FOREIGN RTGHTS TO AN IDE. TIFIED [NVEN'fl0'\1 ENTiTLED "RESONANT-CAVITY APPA.RATUS FOR CYTOM.GTRY OR PARTICLE ANA L'YS iS'' US P 5,793,485, DEVELOPI·:D UNDER DOE CONTRACT NO. DE-AC04-94AL85000; DOE r:\"VENTfON DISCLOSU RE NO. S-85,819 (SD-5797 ); DOE WAIV ER NO. V.l ( ) 201 l-oo_,; rv3 The Petitioner, Paul L. Gourley (Inventor), has requested a \\'aive of the Government's domestic and fo eign patent rights in a subject invention entitled "Resonant-Cavi ty Apparatus for Cytome ry or Particle Analy·sis." The invention v,·as conceived by the inventor while an employee of the Sandia Corporation (Sandia). ,'andia is the M&O contractor for the Sandia a ional Laboratories (S L), a government-0\vned, contracto

84

RMA Annual Conference 15 17 July 2010  

E-Print Network (OSTI)

/26) Chair: John Deathridge Beyond Jazz (Room G35) Chair: Peter Elsdon Gregory Camp (University of Oxford in the Twenty-First Century: Hybridity, the Internet and the Boundaries of Genre 17.30 Short Break 17.45 Keynote in Liszt's `Einzug der Gäste auf Wartburg' from Tannhäuser Shay Loya, Nineteenth-Century Folklorism

Miranda, Eduardo Reck

85

Campus Sustainability Planetary Health Ecological Design Social and Environmental Enterprise Incuba-tion EcoVillages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model Energy  

E-Print Network (OSTI)

Villages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model Energy Conservation, Efficiency1 Campus Sustainability Planetary Health Ecological Design Social and Environmental Enterprise Incuba- tion EcoVillages Sustainable Food Systems Ecoliteracy Solutions Journal Campus Systems Model

Hayden, Nancy J.

86

SJSU Information Support Services Send Messages by Instructor info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

, and Expiration Date for the message. 10. Enter the Term number for the class. To select from a list of terms, use-924-1530 Page 2 The Sign In page displays. 3. Enter your SJSU ID and Password. 4. Click the Sign In button. 5 by Instructor info-support@sjsu.edu, 408-924-1530 Page 3 The SJSU Messaging Search page displays. 6. Click

Su, Xiao

87

Towards an InTerdIscIplInary approach To nexT-GeneraTIon BIofuels EnvironmEntal, tEchno-Economic, and GovErnancE  

E-Print Network (OSTI)

Towards an InTerdIscIplInary approach To nexT-GeneraTIon BIofuels EnvironmEntal, t. 2010. The Ecological Impact of Biofuels. Pages 351-377 in D. J. Futuyma, H. B. Shafer, and D. Huffer, S., Roche, C.M., Blanch, H.W., and Clark, D.S. (2012). Escherichia coli for biofuel production

Iglesia, Enrique

88

U.S. DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEP..I. DFTFRlIllN..I.TION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NEP..I. DFTFRlIllN..I.TION NEP..I. DFTFRlIllN..I.TION RECIPIENT:State of Nevada Office of Energy PROJECT TITLE: Nevada EECBG City $ubgrant: West Wendover Page 1 of2 STATE: NV Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA.ooooo13 EEOOOO687.001 EEO Bssed on my review of the information conccrning the proposed action, as NEPA Compliance Officu (Iuthorlzed under DOE Order 451.IA), I have made the (ollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical assIstance to Individuals (such as builders, owners, consultants, designers), organizations (such as utilities), and state

89

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com  

E-Print Network (OSTI)

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com APPLICATION

Lebendiker, Mario

90

Info Session for: All PHAS 2nd, 3rd, and 4th Year UG Students Provided by: UBC Department of Physics & Astronomy  

E-Print Network (OSTI)

Info Session for: All PHAS 2nd, 3rd, and 4th Year UG Students Provided by: UBC Department of Physics & Astronomy Held at: Hennings 201 Date: Tuesday, September 3th, 2013 Time: 11:00 a.m. to 14:30 p Dunning, Yingyu Yao 12:00 p.m. 2nd Year Student Session -- Hennings 201 Honours, Majors, Minors Programs

Plotkin, Steven S.

91

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 13th Annual ARC Conference  

E-Print Network (OSTI)

Director, Diesel Engine Engineering for GM Powertrain Dan Kapp Director, Powertrain R & A Ford Motor.S. Army TARDEC Rolf Dreisbach Head of Diesel and Powertrain Mechanics Engineering and TechnologyRegistration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia

Papalambros, Panos

92

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 15th Annual ARC Conference  

E-Print Network (OSTI)

matrix. Symposium I 10:45 - 12:00pm Diesel Engine Combustion 12:00 - 1:30 Lunch 1:30 - 2:45 EngineRegistration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia and Engineering Center (TARDEC) National Automotive Center (NAC) Automotive Research Center 2043 W.E. Lay

Papalambros, Panos

93

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7/23/2007 2:06 PM  

E-Print Network (OSTI)

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7 the PMU on a Mac mini and it still isn't displaying video or turning on, contact Apple technical support (1-800-APL-CARE in the U.S.) or take your computer to your local Apple Retail Store or Apple

California at Santa Barbara, University of

94

Voici donc le dernier numro de Gosciences-Infos avant l't. Un t sans rapport AERES rdiger... Mais avec quelques devoirs de vacances tout de mme, de faon tre tout--fait  

E-Print Network (OSTI)

édito Voici donc le dernier numéro de Géosciences-Infos avant l'été. Un été sans rapport AERES à

Demouchy, Sylvie

95

DEP.-\RTUENT OF ENERG Y EERE PROJECT MANAG EM ENT CENTER NEP.-I. DETEIU.lIN.-I.TION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

-\RTUENT OF ENERG Y -\RTUENT OF ENERG Y EERE PROJECT MANAG EM ENT CENTER NEP.-I. DETEIU.lIN.-I.TION Page 1 of2 RECIPIENT:Govemor's Energy Office STATE: CO PROJECf TITLE: COLORADO SEP ARRA - Geothermal Power Direct Use Grant - Town of Rico Funding Opportunity Announcement Number OE-FOA-OOOOO52 Procurement Instrument Number DE-EE0000082 NEPA Control Number GF0..()()()()()82 -009 elD Number o Based on my review of the inCormation concerning the proposed action, as N[PA Compliance Officer (authorized under DOE Order 451.1;\), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A 11 Technical advice and planning assistance to international, national, state, and local organizations. A9 Information gathering (including, but not limited to, literature surveys, inventories, audits), data analysis (including

96

FMAPropInfoStat  

NLE Websites -- All DOE Office Websites (Extended Search)

Proposal Gammasphere Checklist Proposal Gammasphere Checklist Experiment Title: Spokesperson: Spokesperson Contact: Alternate: Alternate Contact: Date/Time Submitted: PAC Cycle: 1. Gammasphere Operating Mode (check one): Coupled to FMA Standalone on APEX beamline No Preference 4. FMA Operation: Recoil Energy/charge > 4 MeV - D. Seweryniak Beam power > 6 watts - D. Seweryniak 2. Target Chamber: Gammasphere chamber - M. Carpenter Gammasphere target wheel - K. Lister Microball chamber - D. Sarantites FMA stand-alone chamber - D. Seweryniak 5. Focal Plane Detectors (check one): PPAC - D. Seweryniak Microchannel Plates - D. Seweryniak

97

Info Weapon Contest  

Science Journals Connector (OSTI)

One of the current paradigms on Ďwarí is the solubility of the frontlines and territory in general. Since the Second World War we have been living in the age of Ďtotal warí or Ďpure warí, as Paul Virilio has call...

Geert Lovink

1998-01-01T23:59:59.000Z

98

Exam #3 Info Sheet  

E-Print Network (OSTI)

The volume/surface area formulas for a cone, cylinder, and/or sphere will also be ... Lesson 24: (page 206) 51, 84. Lesson 25: (page 206) 39, 40, 50, 57, 59, 60,†...

Devlin, Patrick M

2014-11-14T23:59:59.000Z

99

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe C en LI2)  

E-Print Network (OSTI)

M= parcours maths MI= parcours math-info ( groupe C en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M M MI MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI Anglais MI mercredi MA TD Variable Complexe M 3.2 MA M M MI MI jeudi MA MA M M MI MI

Berger, Clemens

100

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe A en LI2)  

E-Print Network (OSTI)

M= parcours maths MI= parcours math-info ( groupe A en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M Anglais* M MI TP Programmation C PV202 MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI TP Projet Scientifique PV214 MI mercredi MA TD Variable

Parusinski, Adam

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

07/14/2005 03:15 PMEBSCOhost Page 1 of 9https://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2  

E-Print Network (OSTI)

.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2 11 page://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN

Spirtes, Peter

102

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info@ssci.com  

E-Print Network (OSTI)

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel. Founded in 1976 and headquartered in the metro-Boston area, SSCI has built a reputation for delivering Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info

Plotkin, Joshua B.

103

Gschwind Benot, Lionel Mnard, Thierry Ranchin, Lucien Wald, Paul Stackhouse, 2007. A proposal for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski and M. Romaniuk (Eds), Shaker Verlag,  

E-Print Network (OSTI)

for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski in Solar Radiation Beno√ģt Gschwind1 , Lionel M√©nard1 , Thierry Ranchin1 , Lucien Wald1 and Paul Stackhouse2 energies. This communication focuses on solar energy and more specifically on aspects in solar radiation

Boyer, Edmond

104

9/18/09 2:44 PMThunderbolts Forum View topic -Dark Energy may not actually exist Page 1 of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d  

E-Print Network (OSTI)

http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553 Forum · View topic - Dark Energy may not actually exist Page 3 of 12http://www.thunderbolts.info/forum/php

Temple, Blake

105

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM  

E-Print Network (OSTI)

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM Visit the Apple Store online (1-800-MY-APPLE), visit a retail location on an iMac (Early 2006), iMac (Mid 2006), iMac (Late 2006), or Mac mini (Early 2006): From the Apple menu

California at Santa Barbara, University of

106

RPP_info2013.dvi  

NLE Websites -- All DOE Office Websites (Extended Search)

1. 1. Introduction The collection of online information resources in particle physics and related areas presented in this chapter is of necessity incomplete. An expanded and regularly updated online version can be found at: http://library.web.cern.ch/particle physics information Suggestions for additions and updates are very welcome. † 2. Particle Data Group (PDG) resources * Review of Particle Physics (RPP) A comprehensive report on the fields of particle physics and related areas of cosmology and astrophysics, including both review articles and a compilation/evaluation of data on particle properties. The review section includes articles, tables and plots on a wide variety of theoretical and experimental topics of interest to particle physicists and astrophysicists. The particle properties section provides tables of published measurements as well as the Particle

107

PittsburghMap&Info  

NLE Websites -- All DOE Office Websites (Extended Search)

Pittsburgh, PA Area Hotel & Restaurants Pittsburgh, PA Area Hotel & Restaurants 9 10 31 4 7 8 South Hills Village 88 19 51 1 3 1 4 5 6 2 3 20 21 30 22 26 28 29 27 25 23 24 Curry Hollow Rd. Lebanon Church Rd. Allegheny Co. Airport 885 88 2 3 11 15 16 17 18 19 NETL Pittsburgh Site Pittsburgh, PA Century III Mall 12 13 14 15 16 51 Entrance Restaurants Hotels June 2009 Entrance to NETL See page 2 for listings CCAC South Campus 885 Hotels NETL Pittsburgh, PA 1. SpringHill Suites by Marriott 1000 Regis Ave 1. McDonald's 2251 Century Dr. 11. Boston Market 98 Clairton Blvd. (Rt. 51) 21. Taco Bell 2050 Lebanon Church Rd. Restaurants NETL Pittsburgh, PA 1000 Regis Ave. West Mifflin, PA 15122 412-653-9800 2. Hampton Inn 1550 Lebanon Church Rd. Pittsburgh, PA 15236 2251 Century Dr. West Mifflin, PA 15122 412-655-8825 2. Arby's 5205 Library Rd. Bethel Park, PA 15102 412-833-3733 3. Wendy's 98 Clairton Blvd. (Rt. 51)

108

Aps_notify Info Page  

NLE Websites -- All DOE Office Websites (Extended Search)

phones. In the US, email can be sent directly to most cell phones. Please contact your cell phone provider to retreive your address. Once you are subscribed, you can log in...

109

info disclosure-rocky mts  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

site is tritium. Impacted media. Affected media include surface and subsurface soils, air, and ground- water. Forest resources on the slopes adjacent to the site have also been...

110

Eddie Price Grad Student Info  

E-Print Network (OSTI)

Computers and Technology. If you have any questions, comments, or concerns about the computer system in the Math Department, you can contact Paul Kepley

111

ch1_General_Info  

NLE Websites -- All DOE Office Websites (Extended Search)

technology for the reuse of Carbon dioxide (CO 2 ) emissions from industrial sources for green energy products. This project would use CO 2 to grow algae for the production of...

112

nanofabricaTion A Resource for Nanoscience  

E-Print Network (OSTI)

for waveguides · MEMS angle, force, and tactile sensors · MEMS gas analysis systems · Microfluidic systems

Blanchette, Robert A.

113

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted Samson 17/04/2008 08:44:53 PMhttp://weblog.infoworld.com/archives/emailPrint.jsp?R=printThis&A=http://weblog.in...  

E-Print Network (OSTI)

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted SamsonPrint.jsp?R=printThis&A=http://weblog.in... Back to article Print this Where will Microsoft's green path lead? For months now, many of the hardware lengths to highlight their green products, plans, and corporate visions. Now the software behemoth

Loke, Seng W. - Loke, Seng W.

114

file://C:\Documents%20and%20Settings\rma\My%20Documents\CSEQ\we  

NLE Websites -- All DOE Office Websites (Extended Search)

Full data base of agricultural experiments used in this study. Full data base of agricultural experiments used in this study. Site ID 1 Tillage 2 Crop 3 Fertilizer (kg/ha/yr) Sample year Sampling Depth (cm) Depth increment (cm) 4 SOC (%) 4 SOC (g/m^2) KY01 n/a sod n/a 1975 0-5 5 2.70 KY01 n/a sod n/a 1975 5-15 10 1.39 KY01 n/a sod n/a 1975 15-30 15 0.79 KY01 n/a sod n/a 1980 0-5 5 3.81 KY01 n/a sod n/a 1980 5-15 10 1.73 KY01 n/a sod n/a 1980 15-30 15 0.90 KY01 n/a sod n/a 1989 0-5 5 3.11 KY01 n/a sod n/a 1989 5-15 10 1.41 KY01 n/a sod n/a 1989 15-30 15 1.11 KY01 CT corn 0 1975 0-5 5 1.33 KY01 CT corn 0 1975 5-15 10 1.24 KY01 CT corn 0 1975 15-30 15 0.68 KY01 CT corn 0 1980 0-5 5 1.25 KY01 CT corn 0 1980 5-15 10 1.38 KY01 CT corn 0 1980 15-30 15 0.78 KY01 CT corn 0 1989 0-5 5 1.31 KY01 CT corn 0 1989 5-15 10 1.55

115

file://C:\Documents%20and%20Settings\rma\My%20Documents\CSEQ\we  

NLE Websites -- All DOE Office Websites (Extended Search)

Analysis (http://cdiac.ornl.gov/programs/CSEQ/terrestrial/westpost2002/westpost2002.html). Carbon Dioxide Information Analysis Center, U.S. Department of Energy, Oak Ridge National Laboratory, Oak Ridge, Tennessee, U.S.A. Summary of agricultural experiments used in this study. Location *Crop or Tillage Prior history Duration (yr) **Treatment Depth (cm) ***‚ąÜSOC (g m -2 ) √Ös, Norway N/A (low N) N/A 31 3 yr cereal-3 yr row crop vs. cereal 20 -199 √Ös, Norway N/A (low N) N/A 31 2 yr ley-4 yr row crop vs. 3 yr cereal- 3 yr row crop 20 199 √Ös, Norway N/A (low N) N/A 31 4 yr ley-2 yr row crop vs. 3 yr cereal- 3 yr row crop 20 881 √Ös, Norway N/A (medium N) N/A 31 3 yr cereal-3 yr row crop vs. cereal 20 -171 √Ös, Norway N/A (medium N) N/A 31 2 yr ley-4 yr row

116

HealtHyCows-RMaMeeting tHuRsday,FebRuaRy14,2013  

E-Print Network (OSTI)

Service Agency, USDA Risk Management Agency, NOFA New Hampshire and private crop insurance agencies. Thank Services, New England Area Office. Some of the programs and services provided include: health certificate and parts of MA. The University of New Hampshire Cooperative Extension is an equal opportunity educator

New Hampshire, University of

117

Microsoft Office InfoPath - Form2  

NLE Websites -- All DOE Office Websites (Extended Search)

ACL Analytical Request ACL Analytical Request Analytical Chemistry Laboratory at Argonne National Laboratory Submitted by: Division: Date: Cost Code: Authorization: E-mail: Building: Phone: Report Results To: E-mail: Division: Description of Analytical Service Needed: (i.e. analysis methods, analytes of interest, project support) Quality Requirements: (i.e. detection limits, accuracy, regulatory holding times or data packages) Sample Description and Sample Origin: (i.e. general sample composition, approximate concentration of analytes) Potential Heath Hazard or Special Handling Required? Yes -- Provide Details ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ Submitter's Sample ID ACL Sample ID Suspect Radionuclides: Radioactivity: Yes No Suspect ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£

118

Microsoft Word - tchr_work_info.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

Number of teachers: Number of teachers: 3. Number of years teacher can participate: 4. Nature of academic year follow-up: 5. Remuneration received by teachers: 6. Major content focus of teacher work projects: Facility Characteristics 1. Special facilities: 2. Unique capabilities or attributes: 3. Core science mathematics, and technological competencies (e.g., applied and basic technologies, integration activities, product realization): Teacher Characteristics* 1. Education in scientific/technical discipline (major degrees): 2. Gender 3. Race, ethnicity 4. Years of teaching experience 5. Research Experience 6. Computer knowledge/experience 7. Courses currently teaching 8. Student ability level 9. Community type (urban/suburban/rural) 10. Community wealth (High/middle/low SES)

119

Microsoft InfoPath - nepa_19496.xml  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

67 67 Title: Replace Brine Disposal System Header to WH Brine Tanks Description: Subcontractor shall shall provide all labor, materials, tools, equipment, and supervision required to replace the existing brine disposal piping to the WH brine tanks with new cement lined piping and fittings, to be supplied by others as Government Furnished Equipment under WH-MM-767A. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following:

120

Magellan Info Session Professor Shahrokh Valaee  

E-Print Network (OSTI)

­ Provides student counselling support 3September 24, 2014 #12;Who Are We? Linda Espeut (Manager Mechanics Area 2 Electromagnetics and Energy Systems ECE314 ­ Fund. Of Electrical Energy Systems ECE320 Electronics: Switch-Mode Power Supplies BME595 ­ Medical Imaging ECE413 ­ Energy Systems & Distributed

Prodiæ, Aleksandar

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

TwitInfo: Aggregating and Visualizing Microblogs  

E-Print Network (OSTI)

traveled to the ASEAN conference and to NATO to work on issues in those parts of the world. He then spent

Pratt, Vaughan

122

Microsoft Word - Badging and Facility Info  

Office of Environmental Management (EM)

Subgroup Spring 2015 Meeting Page 1 Sponsor: EA-10 and EFCOG Host: Brian Barbero, NSTec Regulatory Enforcement Program Manager National Security Technologies, LLC Where:...

123

OSU Contact Info Stores Service Center  

E-Print Network (OSTI)

, and guestroom renovations in 2008 24 hour in-room dining Complimentary Business Center Complimentary WIFI in all public areas of the hotel Westin Workout Center and Westin Workout guestrooms Heavenly Beds in all guestrooms Laptop safes and refreshment centers in all guestrooms Starwood Preferred Guest

Jones, Michelle

124

Jurisdiction Members Contact Info Key Staffers  

E-Print Network (OSTI)

Legislative authorizing / oversight for: · Air pollution, including the Clean Air Act · Environmental research and development · Environmental regulation · Transportation policy · Water resources Majority: · Barbara Boxer (D (R-NE) · John Boozman (R-AR) Majority (Democrats): · Dirksen Senate Office Building, SD-410

125

Info-Greedy Sequential Adaptive Compressed Sensing  

E-Print Network (OSTI)

] (Ct)/H(F) and P[M = O(H(F))] = 1 - o(1). #12;k-sparse signal: windfarm example n wind turbines more general signal and noise model new algorithms: sparse measurement #12;Information theoretical in Algorithm 5. The following theorem shes the error bound. em V.1 (White Gaussian noise added prior

Xie, Yao

126

Info-Exch 2012- Thomas Johnson Presentation  

Energy.gov (U.S. Department of Energy (DOE))

EM Recovery Act Program Director Thomas Johnson gave a presentation on Recovery Act lessons learned at the 2012 Recovery Act Information Exchange.

127

MEPC 2014 Info Session Peter A. Beerel  

E-Print Network (OSTI)

development on diesel engines. · General Atomic expressed interest in development work with TPS-strings-attached" Grand Prize · Free legal services awards Housed in the Viterbi School of Engineering #12;Target VSoE Students MEPC motivation and goal · Engineering innovation central to address of big challenges MEPC Rules

Zhou, Chongwu

128

Fisher info and thermodynamics' first law  

E-Print Network (OSTI)

theory, that thermodynamicsí ?rst law (TFL) can bewhich is a ďFisherís thermodynamicsĒ ?rst-law: note that theone can derive thermodynamics ?rst law for the Fisher

Plastino, A; Plastino, A R; Soffer, Bernard H

2006-01-01T23:59:59.000Z

129

ARRA Project Info Combined 0112110.xls  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

(Lead (Lead Organization) DOE Grant Amount Non- Federal Cost Share Project Lead Organization Location (City) Project Lead Organization Location (State) Description Partners National Alliance for Advanced Biofuels and Bioproducts (NAABB) Led by the Donald Danforth Plant Science Center $44,036,473 $11,009,118 St. Louis MO Develop and demonstrate the science and technology necessary to significantly increase production of algal biomass and lipids, efficiently harvest and extract algae and algal products, and establish valuable conversion routes to fuels and co-products. These activities will accelerate the ability to overcome several key barriers identified in the Algal Biofuels Roadmap, including:

130

Enforcement InfoCenter | Department of Energy  

Office of Environmental Management (EM)

More Nuclear Safety Documents December 2, 2014 Consent Order, Battelle Energy Alliance - NCO-2014-02 Nuclear Safety Enforcement Consent Order issued to Battelle Energy...

131

Microsoft Word - Shipping Info_2014.docx  

NLE Websites -- All DOE Office Websites (Extended Search)

your shipment by the Career Fair: LANL Attn: Jeanette GallegosMary Anne With Bikini Atoll Road, SM-30 MS M714 TA-00, Bldg. 199 Los Alamos, NM 87545-0001 Questions:...

132

MATH 89 -SPRING 2012 Course Info  

E-Print Network (OSTI)

the speed of light. · Thought experiments and abstract description of implications of special relativity, the Doppler effect, and absolute vs. relative Motion. · Historical views leading up to Einstein. · Measuring. · Lorentz coordinates, light cones and a mathematical derivation of special relativity. · The equivalence

Marzuola, Jeremy

133

DOE  

Gasoline and Diesel Fuel Update (EIA)

DOE DOE /E/A- 0202( 83//Q J Sh or t-T er m En er gy O ut lo ok a to m Quar terly Proje ction s Febru ary 1983 Ene rgy Info rma tion Adm inist ratio n Was hing ton, D.C. t rt jrt .or t lor t lor t .lor t- ior t- ior t <.o rt ort . m .er m -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -T erm -T erm -T erm Nrm ue rgy En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y ^n erg y Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Sh ort -T erm 1 Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm

134

he Bush administra-tion has listed myriad  

E-Print Network (OSTI)

SURVEILLANCE: By dissembling random nuclear weapons in the stockpile and closely inspecting and testing explosives and nuclear materials at the Nevada Test Site to gather diagnostic information about weapons Nuclear Security Ad- ministration (NNSA), a division of the Energy Department, to scrutinize the nuclear

Rhoads, James

135

UW Box 354809 Seattle, WA 98195-4809 ph: 206.666.3406 fx: 206.666.3406 email: info@ccph.info web: www.ccph.info  

E-Print Network (OSTI)

decline, and threats of peak soil and peak oil, many communities are making paths to a brighter future

Chen, Tsuhan

136

Microsoft Word - SCI Sensitive Compartmented Info Final 032108.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ACCESS PROGRAM ACCESS PROGRAM Inspection Report Office of Intelligence and Counterintelligence Internal Controls Over the Department of Energy's Sensitive Compartmented Information Access Program DOE/IG-0790 March 2008 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries OFFICE OF INTELLIGENCE AND COUNTERINTELLIENCE INTERNAL CONTROLS OVER THE DEPARTMENT OF ENERGY'S SENSITIVE COMPARTMENTED INFORMATION ACCESS PROGRAM TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Background 3 Removal from SCI Roster 3 Administrative Debriefing 4 Employment Status Change 5 Incomplete Nondisclosure Agreements 6

137

Microsoft Word - ORNL ACREM INFO MEMO 050409.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report Internal Controls over Accountable Classified Removable Electronic Media at Oak Ridge National Laboratory INS-O-09-02 May 2009 Department of Energy Washington, DC 20585 May 4, 2009 MEMORANDUM FOR THE MANAGER, OAK RIDGE OFFICE FROM: Elise M. Ennis Assistant Inspector General for Inspections SUBJECT: INFORMATION: Inspection Report on "Internal Controls over Accountable Classified Removable Electronic Media at Oak Ridge National Laboratory" BACKGROUND The Department of Energy's Oak Ridge National Laboratory (ORNL) conducts cutting edge scientific research. ORNL utilizes removable electronic media, such as computer hard drives,

138

Microsoft Word - REMA Comments EIA_Agency_Info_Collection.doc  

Gasoline and Diesel Fuel Update (EIA)

1 Connecticut Ave NW, Suite 600 * Washington, DC 20036-2701 1 Connecticut Ave NW, Suite 600 * Washington, DC 20036-2701 202-640-6597 tel * 202-223-5537 fax * www.renewablemarketers.org Submitted via: ERS2014@eia.gov May 6, 2013 Ms. Rebecca Peterson U.S. Energy Information Administration Mail Shop EI-23 Forrestal Building 1000 Independence Ave SW Washington, DC 20585 RE: Comments of the Renewable Energy Markets Association on the Energy Information Administration's Agency Information Collection Extension Dear Ms. Peterson: The Renewable Energy Markets Association (REMA) is pleased to submit the following recommendations and comments in response to the Energy Information Administration's (EIA) call for improved industry data collection. REMA is a North American trade association dedicated to maintaining and growing strong

139

Microsoft InfoPath - NEPA_21124_306.xml  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

24A 24A Title: Replace BH Circuit Breakers OCB-4009, 4010 and 4011 (GFE) Description: Subcontractor shall provide all labor, supervision, tools, equipment, and transportation required to furnish three new 138 kV SF 6 circuit breakers to replace the existing BH oil circuit breakers OCB-4009, 4010 and 4011. This procurement will be Government Furnished Equipment (GFE) for installation by others. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following:

140

shiprock info sheet 08.20.13.cdr  

Office of Legacy Management (LM)

Shiprock, New Mexico, Disposal Site pond. Shiprock, New Mexico, Disposal Site pond. Tailings Cover Site After Cleanup Groundwater Shiprock Site Background 1951 Uranium found on Navajo Nation lands near Shiprock. 1952 Uranium-ore buying station is established in Shiprock. 1954 Mill is built in Shiprock. 1954-1968 Various companies operate the mill, processing uranium and vanadium ore. During milling operations, chemicals from mill tailings piles and ponds drain into the soil and groundwater. 1968-1973 Mill buildings and equipment are torn down. 1975-1980 Initial cleanup of materials from former milling operations. 1986 Mill tailings are put in a disposal cell and a cover is constructed over the materials. The disposal cell cover is a barrier that prevents radon gas from escaping and reduces the amount of water drainage through the cell.

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Sapienza Universit di Roma Centro InfoSapienza  

E-Print Network (OSTI)

'APPALTO Il valore contrattuale dell'appalto è pari a 2.093.000,00 (euro duemilioninovantatremila/00), IVA pari ad 3.000,00 (iva esclusa) di cui al "Documento Unico di valutazione dei rischi standard da sono ammesse offerte in aumento. Al Fornitore potrà essere richiesto un incremento o una diminuzione

Guidoni, Leonardo

142

IP Networking Lab http://inl.info.ucl.ac.be  

E-Print Network (OSTI)

Eduroam - Abuse scenario 12 Stockholms universitet UCL Internet user: Beck@SU.se Swedish Authority Belgian Belgium, Jan 2009 Eduroam - Abuse scenario 13 Stockholms universitet UCL Internet Swedish Authority Context : Open WiFi Roaming 3 H F Internet #12;ALAWN - Technical aspects D. Leroy, M. Manulis, F. Koeune

Bonaventure, Olivier

143

Home Fruit Spray Schedule Education Center & Info LIne  

E-Print Network (OSTI)

is followed, trees and small fruit plants should be reasonably free from insect and disease injury. This spray certain aphids, mites, scales, and pear psyllas on fruit trees. Copper soap (copper octanoate and situations where supplementary sprays or sanitation may be helpful. Diseases Black Knot of Plum and Cherry

New Hampshire, University of

144

SDS/forms/student info STUDENT CONTACT INFORMATION  

E-Print Network (OSTI)

: __________________________________________________________________ Residence Address: _______________________________________________________________ Cell Phone: _________________________________________________________________ _________________________________________________________________ _________________________________________________________________ Home Phone Number: _____________________________________________________ Cell Phone Number: _____________________________ Home Phone: ________________________ Email

Massachusetts at Lowell, University of

145

MINERvA Engineering Info for Director's 3b review  

NLE Websites -- All DOE Office Websites (Extended Search)

we also need to start construction of the Support Stand and Bookend for use in the cavern. These drawings are shown in: 8. Support Structure Ass'y (PDF 1748k) (controlled by J....

146

Purdue Extension 1-888-EXT-INFO  

E-Print Network (OSTI)

as a burndown before planting; used in-crop on Roundup Ready¬ģ soybeans, corn, alfalfa, cotton, and canola

147

ME 305, Course Info, p. 1 Mechanics of Materials  

E-Print Network (OSTI)

calculator Access to a computer with either MatLab or Octave installed Syllabus: See attached; some topics will be given unless these are completed. Any projects assigned will be regarded as part of the homework

148

INFO-FINANCES dition : Juin 2011 BULLETIN 25  

E-Print Network (OSTI)

://www.sf.ulaval.ca/ AApppprroovviissiioonnnneemmeenntt Contrat d'approvisionnement des gaz comprimés (gaz en cylindre) Le contrat actuel avec Praxair'exécutera une prise d'inventaire des cylindres sur le campus. La prise d'inventaire sera coordonnée par Praxair

Laval, Université

149

Constructing a Cleaner Economy Info Graphic | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

More Documents & Publications Strategies for the Commercialization & Deployment of GHG Intensity-Reducing Technologies & Practices Open Government Plan 1.0 Fiscal Year 2010...

150

ARRA Project Info Combined 0112110.xls | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

More Documents & Publications ARRA Projects Chart Missouri Recovery Act State Memo Texas Hydrogen Highway - Fuel Cell Hybrid Bus and Fueling Infrastructure Technology Showcase...

151

Supp. Info. Gentner/2002-09188B 1 Supplementary Information  

E-Print Network (OSTI)

in northern Indiana, transported in cages by car to the University of Chicago, and housed in large flight to food and water ad libitum while in the flight aviary. Subjects were naive to all the trainingHz to 10 Hz to 10 kHz over 2 s (2 s ISI, 10 s total duration). The peak power of all stimuli (song samples

Gentner, Timothy

152

Novembre -Dcembre 2013 -N 251 SUBAQUA InfosRecherche  

E-Print Network (OSTI)

's University de Belfast (Irlande du Nord), nous révèlent. On s'en doutait. Fallait-il encore le prouver. En- loureuse les conduisant à changer de stra- tégie, de parcours. L'expérience ayant été menée sur 90

Jacquet, Stéphan

153

Alternative Fueling Station Locator App Provides Info at Your...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fueling Station Locator website. It provides information on more than 15,000 public and private alternative fueling stations throughout the United States. The app lists where...

154

Info Vis Comp5048 lecture August 13 Tutorial: when?  

E-Print Network (OSTI)

in upper case are fixed and spaced regularly around a circle), and b. the Hooke's law spring method. A B,C,d,B,c f C,d,e,g g d,e,f 2. Find some code that computes force-directed layout. Test in on graphs with 10

Hong,Seokhee

155

TwitInfo: Aggregating and Visualizing Microblogs for Event Exploration  

E-Print Network (OSTI)

Microblogs are a tremendous repository of user-generated content about world events. However, for people trying to understand events by querying services like Twitter, a chronological log of posts makes it very difficult ...

Marcus, Adam

156

Info-Exch 2012- Sites Lessons Learned Presentation  

Energy.gov (U.S. Department of Energy (DOE))

Sites around the DOE complex funded by the EM Recovery Act Program provided lessons learned during the 2012 Information Exchange.

157

Start uw eigen web dialoog op www.lucide.info  

Science Journals Connector (OSTI)

Website Bent u bestuurder of toezichthouder bij een zorginstelling? Bent u alleen ge Ônteresseerd, of wilt u gewoon meepraten met de mensen die het in de zorg voor het zeggen hebben? Op de websit...

2014-03-01T23:59:59.000Z

158

tion and function of -sarcoglycan in neurons have not been investigated, and the mechanism by which  

E-Print Network (OSTI)

. Neurology 2000; 54:1746­1752. 13. Hack AA, Groh ME, McNally EM. Sarcoglycans in muscular dystrophy. Microsc. Proc Natl Acad Sci USA 1999;96:5173­5176. 3. Saunders-Pullman R, Shriberg J, Heiman G, et al. Myoclonus;56:1213­1216. 10. Danckwardt S, Neu-Yilik G, Thermann R, et al. Abnormally spliced -globin mRNAs: a single point

Kiper, Daniel C.

159

FOR STUDENTS // FEbRUaRy 2012 FOR EDUCaTION  

E-Print Network (OSTI)

basic Search (autocomplete) 10 Full Search 11 browsing Menus 12 PERFORMING aNaLySIS 12 Navigating Functions 13 Stock/Company Screening 14 analyzing a Company 15 analyzing an Index, bond or Currency 16 Ex sectors. It features company financials, market data spanning more than 20 years, charts, statistics

Banaji,. Murad

160

RESOLUTION NO. 2013 -110 RESOLUTION AMENDING THE TURLOCK IRRIGA TION DISTRICT'S  

E-Print Network (OSTI)

Owned Electric Utilities and the Turlock Irrigation District Renewable Resources Procurement Plan. NOW) with the TID Renewable Resources Procurement Plan. The TID Renewable Resources Procurement Plan, at minimum Compliance Period 1, January 1, 2011 to December 31,2013, TID shall procure renewable energy resources

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

WATER QUALITY DATA AND COLLECTION SUMMARY Water Monitorin site Descri tion  

E-Print Network (OSTI)

-ionized ammonia nitrogen, ammonia nitrogen, Total ~jeldahl Nitrogen, nitrate nitrogen, pH, total phosphorous seasonal concentrations were reported for carbon dioxide and six for bicarbonate alkalinity. Graphs were alkalinity, biochemical oxygen demand, carbon dioxide, chlo- rophyll a, chlorophyll b, chloride, color

Soerens, Thomas

162

2010 shanghai ExPo EDiTion soCiology graDUaTE Daisy  

E-Print Network (OSTI)

life for all. #12;1 06 13 ConTEnTs 02 BUilDing BriDgEs To China: Professor John hearn writes about Goodman's research into German adventurers in China, including architect Walther Frey who designed some at the Shanghai expo 16 whaT nExT for China: Chinese Ambassador Zhang Junsai and historian John Wong write about

Du, Jie

163

The end of the book offers recommenda-tions and suggestions for running and docu-  

E-Print Network (OSTI)

also use this book to ana- lyze the impact of innovations in their soft- ware development practices at the Fraunhofer Institute for Experimental Software Engineering in Kaiserslautern. Germany. Contact her at lopez of application systems tailored toward a particular prob- lem domain. We can express variability within

van Deursen, Arie

164

IN VESTIGATION OFN ON CON VEN TION HALL THRUSTER Raitse N.J. Fisch  

E-Print Network (OSTI)

with a cu p­type magne tic fie ld di tribution be e n inve tigate d. It e xhibit charge characte can also e scape along the magne tic fie ld line s [1]. The use of concave magne fie line of the magne tic fie profile state ­of­the Hall thruste now ope rate with e fficie ncie s (the ratio

165

High-Risk Groups The CenTer for TransporTaTion safeTy  

E-Print Network (OSTI)

measures of protection. Motorcyclists Ongoing careful analysis of motorcycle crash trends has provided a foundation for a statewide campaign to improve motorist awareness of motorcycles. The CTS also conducts professionals as well as motorcycle users. In the wake of these efforts, data suggest that motorcycle crashes

166

n Ja FISCH AND Cs Fr Ft KARNEV This work gas supparzed by the U, S, Departmecr of Snergp  

E-Print Network (OSTI)

, This difficulty can be circumvented, in theory, by generating the toroidal plasma current with radio-frequency (rf attractive regime of high-frequency waves. Con- clusions are based, in part, on the numerical solu- tion://charles.karney.info/biblio/fisch81.html #12;Current Generation with Low-Frequency Waves Nathaniel J. Fisch and Charles F. F. Karney

Karney, Charles

167

STATEMENT OF CON SID ERA TIONS REQUEST BY ABENGOA SOLAR INC. (ASI) FOR AN ADVANCE WAIVER OF  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ABENGOA SOLAR INC. (ASI) FOR AN ADVANCE WAIVER OF ABENGOA SOLAR INC. (ASI) FOR AN ADVANCE WAIVER OF DOMESTIC AND FOREIGN PATENT RIGHTS UNDER DOE AWARD NO. DE-FC36- 08G018037; W(A) 2011-61 ASI has requested a waiver of domestic and foreign patent rights of the United States of America in all subject inventions arising from its participation under the above referenced cooperative agreement entitled ''Development of Next-Generation Parabolic Trough Collectors and Components for CSP Applications." According to ASI's petition, the objective of the project funded by the cooperative agreement is "to develop the technology that is needed to build a competitive parabolic trough industry for the [U.S .] utility mru·ket." Specifically, the scope of work includes the "development of alternative collectors structures, components and field deployment teclmiques.

168

and Rybock et al. (1975), we believe that popula-tion differences do not explain the differences in  

E-Print Network (OSTI)

. This research was funded by Bonneville Power Administration, U.S. Depart- ment of Energy, Agreement No. DE-A179

169

In summary, larval settlement is a challenging proposi-tion in the rocky intertidal. Given the highly energetic,  

E-Print Network (OSTI)

. 2001. Supply-side ecology: the nature and consequences of variations in recruitment of intertidal distribution of light energy is important for both vision and photosynthesis, and can be affected by the medium of this variation, the aquatic near-shore environment is a challenging world for organisms that see, as well

Cummings, Molly E.

170

Full field investigation of salt deformation at room temperature: coopera-tion of crystal plasticity and grain sliding  

E-Print Network (OSTI)

, Germany. ABSTRACT: We observed with optical and scanning electron microscopy halite samples during Halite has been extensively studied both as a rock forming mineral with industrial applications (storage a renewed interest in studies of the mechanical behavior of halite under low stresses (Bérest et al., 2005

Paris-Sud XI, Université de

171

tions (Fig. 4). The layer thicknesses observed (a 0.90 m for the 400-m fibers; a  

E-Print Network (OSTI)

(1999). 17. Z. U. Borisova, Glassy Semiconductors (Plenum, New York, 1981). 18. A. K. Varshneya, J. Non (1970). 22. M. Bass, Ed., Handbook of Optics (McGraw-Hill, New York, 1995). 23. J. E. Mark, Ed., Polymer

Romanowicz, Barbara

172

tions (www.aip.org/pas). One of its pro-grams is suited for examining the phe-  

E-Print Network (OSTI)

in an electromagnetic analog of the spring oscillator--that is, in a series LCR circuit containing an inductor (a coil oscil- lations of a mechanical torsion-spring pendulum whose moment of inertia is subject to periodic- ments this article describes deal with a fa- miliar mechanical system--the torsion- spring oscillator

Butikov, Eugene

173

tion (21) and protonation state (22) of TyrL162 may be important for the mechanism of electron  

E-Print Network (OSTI)

oxygen from water. Crystal structures of photo- system II (30) reveal that TyrZ lies between the oxygen-evolving center and the special pair in a position functionally analogous to that occupied by TyrL162 of RCvirL162 may have aided the spontaneous formation of tyrosine radicals in an ancient reaction center

Blumberg, Bruce

174

Abstract In the present study, soil C and N mineraliza-tion and nutrient availability were compared: (1) in  

E-Print Network (OSTI)

losses of SOM can only be replenished in the short-term by application of organic matter such as ma- nure

Lehmann, Johannes

175

form processing specifically for use by vision applica-tions. The most fundamental of the planned extensions  

E-Print Network (OSTI)

, J. Brolio, A. Hanson, and E. Riseman, "The Schema System," International Journal of Computer Vision, "Detecting Runways in Complex Airport Scenes," Computer Vision, Graphics, and Image Processing, Vol. 51, No:McGraw Hill, 1975, Chapter 5. #12;Figure 10 Los Angeles International -- Excellent runway only. #12;Figure 9

Southern California, University of

176

Microsoft Word - info quality guidelines updated 3-7-11.docx  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

p p DEPARTMENT OF ENERGY Final Report Implementing Office of Management and Budget Information Dissemination Quality Guidelines AGENCY: Office of the Chief Information Officer, Department of Energy (DOE). ACTION: Notice. SUMMARY: DOE gives notice of the final report to the Office of Management and Budget (OMB) that contains final DOE guidelines setting forth policy and procedures to ensure and maximize the quality, utility, objectivity, and integrity of the information that DOE disseminates to members of the public. DOE has prepared this final report pursuant to OMB government wide guidelines under section 515 of the Treasury and General Government Appropriations Act for Fiscal Year 2001 (Act) (Pub.L. 106-554, 114 Stat. 2763). DATES: The guidelines in the final report to OMB are effective October 1, 2002.

177

MIT Plasma Science & Fusion Center: research>alcator>facility info  

NLE Websites -- All DOE Office Websites (Extended Search)

Density Physics Waves & Beams Technology & Engineering Useful Links Alcator C-Mod Criteria for Design of Vacuum Components This document is meant to be a guideline for design and construction of components that interface with the CMOD vacuum system. It does not intend to cover all situations but instead is designed to start one thinking about the problems encountered in constructing a successful device that will operate in the Alcator vacuum environment without causing any unwanted effect on the quality of that vacuum. Material Selection The Alcator vacuum vessel is made from 304L SS, as are most of the support devices and diagnostic assemblies in the vacuum. Other than Molybdenum on the limiters and in the divertor, this is the predominate material used in

178

Microsoft Word - Material_ChemEmissions_Info_LBNL_090810_final-2  

NLE Websites -- All DOE Office Websites (Extended Search)

Environmental Energy Technologies Division September 2010 Funding was provided by the U.S. Dept. of Energy Building Technologies Program, Office of Energy Efficiency and Renewable Energy under DOE Contract No. DE-AC02- 05CH11231; by the U.S. Dept. of Housing and Urban Development Office of Healthy Homes and Lead Hazard Control through Interagency Agreement I-PHI-01070, and by the California Energy Commission through Contract 500-08-06. Chemical Emissions of Residential Materials and Products: Review of Available Information Henry Willem and Brett C. Singer LBNL-3938E Chemical Emissions of Residential Materials and Products: Review of Available Information

179

GeneInfoMiner?a web server for exploring biomedical literature using batch sequence ID  

Science Journals Connector (OSTI)

......freely available over the Internet at http://brainarray...National Institute on Drug Abuse R21 DA13754-01 to F...al. 1999MedMiner: an internet text-mining tool for...National Institute on Drug Abuse R21 DA13754-01 to F...1999) MedMiner: an internet text-mining tool for......

Weijian Xuan; Stanley J. Watson; Fan Meng

2005-08-01T23:59:59.000Z

180

1http://info.anu.edu.au/hr/ Career Development GuiDe  

E-Print Network (OSTI)

and facilitator · career consultant · staff development consultant Hr Generalists Workforce planning · college/division Hr officer · college/division Hr consultant · workforce planning consultant · workforce planning · identifying appropriate professional development · creating a career development plan · improving your

Botea, Adi

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Online.Academy.edu/BuildingInfo Ads by Google August 1, 2010  

E-Print Network (OSTI)

According to a poll released July 27 America has nine of the most important green buildings in the world publication Architect Magazine listing the 'most important green buildings since 1980' were released on July 28. The poll was conducted amongst 150 leading green building experts including architects, engineers

182

EMERGENCY CONTACTS for DOWNER LAB Contact Phone After Hours Purpose/Additional Info  

E-Print Network (OSTI)

(Building-Related) 471-0043 471-2020 Plumbing/floods, fire sprinklers, heating/cooling, lighting, electrical whether to see a healthcare provider. For severe or potentially life-threatening medical or mental health

Shvets, Gennady

183

InfoTraffic Teaching Important Concepts of Computer Science and Math through Real-World Examples  

E-Print Network (OSTI)

Ruedi Arnold Inst. for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland rarnold@inf.ethz.ch Marc Langheinrich Inst. for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland langhein@inf.ethz.ch Werner Hartmann Center for Comp. Education PH Bern 3012 Bern, Switzerland werner.hartmann@phbern.ch ABSTRACT

184

Continuing Education examination available at http://www.cdc.gov/mmwr/cme/conted_info.html#weekly.  

E-Print Network (OSTI)

-pod laundry detergent exposures. Parents and caregivers should keep laundry detergent pods, as well as other was discharged 24 hours after the exposure. Poison center staff members fol- lowed up with the child's parents 4 of Potential Life Lost from Unintentional Injuries Among Persons Aged 0­19 Years -- United States, 2000

185

Organization Industry Majors Positions Info Sessions Job Fair Application Process/Interviews Baker Hughes  

E-Print Network (OSTI)

& Gas Service Company All Engineering majors, Engineering Technology, Geology, Mathematics, Physics Services Civil Engineering, Computer Science, Mechanical Engineering, Petroleum Engineering Full Time, Part Hughes Oilfield Service Company Internships, Full Time Sept 23, 8:30 PM Wood Center C/D Yes See job

Ickert-Bond, Steffi

186

Veterans and STEM Mentoring Programs- Info Session and Brown Bag Networking  

Energy.gov (U.S. Department of Energy (DOE))

January is National Mentoring Month. Join the Veterans Mentoring Program and the STEM Mentoring Program at DOE for information distribution and networking to meet current and potential mentors and...

187

Land Universitet Sprk OBS! Mer info Argentina Instituto Tecnologico de Buenos Aires Spanska Ej fr F  

E-Print Network (OSTI)

/Engelska Endast A Finland Tampereen Teknillinen Korkeakoulu Engelska / Finska Finland University of Lapland Engelska/Finska Endast ID Finland Oulun Yliopisto Finska/Engelska Finland √?bo Akademi Svenska Finland Aalto yliopisto Finland Lahti University of Applied Sciences (Lahti Yrkesh√∂gskola) Endast ID Finland Vaasan

188

Convergence of Bio Info Nano Eco: Global Public Goods and Economic Growth  

E-Print Network (OSTI)

This article is about convergence and why not. How about a ride to space in an elevator? Why not? A single nanotube could stretch from earth to the stratosphere and be able to support its own weight. This fact spurred NASA ...

Datta, Shoumen

2008-07-31T23:59:59.000Z

189

TravInfo Evaluation (Technology Element) Traveler Information Center (TIC) Study: Operator Response Time Analysis  

E-Print Network (OSTI)

Traveler Information Center (TIC) Study Operator Inte$aceTraveler Information Center (TIC) Study Operator ZnterjizceInformation Center (TIC) Study (Technology Evaluation

Miller, Mark A.; Loukakos, Dimitri

2000-01-01T23:59:59.000Z

190

Trav Info Evaluation (Technology Element ) Traveler Information Center (TIC) Study: System Reliability and Communications Interface  

E-Print Network (OSTI)

Traveler Information Center (TIC) Study (September 1996 -Information Center (TIC) Study (Technology EvaluationTraveler Information Center (TIC) Study: System Reliability

Miller, Mark; Loukakos, Dimitri

1998-01-01T23:59:59.000Z

191

Trav Info Evaluation ( Technology Element ) Traveler Information Center ( TIC ) Study: Operator Interface Analysis - Phase III  

E-Print Network (OSTI)

and evaluator visits to the TIC. The objective of this workthe different aspects of the TIC working environment. Thecontribute to or hinder the TIC operator’s job performance.

Miller, Mark; Loukakos, Dimitri

1998-01-01T23:59:59.000Z

192

[info:lanl-repo/lareport/LA-UR-14-27140] Proceedings of the Workshop...  

Office of Scientific and Technical Information (OSTI)

Library A permalink (or permanent link) is a URL that points to a specific record or resource. Permalinks remain unchanged indefinitely Permalinks are considered the best way to...

193

The Integrated Use of EMME/2 and Arc/Info -Practice in Lyon County, Minnesota  

E-Print Network (OSTI)

maps for these software are very difficult to find. The Geographic Information System (GIS), like Arc in a systematic way. Much effort has been invested in building GIS map databases at city, county and state level in recent years so we can get a digitized map in GIS format easily from the Internet. But the GIS software

Levinson, David M.

194

Providing a networked future for interpersonal information retrieval: InfoVine and user modelling  

Science Journals Connector (OSTI)

......proposes a novel approach for future Intranet commu- nication. A software system...therefore the presence of particular characteristics would imply that of others [30...the next version is to be run over the Intranet and accessed via the World Wide Web......

Clare F. Harvey; Peter Smith; Peter Lund

1998-05-01T23:59:59.000Z

195

Providing a networked future for interpersonal information retrieval: InfoVine and user modelling  

Science Journals Connector (OSTI)

......novel approach for future Intranet communication. A software...Abstract The Internet and Intranet provide the potential for...novel approach for future Intranet commu- nication. A software...related phenomenon of the technology gatekeeper. 2.1. Case......

Clare F. Harvey; Peter Smith; Peter Lund

1998-05-01T23:59:59.000Z

196

Lab-Corps Program info. session - Jan. 20, 2015 | Argonne National...  

NLE Websites -- All DOE Office Websites (Extended Search)

energy ---Nuclear energy modeling & simulation ---Nuclear fuel cycle ---Reactors -Energy usage --Energy storage ---Batteries ----Lithium-ion batteries ----Lithium-air...

197

info710 : Complements de bases de donnees TD 6 : decompositions et forme normale  

E-Print Network (OSTI)

) ; - R(A, B, C, D, E), avec F = {AC E, B D, AE BCD, DC} et = (ABC, CDE) ; Question 2. Est-ce que les 1 1 1 1 1 0 1 2 1 0 1 3 2 2 2 2 avec = (AB, BCD) ; - R A B C D E n n + 1 n + 2 n + 1 n + 3" : code unique de d¬īesignation d'un livre publi¬īe) - le Prix du livre. Les d¬īependances impos¬īees sont G

Hyvernat, Pierre

198

Microsoft Word - info quality guidelines updated 3-7-11.docx...  

Office of Environmental Management (EM)

Final Report Implementing Office of Management and Budget Information Dissemination Quality Guidelines (67 Fed Reg 62446) Final Information Quality Bulletin for Peer Review...

199

FINANCIAL INFoRmATIoN ANU ANNUAl RepoRt 2009 67  

E-Print Network (OSTI)

the Australian Radiation protection and Nuclear Safety Agency CDU Charles Darwin University CPAS Centre and Safety RAP Reconciliation Action plan SII Systemic Infrastructure Initiative UAI Universities Admissions

Botea, Adi

200

http://www.sord.nv.doe.gov/MEDAStationInfo-tng.htm  

National Nuclear Security Administration (NNSA)

Phone: Contact - (702) 295-1232 Fax - (702) 295-3068 http:www.sord.nv.doe.gov Report web page problems to: SORD Webmaster Date Modified: 031208 ||Home | Privacy Policy |...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

OpenEI: Datasets in the OpenEnergyInfo Data Repository  

DOE Data Explorer (OSTI)

The Open Energy Information initiative (OpenEI) is a platform to connect the world's energy data. It is a linked open data platform bringing together energy information to provide improved analyses, unique visualizations, and real-time access to data. OpenEI follows guidelines set by the White House Open Government Initiative , which is focused on transparency, collaboration, and participation. OpenEI strives to provide open access to this energy information, with the ultimate goal of spurring creativity and driving innovation in the energy sector.[Copied from the OpenEI Wiki main page]. It features a wiki, a blog, a list of information gateways, and a browsing list of deposited data sets.

202

1 Health Gov Info.doc HEALTH-RELATED GOVERNMENT INFORMATION & STATISTICS  

E-Print Network (OSTI)

.gc.ca/publicat/sars-sras/naylor/index-eng.php · Building on Values: The Future of Health Care in Canada (Romanow report) http://dsp-psd.pwgsc.gc.ca/Collection/CP32-85-2002E.pdf · A Framework for Reform: Report of the Alberta Premier's Advisory Council on Health listing, check out the `publications' list at URL: http://www.health.alberta.ca/newsroom/pub-health-care

Abolmaesumi, Purang

203

www.reteortibotanicilombardia.it info@reteortibotanicilombardia.it con il contributo di  

E-Print Network (OSTI)

'invisibile... - a cura di Barbara Meani. ore 17.00 "SugheriAMO" - laboratorio creativo per bambini e famiglie - I tappi

De Cindio, Fiorella

204

Discrete Math, 10th day, Friday 7/9/04 REU 2004. Info  

E-Print Network (OSTI)

to Cauchy's functional equation (CFE)? Clearly, f(x) = cx is a solution. We will make several observations: if f satis#12;es CFE then 1. f(0) = 0. (Why?) 2. Let c := f(1). Then (Vx P Z)(f(x) = cx). 3. f (p)(f(x) = cx). Exercise 10.4. If f is a solution of CFE and it is bounded in an interval then (Vx)(f(x) = cx

Babai, László

205

EE 744 Coding Theory and Spread Spectrum Class Info: Meeting time: 2:20-3:40 Tuesday and Thursday  

E-Print Network (OSTI)

. Fundamentals of Codes, Graphs, and Iterative Decoding, Kluwer, 2003. Objectives: By the end of the semester you student handbook. The penalties for cheating and plagiarism are defined in the handbook. Web Site: A web

Joiner, Laurie L.

206

http://www.illegal-logging.info/item_single.php?item=document&item_id=21&approach_id=26  

E-Print Network (OSTI)

change, 1990-2000 Annual change (%) Global total 3,963,429 3,869,455 -9,391 -0.22 Source: FAO 2001 #12 of deforestation, compiled by the FAO, suggests global forests are disappearing at a rate of 0.2% per annum accounted for 25-50% of global imports for several important timber products in 2000. A large, though

207

L:\\RHtoUGRD\\transfer general info\\RHAG-UGRD Procedures December 2012 RATCLIFFE HICKS SCHOOL OF AGRICULTURE  

E-Print Network (OSTI)

OF AGRICULTURE TRANSFER PROCEDURES Ratcliffe Hicks students may apply to transfer into the College of Agriculture degree requirements to graduate from the Ratcliffe Hicks School of Agriculture (RHAG) to transfer School of Agriculture Office of Academic Programs #12;

Alpay, S. Pamir

208

Organizing Off-Campus Networking/Recruiting Info: 3 Popular Approaches (Tips compiled from Erb and other SNRE students)  

E-Print Network (OSTI)

: Create a folder on your hard drive for each company to track notes from each conversation, your exact and networking priorities for each company · Each company on a diff tab in greater depth · Field headings: firmMind, , MindMapping, MindJet, plenty of other free and online tools via a google search on "Mind Mapping" o

Edwards, Paul N.

209

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network (OSTI)

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

210

Pouze informativn! Zvazn podmnky pijmacho zen viz https://is.cuni.cz/studium/podprij/index.php?do=info&fakulta=11320  

E-Print Network (OSTI)

Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php/2012 Praha 2010 #12;2 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php ISBN 978-80-7378-125-5 #12;3 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php

Cerveny, Vlastislav

211

Presented in Randolph Center, VT and West Lebanon, NH by UNHCE Geospatial Outreach Program Course info and registration online  

E-Print Network (OSTI)

: ArcGIS 10 Topics covered: Creating GIS maps GIS techniques GIS data maintenance $495 standard $349 to ArcGIS 10. Participants learn how to use ArcGIS 10 to produce attractive, effective maps. Data processing and data editing techniques are covered, as well as, new techniques for mapping and sharing GIS

New Hampshire, University of

212

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network (OSTI)

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S040:00-10:00 Genome 361 10:00-11:00 GS-ITS 11:00-12:00 Genome 351 TA Office Hours 12:00-1:30 Genome 361 TA Mtg 3:00-12:00 Genome 351 TA Office Hours 12:00-1:30 Genome 361 TA Mtg 3:00-4:00 D. Skelly 10:30-12:00 Genome 541 1

Kaminsky, Werner

213

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network (OSTI)

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S330 Lab 4 5 6 7 8 9:30-11:30 Brewer Lab 11:30-12:30 T. Lemus 9:00-10:00 Managers Mtg 10:30-12:30 Waterston:00-3:00 Blimes 9:30-11:30 Brewer Lab 3:00-5:00 O. Serang Dissertation 9:00-10:00 Managers Mtg 10

Kaminsky, Werner

214

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network (OSTI)

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S110 Monday Tuesday Wednesday Thursday Friday 1 9:00-10:00 E. Torskey 10:00-11:30 NWGC Mtg 11:30-12:30 E:00-11:30 NWGC Mtg 12:00-1:30 PopGenLunch 11 12 13 14 15 1:00-2:20 Genome 599A 3:30-4:50 Genome 475 9

Kaminsky, Werner

215

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network (OSTI)

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S230 Informatics 2:00-3:00 Admin Staff Mtg 4:00-5:00 N. Cameron 10:00-11:00 NWGC Comp 1:00-2:00 Nickerson Lab 2 11 12 13 14 15 12:00-1:00 PostDoc Mtg 1:00-2:00 W. Swanson 2:00-3:00 Nickerson Lab 10:00-11:30 Manoil

Kaminsky, Werner

216

NCBI Handout Series | CDD | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov CDD: Conserved Domain Database  

E-Print Network (OSTI)

.ncbi.nlm.nih.gov/pub/mmdb/cdd/ Searching CDD with text query Entering a set of query terms in the search box and pressing the "Search and is extensively linked with other NCBI data. CDs can be found by direct text searching from the CDD homepage is represented in scoremat format and these scoremats have been made available for search with a pro- tein query

Levin, Judith G.

217

NCBI Handout Series | SRA | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov SRA: Sequence Read Archive  

E-Print Network (OSTI)

the Entrez SRA page by entering desired terms and clicking the "Search" button (A). Complex que- ries can the "Edit" link (F) so that custom terms, such as history #, can be entered. Clicking the "Add to history can be browsed, searched and downloaded from its homepage at www.ncbi.nlm.nih.gov/sra/ and www

Levin, Judith G.

218

IEEE TRANSACTIONS ON COMPUTERS, VOL. 47, NO. 10, OCTOBER 1998 1073 The InfoPad Multimedia Terminal: A Portable  

E-Print Network (OSTI)

designed for portable stand-alone operation. The requirements to reduce the weight and energy consumption- sary to reduce the energy consumption, weight and cost of the end-user device as much a the terminal to have the port- ability of a paper notebook (1 lb, 8.5" x 11") while still being able to support

Han, Richard Y.

219

HOME NEWS SPORTS BUSINESS OPINIONS ENTERTAINMENT HEALTH TRAVEL INFO CLASSIFIED ADSLong Beach, CA, 12/21/2006 Advertisement  

E-Print Network (OSTI)

, 12/21/2006 Advertisement del.icio.us Digg Reddit YahooMyWeb Google What's this? L.B. Port pollution to be studied Researchers hope to find source of pollutants detected in nearby areas. By Kristopher Hanson agency are teaming up to capture and test the origin of tiny pollution particles floating around harbor

Valero-Cuevas, Francisco

220

postdoc:Postdoc Program:Career Fair:2013:Shipping Info_2013.docx Shipping Information and Display Setup  

E-Print Network (OSTI)

address: Los Alamos National Laboratory (LANL) Attn: Jeanette Gallegos/Mary Anne With Bikini Atoll Road

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

STATEMENT OF CON SID ERA TIONS REQUEST BY 3M COMPANY ("3M") FOR AN ADVANCE WAIVER OF PATENT RIGHTS  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3M COMPANY ("3M") FOR AN ADVANCE WAIVER OF PATENT RIGHTS 3M COMPANY ("3M") FOR AN ADVANCE WAIVER OF PATENT RIGHTS UNDER DOE GRANT NO. DE-FG36-08G018134; W(A) 2011-039 3M has requested a waiver of patent rights of the United States of America for all subject inventions arising from its participation under the above referenced grant entitled "Energy Reduction and Advanced Water Removal via Membrane Solvent-Extraction Technology." 3M has developed a membrane solvent-extraction (MSE) technology that shows promise to substantially decrease the energy and water consumption in the production ofbioethanol. The project funded by this grant furthers concept development and technology development and verification at the pilot scale. The project will refine the membrane, modules, and solvent

222

Volume 25. tionScrvica,Univeraity of B.C., Number 21. , Vancouver, B.C. VtX 1W5,  

E-Print Network (OSTI)

of transport phenomena in metallurgicalprocesses." Earlier this year the institute presented him with its of the chemical engineering department. Cancer agents in food subject of UBC research UBC scientists and the establishmentof guidelines for student evaluationof courses and teaching, and for the use and distribution

Farrell, Anthony P.

223

The purpose of this file (always under construction) is to provide correc-tions and references to further developments regarding the material in the  

E-Print Network (OSTI)

, Dammame, Allouche, Berthe, Denis takes the results further. 3. (3) (Gauss, Inv 88): (Updates) For A

Zakharov, Vladimir

224

The purpose of this file (always under construction) is to provide correc-tions and references to further developments regarding the material in the  

E-Print Network (OSTI)

, Dammame, Allouche, Berthe, Denis takes the results further. 3. (3) (Gauss, Inv 88): (Updates) For A, other volume, Anderson's papers in Duke, JNT, Dammame's thesis a

Zakharov, Vladimir

225

Hydrolysis of DFP and the Nerve Agent (S)-Sarin by DFPase Proceeds Along Two Different Reaction Pathways: Implica-tions for Engineering Bioscavengers  

SciTech Connect

Organophosphorus (OP) nerve agents such as (S)-sarin are among the most highly toxic compounds that have been synthesized. Engineering enzymes that catalyze the hydrolysis of nerve agents ( bioscavengers ) is an emerging prophylactic approach to diminishing their toxic effects. Although its native function is not known, diisopropyl fluorophosphatase (DFPase) from Loligo vulgaris catalyzes the hydrolysis of OP compounds. Here, we investigate the mechanisms of diisopropylfluorophosphate (DFP) and (S)-sarin hydrolysis by DFPase with quantum mechanical/molecular mechanical (QM/MM) umbrella sampling simulations. We find that the mechanism for hydrolysis of DFP involves nucleophilic attack by Asp229 on phosphorus to form a pentavalent intermediate. P F bond dissociation then yields a phosphoacyl enzyme intermediate in the rate-limiting step. The simulations suggest that a water molecule, coordinated to the catalytic Ca2+, donates a proton to Asp121 and then attacks the tetrahedral phosphoacyl intermediate to liberate the diisopropylphosphate product. In contrast, the calculated free energy barrier for hydrolysis of (S)-sarin by the same mechanism is highly unfavorable, primarily due to the instability of the pentavalent phosphoenzyme species. Instead, simulations suggest that hydrolysis of (S)-sarin proceeds by a mechanism in which Asp229 could activate an intervening water molecule for nucleophilic attack on the substrate. These findings may lead to improved strategies for engineering DFPase and related six-bladed -propeller folds for more efficient degradation of OP compounds.

Wymore, Troy W [ORNL] [ORNL; Langan, Paul [ORNL] [ORNL; Smith, Jeremy C [ORNL] [ORNL; Field, Martin J. [Institut de Biologie Structurale Jean-Pierre Ebel] [Institut de Biologie Structurale Jean-Pierre Ebel; Parks, Jerry M [ORNL] [ORNL

2014-01-01T23:59:59.000Z

226

38 coMMunicaTions of The acM | FeBRuARY 2012 | VoL. 55 | No. 2 illustrationbyandriJborysassociates  

E-Print Network (OSTI)

. Even less safety-crit- ical software has problems. The com- puter I am using to write this column #12Jborysassociates DOI:10.1145/2076450.2076463 Marvin V. Zelkowitz Viewpoint what have we Learned about Software Instead of Healing--A Radiation Setting Is Wrong, and Patients are Harmed."a I did not immediately learn

Zelkowitz, Marvin V.

227

inverter. He is the author or co-author of more than 300 publica-tions in his research fields including the book `Control in Power  

E-Print Network (OSTI)

W, the induction generator is favored for small hydro and wind power plants. More recently, with the widespread use Power Electronics Society NEWSLETTER 19 Induction Generators for Small Wind Energy Systems M. Godoy solution for such applications [1]. For its simplicity, robustness, and small size per generated k

Sim√Ķes, Marcelo Godoy

228

When Pfizer Met McDreamy: A Classic American Love Story Between Medicine and the Media  

E-Print Network (OSTI)

Jordan, 2003 Pharmaceutical Industry. In Companion toPhRMA the pharmaceutical industryís lobbying organization.loosened for the pharmaceutical industry but the information

Bodoh-Creed, Jessica Anne

2013-01-01T23:59:59.000Z

229

Designing a High Performance OpenSHMEM Implementation using Universal Common Communication Substrate as a Communication Middleware  

SciTech Connect

OpenSHMEM is an effort to standardize the well-known SHMEM parallel programming library. The project aims to produce an open-source and portable SHMEM API and is led by ORNL and UH. In this paper, we optimize the current OpenSHMEM reference implementa- tion, based on GASNet, to achieve higher performance characteristics. To achieve these desired performance characteristics, we have redesigned an important component of the OpenSHMEM implementation, the network layer, to leverage a low-level communication library designed for imple- menting parallel programming models called UCCS. In particular, UCCS provides an interface and semantics such as native atomic operations and remote memory operations to better support PGAS programming models, including OpenSHMEM. Through the use of microbenchmarks, we evaluate this new OpenSHMEM implementation on various network metrics, including the latency of point-to-point and collective operations. Furthermore, we compare the performance of our OpenSHMEM imple- mentation with the state-of-the-art SGI SHMEM. Our results show that the atomic operations of our OpenSHMEM implementation outperform SGI s SHMEM implementation by 3%. Its RMA operations outperform both SGI s SHMEM and the original OpenSHMEM reference implemen- tation by as much as 18% and 12% for gets, and as much as 83% and 53% for puts.

Welch, Donald A [ORNL] [ORNL; Shamis, Pavel [ORNL] [ORNL; Gorentla Venkata, Manjunath [ORNL] [ORNL; Poole, Stephen W [ORNL] [ORNL; Tony, Curtis [University of Houston, Houston] [University of Houston, Houston

2014-01-01T23:59:59.000Z

230

WELLBEING RESOURCE GUIDE http://info.anu.edu.au/hr/anu-staff-wellbeing. Enquiries: Nicki.read-Jones@anu.edu.au Wellbeing Consultant x58943  

E-Print Network (OSTI)

/187/ For information and assistance in the ACT contact (02) 6207 9977 http://www.drugs.health.gov.au/internet of the illness call 02 6232 9044 Centrelink http://www.centrelink.gov.au/internet/internet affected by domestic violence call 02 6280 0900 Elder Abuse http://www.eapa.asn.au/ Information

Botea, Adi

231

Pacific Institute 654 13th Street, Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org  

E-Print Network (OSTI)

). Including air pollution as a screening criterion acknowledges the health impacts borne by Californians pollution and reducing public health impacts. Including air pollution as a screening criterion provides will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific

232

SJSU Information Support Services Create Contracts for 12-Month Appointment info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

. Note Data about the position will populate. Term Enter the fall term of the current year in a four demonstrates how to create a contract for a 12-month appointment by entering effective dates that encompass hyperlink. 3. Click the CSU Contract Data hyperlink. The CSU Contract Data search page displays. 4. Click

Su, Xiao

233

SJSU Information Support Services Run Batch Contracts for Temporary Faculty info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

page displays. 5. Term: Use the lookup button to search the appropriate term. 6. Due Date: (optional data that exists in the system for the temporary faculty will appear on the Contract Appointment letter/Terms. 2. Click Batch Contracts for T. Faculty. The Batch Process for TF Contract search page displays. 3

Su, Xiao

234

SJSU Information Support Services Hire a Teaching Associate or Graduate Assistant info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

displays. 1. From the Main Menu, click the CSU ID Search hyperlink. 2. Enter any known search criteria. 3 Name Description Enter the Position Click the lookup icon to perform search, if unknown. When you click the tab or outside of the field, position data will populate. Term Enter term in a four-digit format

Su, Xiao

235

SJSU Information Support Services SR102: Basic Records Processing II info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

this option, skip step 11. The Enter Search Criteria page displays. 9. Enter the Course Subject-924-1530 Page 5 The Enter Search Criteria page displays. 11. Enter at least two criteria and then click. Once students are term activated and assigned a registration appointment time, they can enroll

Su, Xiao

236

SJSU Information Support Services Rehire a Part-Time Temporary Faculty, TA or GA info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network (OSTI)

of the contract. Contract Desc Enter a name for the contract. Include the Last Name, Dept Name and Term. Example of the field, position data will populate. Term Enter term in a four-digit format. Example: 2054 = Fall 2005 if the person is a Late Start or Early Termination. (Enter L for Late Start. Enter E for Early Term). Number

Su, Xiao

237

SLU, Box 58, SE-230 53Alnarp, Sverige tel: +46 (0)40-4150 00 Org.nr 202100-2817 info@slu.se  

E-Print Network (OSTI)

to such questions of sustainable urban development, for instance, when it comes to the importance of green areas continually threatened by building development. Conflicts over land use are expected to increase further sustainable development. The exchange of experiences with other key future research areas has thus far been

238

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network (OSTI)

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

239

NASA Space Craft Contest -Artist Info -2D Original, Pg. 1 Information includes title of artwork, artist name and Etsy shop  

E-Print Network (OSTI)

ROBOTS Dylan Strzynski dylanS.etsy.com Orrery Alisha Gould alishagould.etsy.com Moon Tile Kelly Cook Cookstah.etsy.com Wayfinder - Light Reactive Painting Shayla Maddox shaylamaddox.etsy.com The Wonders Painting W. Brent Wear brentwear.etsy.com High Texture Embroidered Moon Rachel B. Hobson Rachel

240

G:\\Insurance\\WPS14-15\\Info\\Web\\Healthmain.Docx Rev 5-12-14 Medical College of Wisconsin Affiliated Hospitals  

E-Print Network (OSTI)

Subscriber" 2. Enter your Member # 3. Click "continue" and Start your Provider Search Or, Call WPS Customer a standardized template utilizing a uniform glossary of terms and can be used to compare this benefit plan to other benefit plans available to you. Note: Exact details and coverage are subject to the terms

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

www.westlothianonline.infoWEST LOTHIAN COUNCIL DELIVERS www.westlothian.gov.ukWEST LOTHIAN COUNCIL DELIVERS EXCELLENCE IN PUBLIC SERVICES  

E-Print Network (OSTI)

.17 102.38 100.62 101.87 99.74 99.74 99.97 99.76 99.74 99.75 99.67 99.57 99.58 99.50 99.68 99.5199.54 99

Heal, Kate

242

Destination Palo Alto -Lodging http://www.destinationpaloalto.com/pages/lodging.php?visitor_info_id=8[7/27/2011 10:00:32 AM  

E-Print Network (OSTI)

, restaurant, bar Complimentary: parking, Internet in guest rooms $99-$399 AAA Each furnished guestroom has

Quake, Stephen R.

243

MyEmployeeInfo Help Sheet (rev 01/05) 1) Please select a web browser from your desktop. We recommend the following browsers based on the  

E-Print Network (OSTI)

may find the icon browser on the desktop or from the Start menu (generally in the bottom left corner) under Programs. Internet Explorer Icon Firefox icon Safari icon Konqueror 2) In the address field) Channel Controls (i.e. Section Headings) Focus / Un-focus The focus icon will hide the rest

244

LASLO EVERS | Change Password | Change User Info | CiteTrack Alerts | Subscription Help | Sign Out Editors' Choice: Highlights of the recent literature  

E-Print Network (OSTI)

-barometer to reduce noise from atmospheric wind. Evers and Haak report detection on 8 November 1999 of a discrete 0 that such propellers or turbines can be integrated into more complex devices. As an example, they prepare a light

Evers, Läslo G.

245

Suggested Search Terms Try searching a few of the phrases provided in PsycINFO and ABI/INFORM, and use appropriate  

E-Print Network (OSTI)

fit and Empirical organizational change and resistance learning organization organizational learning organizational learning job satisfaction motivation and employees personality traits and job

Abolmaesumi, Purang

246

NCBI Handout Series | Structure | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov The Structure Database from NCBI  

E-Print Network (OSTI)

) and relevant resources (C). A search can be performed by entering a set of terms in the search box and clicking through the Entrez search and retrieval system using a web browser (www structure records using the Vector Alignment Search Tool (VAST). A web service for this tool is available

Levin, Judith G.

247

NCBI Handout Series | dbGaP | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov dbGaP: Database of Genotype and Phenotype  

E-Print Network (OSTI)

a central entry point to access the data from this database. Entering terms in the search box and clicking the Search button (A) performs a search against this database. In the body of the homepage, Getting Started Results Browser (H). Integrated searches for phenotype and genotype data can be done using the Phenotype

Levin, Judith G.

248

HowTo-update-MyAccess-personal-info.docx:06/19/2012 1 of 2 How to update your personal information in MyAccess ...  

E-Print Network (OSTI)

. Below are a few steps that will help you. 1. go to web site: http://myaccess.wvu.edu/ - click on "Login

Mohaghegh, Shahab

249

EIHereu as second class matter at New York, N. Y., Jail. 7. 1928. Evol\\1tion P\\1b!. Corp., 96-Sth Ave., N. Y. GREAT SPIRAL STAR-CLOUD IN ANDROMEDA  

E-Print Network (OSTI)

the universe. The first scientific theory of the origin of our solar system goes back to the philosophers Kant was first conceived, it was thought to have two kinds of evidence in its favor, first, features in our solar attraction of each particle for every other. Thus the outermost planet was first formed. In the same way

250

08853010/$25.00 2010 IEEE 1673IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 57, no. 7, jUly 2010  

E-Print Network (OSTI)

. Introduction Minimizing the size of electrical servo-drives used in small-scale actuation has become for the dynamics of a thin piezoelectric plate in an electric field is presented. This PDE model is discretized via of an intuitive inter- pretation in terms of electrical circuits, may be a better choice in control situations. I

Pugh, Mary

251

08853010/$25.00 2009 IEEE 213IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 56, no. 1, JanUary 2009  

E-Print Network (OSTI)

. Introduction quarter-wavelength acoustic matching layers be- tween the piezoelectric ceramic to obtain a homogeneous composite thin matching layer with high powder loading using submicron powders pro- cess using metal particles dispersed in a polymer matrix cannot be used for the fabrication

Cao, Wenwu

252

ECEEE 2011 SUMMER STUDY EnERgY EffiCiEnCY fiRST: ThE foUnDaTion of a low-CaRbon SoCiETY 2037 The significance of difference  

E-Print Network (OSTI)

The significance of difference: Understanding variation in household energy consumption Janine Morley School@comp.lancs.ac.uk Keywords socio-technical, energy behaviour, interaction, consumption dynamics, demand patterns, domestic energy, electricity use, households, end-use consumption, practices, practice theory Abstract Studies

Hazas, Mike

253

08853010/$25.00 2010 IEEE 2522 IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 57, no. 11, novEmbEr 2010  

E-Print Network (OSTI)

(saFT), which was introduced in ultrasonic nondestructive test- ing (ndT) in the early 1970s [1] and has been in wide use since the late 1980s. In basic saFT, a synthetic ar- ray is emulated in post depth-of-field. The early versions of saFT were time domain imple- mentations, followed later

254

IEEE TransacTIons on UlTrasonIcs, FErroElEcTrIcs, and FrEqUEncy conTrol, vol. 58, no. 5, May 2011 1037 08853010/$25.00 2011 IEEE  

E-Print Network (OSTI)

(SAFT) is used to create focused images from ultrasound scans. SAFT has traditionally been applied only the use of SAFT to multilayer structures. In this article we present a similar fo- cusing algorithm called (saFT) [8]. although the time-domain delay-and-sum method was the starting point, frequency domain

255

Resilience by design for cloud services  

E-Print Network (OSTI)

adapted from the industry-standard technique known as Failure Mode and Effects Analysis (FMEA)1 the industry-standard process known as FMEA have been adapted to create a Resilience Modeling and Analysis (RMA

Chaudhuri, Surajit

256

E-Print Network 3.0 - astrobiology education poster Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

David Catling, UW... Astrobiology, and & Mark Claire, UW Astronomy 2:30 P.M., Rm.A-118, PAA "Biogeochemistry and photochemistry... in its services, programs, activities, education...

258

The Honorable Bill Johnson j.  

Office of Legacy Management (LM)

- Department of En&gy, - Department of En&gy, Washington, DC 20585 \APR 0 3 7995 The Honorable Bill Johnson j. 30 Church Street, Rochester, New-York 14614 / Dear MayorJohnson: 'I Secretary of Energy Hazel O'Leary has announced a'nei approach to openness in the Department of'Energy (DDE) and its communications with the public. In, support of this initiative, we are pleased to forward the enclosed info&tion related to the former University of. Rochester site in, your jurisdiction performed work for DOE or its predecessor agencies. Thins information is provided for your information, use, and retqntion. DDE's Formerly Utilized SitesRemedial Action Program.isI responsible for identification of sites used by DOE's predecessor agencies, determining current 'radiological condition.'and, where, it has authority, performing

259

Environmental Management American Recovery & Reinvestment Act...  

Office of Environmental Management (EM)

project reviews to track and monitor project performance and foresee any challenges. Info-Exch 2012 - Thomas Johnson Presentation Info-Exch 2012 - Shirley Olinger Presentation...

260

Slide14 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

In Summary: Three Points on Nano Info Diffusion In Summary: Three Points on Nano Info Diffusion. Link to larger image. Modeling - It's possible. Metadata - numeric data, unlike...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Collaboration Is Imperative Info Age OSTI TIO STIM OR Info Age STIM TIO OSTI Program Manager Researcher Together we can achieve more (with less) than we can individually....

262

MA 16100  

E-Print Network (OSTI)

Course Info. Syllabus ∑ Emergency Preparedness Syllabus Attachment ∑ Course Calendar ∑ Assignment Sheet. Resources. Online Graphing Calculator ∑ Past†...

263

Calculus For Technology II  

E-Print Network (OSTI)

MA 22200, Spring 2012. Calculus For Technology II ... Other Information. Emergency procedures ∑ Exam info (A Hoffman)†...

264

e-mail: inikol@aueb.gr : 210 8203121  

E-Print Network (OSTI)

International Airport, Schneider Electric, Siemens, TOYTA, Citibank, Info ­ Quest, HSBC, Direct Services

Chatziantoniou, Damianos

265

01.07.2013, 2013_EnviroInfo_wald_hc1_short.doc HelioClim-1: 21-years of daily values in solar radiation in one-click  

E-Print Network (OSTI)

manuscript, published in "27th International Conference on Informatics for Environmental Protection, Hambourg as the main use of these data relates to investment decision in solar plants and selection of appropriate

Paris-Sud XI, Université de

266

Laboratoire d'InfoRmatique en Image et Systmes d'information LIRIS UMR 5205 CNRS/INSA de Lyon/Universit Claude Bernard Lyon 1/Universit Lumire Lyon 2/Ecole Centrale de Lyon  

E-Print Network (OSTI)

! Ververidis et al (2004, 2005): Anger, happiness, neutral, sadness, surprise Pitch, spectrum and energy six" Anger, Happiness, Fear, Neutral, Sadness, Surprise... !Dimensional theory [Wie05a] 2 or 3 Dimensional emotions: helps in building classifiers 5 #12;State of the art: Acoustic correlates ! Emotion may

Dellandréa, Emmanuel

267

AgriculturalPO Box 339, Bloemfontein, 9300 I Tel: 051 401 9111 I E-mail: info@ufs.ac.za I www.ufs.ac.za Natural and  

E-Print Network (OSTI)

www.ufs.ac.za Faculty of Natural and Agricultural Sciences 2013 #12;1 SCIENCES If age brings wisdom Sciences. For a century this faculty has been one of the leaders in science training and research and Agricultural Sciences where our motto "no substitute for excellence" drives our academic endeavors. The Faculty

Buehrer, R. Michael

268

Cet article est disponible en ligne l'adresse : http://www.cairn.info/article.php?ID_REVUE=ANNA&ID_NUMPUBLIE=ANNA_595&ID_ARTICLE=ANNA_595_0971  

E-Print Network (OSTI)

. c.) et ya¬Įsa¬Į lorsqu'il s'agit de sources en persan et en arabe, car c'est sous cette forme que le terme appara√ģt le plus souvent. Pour la translitt√©ration des mots arabes et persans, nous suivons le

Boyer, Edmond

269

This paper was published in Optics InfoBase and is made available as an electronic reprint with the permission of OSA. The paper can be found at the  

E-Print Network (OSTI)

to classify the elements of a scene is a convenient and efficient solution to many image-processing tasks daylight. Estimates of the mean number of distinguishable colored surfaces were

Foster, David H.

270

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BESK/VISIT: LILLA FRESCATIVGEN 4A, STOCKHOLM, INFO@KVA.SE HTTP://KVA.SE  

E-Print Network (OSTI)

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BES√?K by Patricia K. Kuhl, University of Washington, Seattle, WA, USA and Hon. Dr., Stockholm University, Sweden will be followed by a panel discussion including Hugo Lagercrantz, Karolinska Institutet, Solna, Sweden, Andrew

271

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network (OSTI)

to Enrich Co-Presence Information." In: Adjunct Proceedings of the Seventh International Conference to Enrich Co-Presence Information Bibliographic Reference: Rahul Nair and Marc Davis. "Bluetooth Pooling on Ubiquitous Computing (UbiComp 2005) in Tokyo, Japan, 2005. #12;Bluetooth Pooling to Enrich Co

272

NCBI Handout Series | Clone DB | Last Update: August 19, 2013 Contact: info@ncbi.nlm.nih.gov Repository for DNA clones with integrated information on sequences, maps and distributors  

E-Print Network (OSTI)

terms are automatically entered in the query box (F). Clicking the "Add to history" link (G) pre- views box so custom terms such as a search history (#9) can be added. Displaying the search results A search for accessing data from CloneDB: Text searching through the Clone DB homepage www.ncbi.nlm.nih.gov/clone/ Bulk

Levin, Judith G.

273

Enterprise GIS System Architecture Prepared for: State of Rhode Island  

E-Print Network (OSTI)

Enterprise GIS System Architecture Prepared for: State of Rhode Island Date: 9/26/2011 Prepared byEdit, ArcEditor, ArcEurope, ArcExplorer, ArcExpress, ArcGIS, ArcGlobe, ArcGrid, ArcIMS, ARC/INFO, ArcInfo, ArcInfo Librarian, ArcInfo--Professional GIS, ArcInfo--The World's GIS, ArcLessons, ArcLocation, Arc

Wang, Y.Q. "Yeqiao"

274

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 2  

SciTech Connect

During TVA's visit and survey of RMA's GB facility, sample points were identified (Table A-1). The sample points initially identified were from Buildings 1501, 1503, 1603, 1506, 1601, 1601A, and 1602. Piping isometrics were produced for each sample point identified and are shown in Appendix B. After a careful review of each sample point and discussions with RMA personnel, 67 of the original sample points were eliminated. The sample points eliminated consisted of all ventilation points and process equipment/piping that is open to the atmosphere.

Not Available

1988-10-01T23:59:59.000Z

275

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network (OSTI)

> ayn> √ľniversiteden 1953'te ald>. 1960'da Ege √?niversitesi T>p Fak√ľltesi'nde "yabanc> ma- tematik ve- l>flt>. Ege √?niversitesi'nde do√ßent (1965) ve profe- s√∂r (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde g√∂rev ald>. 1997

Sertöz, Ali Sinan

276

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records  

E-Print Network (OSTI)

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records for canola agent will help you request protection from RMA (Risk Manage- ment Agency) to transfer a canola crop

Goodman, Robert M.

277

Profiling translatomes of discrete cell populations resolves altered cellular priorities during hypoxia in Arabidopsis  

Science Journals Connector (OSTI)

...small subunit (pRBCS1A) Cotyledon and leaf epidermis Cuticular wax gene (pCER5) Cotyledon and leaf guard cells K + channel (pKAT1...publicly available CEL files (21-25) were analyzed using the pipeline described above. The RMA normalization step was always applied...

Angelika Mustroph; M. Eugenia Zanetti; Charles J. H. Jang; Hans E. Holtan; Peter P. Repetti; David W. Galbraith; Thomas Girke; Julia Bailey-Serres

2009-01-01T23:59:59.000Z

278

ProtEx: a toolkit for the analysis of distributed real-time systems  

E-Print Network (OSTI)

and queuing policies present in a system. In this thesis we present a methodology to extend the traditional RMA approach by allowing general characterization of workload and flexible modeling of resources. We realize our approaches within ProtEx, a toolkit...

Meylan, Yves Damien Meylan

2012-06-07T23:59:59.000Z

279

(mobile ) (xml ) 2001 12 ------  

E-Print Network (OSTI)

Act HIPAA 21CFR 11 RMA DOD 5015.2-STD - Sarbanes-Oxley Gramm-Leach-Bliley #12;(Gramm HIPAA Protected Health Information PHI PHI PHI PHI HIPAA PHI HIPAA #12; HIPAA 25 10 1.2.4. FDA FDA (Food and Drug Administration) 21 CFR (Code of Federal Regulations) Part 11

280

Prof. Dr. Metin Heper (Siyaset Bilimi Blm), doktoras>n> 1971'de Syracuse  

E-Print Network (OSTI)

√ľniversitelerinde araflt>rmac>l>k yapm>flt>r. Bilkent √?niversitesi'nde >rma M√ľd√ľrl√ľ¬§√ľ'nde dan>flmanl>k, Michigan State ile Ball State √ľniversitelerinde √∂¬§retim √ľyeli¬§i yapm>fl olan Dr. Aydo¬§an, Bilkent √?niversitesi'nde ¬§> ile

G√ľrel, Levent

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

E-Print Network 3.0 - abstracts search period Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

the period you wish to search. 12;2 PsycINFO user guide September 2002 Enter your search term or terms... PsycINFO user guide citations summaries abstracts journal...

282

Probing the extended emission-line region in 3C 171 with high-frequency radio polarimetry  

Science Journals Connector (OSTI)

......assuming it is cospatial with the EELR, would be 1010 Mo. 1 See http://info.aoc.nrao.edu/vla/html/highfreq/hffastswitch.html 2 See http://info.aoc.nrao.edu/vla/html/refpt.shtml Acknowledgments: The National Radio......

M.J. Hardcastle

2003-02-21T23:59:59.000Z

283

Dark Fiber Testbed  

NLE Websites -- All DOE Office Websites (Extended Search)

US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network Problems: trouble@es.net Provide Web Site Feedback: info@es.net Dark Fiber Testbed Info on dark fiber testbed...

284

The Case for an Informed Path Selection  

E-Print Network (OSTI)

Université catholique de Louvain IP Networking Lab - http://inl.info.ucl.ac.be April 24th, 2008 1 #12 of IDIPS is available - http://inl.info.ucl.ac.be 14 #12;15 #12;

Bonaventure, Olivier

285

O. Bonaventure, 2007ISP-model 1 Issues in modelling ISP networks  

E-Print Network (OSTI)

François Bruno Quoitin Université catholique de Louvain Louvain-la-Neuve, Belgium http://inl, available form http://inl.info.ucl.ac.be Totem toolbox : http://totem.info.ucl.ac.b

Bonaventure, Olivier

286

Experimenting with Multipath TCP Sebastien Barre*, Olivier Bonaventure*  

E-Print Network (OSTI)

selection heuristics To download MPTCP for Linux: http://inl.info.ucl.ac.be/mptcp Acknowledegments in this document. http://inl.info.ucl.ac.be/mptcp sebastien.barre@uclouvain.be #12;

Bonaventure, Olivier

287

Appears in Proc. Third International Workshop on Self Adaptive Software Rosslyn, VA, June 2003  

E-Print Network (OSTI)

Honeywell Laboratories musliner@htc.honeywell.com Robert P. Goldman SIFT, LLC rpgoldman@sift.info Kurt D

Krebsbach, Kurt D.

288

MA 16100  

E-Print Network (OSTI)

MA 16100, Fall 2014. Plane Analytic Geometry And Calculus I. Course Info. Syllabus ∑ Emergency Preparedness Syllabus Attachment ∑ Course Calendar†...

289

National Nuclear Physics Summer School (NNPSS) 2011  

NLE Websites -- All DOE Office Websites (Extended Search)

Important Dates Topics and Lecturers Check-inLocal Info Accommodations Travel Cost Program Contacts Organizers Lecture Notes Sponsors...

290

Platform Computing Inc. 3760 14th Avenue  

E-Print Network (OSTI)

: (905) 948-9975 email: info@platform.com www.platform.com Platform Computing Launches Networking Site

Buyya, Rajkumar

291

U Y U Y Y  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Y Y / U Y / Y f j MoN 12: 2 7 F.41 301~0.31125 - .-----.. - -- . INFO NGNT HR- 1 /-Y kn 0 0 s 09/0&1/96 11:57 B 3 0 1 . .d 6 8 5 2 OF E C O R D S ADM @J 0 0 5 REQUEST FOR RECORDS DISPOSITION AUTHORIIY . . - Department of Energy . . . I . , . , . . . I JOB NUMBER ~ 1 4 3 4 - 9 6 - i a . , 1. FROM (Agency ar ~ b l l s h m a n D NOTIFICATION TO AGENCY -L 2 . MAJOR SUBDIVISION Savannah River Operations .Office ' , , ; 3. MINOR SUQ~IVISION Savannah River Site(SRS)/ Wcstin&oum Savannah River Cory (WSRC) . . u. 6. AQENCY CERT~FICA'TION' , . 1 hereby that I am mthorized to act h r this ageacy i n m d W ~srtaining tn the dispnsi of its ~ o o r d ~ and Lhal the; r d s pr+ far dispasd on tbc artached, 2 p o d s ) a & not nqw heedcd for'thc busiitEss of this ng+ m will hat be n d c d afl= f i e . ,p&im@s 3puiticd; ad tbne writtcr~c~ucr~'mc8 born t

292

Achieving Sustainability inCaliforniaís CentralValley  

E-Print Network (OSTI)

and clean-burning agricultural waste cogeneration as ansuch as clean-burning agricultural waste cogeneration,tion and clean-burning agricultural waste cogenera- tion as

Lubell, Mark; Beheim, Bret; Hillis, Vicken; Handy, Susan L.

2009-01-01T23:59:59.000Z

293

Document (501k)  

NLE Websites -- All DOE Office Websites (Extended Search)

9 Named Ranges 96 Project Inputs HTGR Project Fractions HTGR Cost Basis Commodity Prices Economic Inputs IRR Analysis List Info Results Summary Sensitivity Analysis BraytonCost CA...

294

E-Print Network 3.0 - activation state insights Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

- ment the state of the visualization at the time an insight occurs. Of course, an exploration process... Evaluating an InfoVis Technique Using Insight Reports Markus...

295

--No Title--  

NLE Websites -- All DOE Office Websites (Extended Search)

Missouri and University of Tennessee have identified the genes required for bacterial mercury methylation. Image by Thomas Splettstoesser info@scistyle.com Researchers from Oak...

296

CTI-Private Financing Advisory Network | Open Energy Information  

Open Energy Info (EERE)

to get more RE and climate friendly projects financed and thereby to accelerate technology transfer under the UNFCCC." 1 The website provides general info and updates, an...

297

Key Word List Administrative  

E-Print Network (OSTI)

Self-Service Energy Efficiency Environment / Sustainability Ethics / Integrity Evaluation - Employee Attitudes Employee Development Employee Info Employee Misconduct/Termination Employee Recognition Employee

Fernandez, Eduardo

298

Data:Bd89b540-bda4-4bfb-9256-4e037b5532a9 | Open Energy Information  

Open Energy Info (EERE)

Description: Additional Info: Applicability: This schedule is applicable to the consumption of electrical energy for commercial or industrial uses, or for domestic...

299

NERSC User Demographics  

NLE Websites -- All DOE Office Websites (Extended Search)

2013 2012 2011 2010 Careers Visitor Info Web Policies Home About NERSC Usage Demographics NERSC Usage Demographics NERSC Usage Demographics 2013 2013 NERSC Usage by...

300

Cheap acoustics as a learning methodology London South Bank University, FESBE, Borough Road, SE1 0AA London, UK  

E-Print Network (OSTI)

, Revit:Ecotect, Google Sketchup, ARTA, and winMLS. Through info4education.co.uk the students have access

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

SPIDERS Fort Carson Industry Day  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

20% 25% 30% 35% 40% 45% Info Tech BankingFinance Dams FoodAgriculture Communications Health Care Transportation Nuclear Government Chemical Crit Manufacturing Commercial...

302

1 | T H E A U S T R A L I A N N A T I O N A L U N I V E R S I T Y M I N U T E S  

E-Print Network (OSTI)

Dave Richardson (Chair) ATTENDING James Ashton (CECS), James Blanden (Enterprise Systems), Jo Bryant & Communications), Kathy Collier (AD Scholarly Info Res Mgmt), Dominy Evans (AD Enterprise Services), Anita Fitch

303

NETL Overview  

NLE Websites -- All DOE Office Websites (Extended Search)

* Grid operators have new resource options - Reduce peak load and prices through demand response - Improve grid reliability - Ancillary services Today Tomorrow Little or no info,...

304

E-Print Network 3.0 - active nuclear material Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Powered by Explorit Topic List Advanced Search Sample search results for: active nuclear material Page: << < 1 2 3 4 5 > >> 1 Contact Info: Pavel Oblozinsky Summary: physics...

305

FCRPS Hydro Projects (generation/hydro)  

NLE Websites -- All DOE Office Websites (Extended Search)

Information Kiosk Current Hydrological Info Fish Funding Agreement FCRPS Definitions Wind Power Monthly GSP BPA White Book Dry Year Tools Firstgov Federal Columbia River Power...

306

Data:E9d72d0c-f8be-470d-afca-297aef377a7f | Open Energy Information  

Open Energy Info (EERE)

0521 End date if known: Rate name: Residential Rates - Two Residential Units - One Meter Sector: Residential Description: Additional Info: The Minimum monthly charge of 5.40...

307

Data:975f76e7-e706-4f8a-95ee-5ab43a42922c | Open Energy Information  

Open Energy Info (EERE)

0521 End date if known: Rate name: Residential Rates - Three Residential Units - One Meter Sector: Residential Description: Additional Info: The Minimum monthly charge of 8.10...

308

ARRA Projects Chart | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Chart More Documents & Publications ARRA Project Info Combined 0112110.xls Missouri Recovery Act State Memo The Promise and Challenge of Algae as Renewable Sources of Biofuels...

309

A Path to Successful Energy Retrofits: Early Collaboration through Integrated Project Delivery Teams  

E-Print Network (OSTI)

Parrish, PhD KDParrish@lbl.gov EERE Information Center1-877-EERE-INFO (1-877-337-3463) www.eere.energy.gov/

Parrish, Kristen

2014-01-01T23:59:59.000Z

310

Guide to Setting Thermal Comfort Criteria and Minimizing Energy Use in Delivering Thermal Comfort  

E-Print Network (OSTI)

Berkeley, CA 94720 CMRegnier@lbl.gov EERE Information Center1-877-EERE-INFO (1-877-337-3463) www.eere.energy.gov/

Regnier, Cindy

2014-01-01T23:59:59.000Z

311

Chris Tracy  

NLE Websites -- All DOE Office Websites (Extended Search)

info@es.net Chris Tracy Christopher (Chris) Thomas Tracy Network Engineer Network Engineering Services Group CTracy@es.net Chris Tracy has worked in computing and...

312

Data:00b49e12-6650-4565-bc32-b0dc8c851fd9 | Open Energy Information  

Open Energy Info (EERE)

date: 20130101 End date if known: Rate name: RESIDENTIAL FARM RATE SCHEDULE - F1 Sector: Residential Description: Additional Info: Applicability: This schedule is...

313

Fermilab | Science  

NLE Websites -- All DOE Office Websites (Extended Search)

feature photo feature photo feature photo feature photo feature photo Science Navbar Toggle About Quick Info Science History Organization Photo and Video Gallery Diversity...

314

1547.ps  

E-Print Network (OSTI)

Dec 18, 2006 ... tic; [objt,Xt,yt,Zt,info] = mysdps(blk,A,C,b); t = toc;. >> tic; [fL, Y, dl] = vsdplow(blk,A,

315

Power Services Site Help & Information (pbl/main)  

NLE Websites -- All DOE Office Websites (Extended Search)

Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Web Site Help & Information Links to Help Pages: Power Services Site...

316

You are Here System (help/navigation)  

NLE Websites -- All DOE Office Websites (Extended Search)

Navigation Aids > Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Site Navigation Aids "You Are Here" System Under...

317

E-Print Network 3.0 - algimantas gradeckas lilija Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Sciences and Ecology 6 Werner Lehne, 10.5.2010 StudienbroInfo Mai2010 Summary: .Sc.M.Sc.Dipl. Wirtschaftsmathematik: StudienkoordinatorinStudienfachberaterin...

318

Visiting NERSC  

NLE Websites -- All DOE Office Websites (Extended Search)

Visitor Info Visitor Information NERSC is located at Berkeley Lab's Oakland Scientific Facility (OSF) at 415 20th Street ("Thomas L Berkley Way") at Franklin Street in downtown...

319

Alice Koniges  

NLE Websites -- All DOE Office Websites (Extended Search)

David Turner Harvey Wasserman Woo-Sun Yang Zhengji Zhao Org Chart NERSC History NERSC Stakeholders NERSC Usage Demographics Careers Visitor Info Web Policies Home About Staff...

320

Selected Recent Publications and Presentations  

NLE Websites -- All DOE Office Websites (Extended Search)

David Turner Harvey Wasserman Woo-Sun Yang Zhengji Zhao Org Chart NERSC History NERSC Stakeholders NERSC Usage Demographics Careers Visitor Info Web Policies Home About Staff...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Alliant Energy Interstate Power and Light (Electric) - Business...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

State Government Savings Category Heat Pumps Lighting Maximum Rebate See program web site Program Info State Minnesota Program Type Utility Rebate Program Rebate Amount New...

322

SPARK! 2012 | ornl.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnetic Filtration Process - Sherrill Advanced Credentialing For Trusted Networks - Sims Content Recommendation Solution - Tech Info Consumers - Morris Spark 2012 Request For...

323

Site Transition Guidance | Department of Energy  

Office of Environmental Management (EM)

Transition Guidance More Documents & Publications EM Recovery Act Lessons Learned (Johnson) Info-Exch 2012 - Thomas Johnson Presentation EM Recovery Act Lessons Learned...

324

RHIC | Image Library  

NLE Websites -- All DOE Office Websites (Extended Search)

arrow See the RHIC collection on Flickr | Note: to see photo descriptions, click "show info" in the player window after pressing play....

325

E-Print Network 3.0 - agilent dna microarrays Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Microarray experiments aim Source: Laforest, Frdrique - Laboratoire d'InfoRmatique en Image et Systmes d'information, Universit Claude Bernard (Lyon I) Collection: Computer...

326

GLOSSARY OF COMMITTEE ABBREVIATIONS: ACA: Advisory Committee on Athletics  

E-Print Network (OSTI)

) Commercialization of Intellectual Property Rights SRC, FCC F Senate (action) Conflict Resolution Process for Student Academic Complaints SCSA, SSCC St Senate (info) Copyright SCFA, SCC U

Amin, S. Massoud

327

Factsheets | The Ames Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

disruptions. Image Rare Earths Info Card This handy pocket card highlights the rare earth elements on the front and provides information on the back concerning Ames...

328

Alliant Energy Interstate Power and Light - Residential Renewable...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Eligibility Residential Savings Category Photovoltaics Solar Water Heat Maximum Rebate Solar Thermal Water Heater: 750 Program Info State Iowa Program Type Utility Rebate...

329

MA 15300  

E-Print Network (OSTI)

PowerPoints, Video Lessons and Outlines ∑ Supplemental Instruction Info ∑ Tutoring/Assistance Opportunities ∑ Chapter 1 of Textbook ∑ Even Answers to Book†...

330

STOCHASTIC ION HEATING BY A PERPENDICULARLY PROPAGATING ELECTROSTATIC WAVE  

E-Print Network (OSTI)

Plasma Research Report , PRR 76/24 July 1976 Link: http://charles.karney.info/biblio/karney77c.html #12

Karney, Charles

331

Microhole Array | Open Energy Information  

Open Energy Info (EERE)

data using small-diameter downhole tools designed for slim holes. Additional Info CostTime Dependency: Microholes cost less to drill than traditional wellbores, delivering...

332

Slide11 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

when full bibliographical control is not feasible. Most Science Info Is in the Deep Web. Federated search drills down to the deep Web where scientific databases reside. Unlike...

333

APPENDIX A:  

National Nuclear Security Administration (NNSA)

Watson Submitted to Sandia Site Office, Gorn, Caughey Info Copy Only Albuquerque - Local Air Pollution Control RegulationsAir Permits No Change - Report is sent through the...

334

E-Print Network 3.0 - air pollutants occupational Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

info@pacinst.org www.pacinst.org Summary: will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific......

335

Department of Mathematics: Course Page  

E-Print Network (OSTI)

Course Info. Ground Rules ∑ Syllabus. Resources. Past Exam Archive. Assignments. WebAssign Login ∑ WebAssign Help ∑ Connection Errors. Course†...

336

Vantage Pomona Heights | Open Energy Information  

Open Energy Info (EERE)

EIS at na for na Environmental Impact Statement for the Vanage to Pomona Heights 239kV Transmission Line Project General NEPA Document Info Energy Sector Transmission...

337

One Nevada | Open Energy Information  

Open Energy Info (EERE)

One Nevada EIS at na for NA Final Environmental Impact Statement for the One Nevada Transmission Line Project (ON Line Project) General NEPA Document Info Energy Sector...

338

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Three Topics Relating to Nano Info Diffusion We see three complementary approaches to improve information sharing and awareness Modeling - It's possible. Metadata - numeric data,...

339

Slide15 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Slide 15: In Summary: Three Points on Nano Info Diffusion -Modeling - it's possible -Metadata - numeric data, unlike textual data, requires metadata to ensure access -Stewardship -...

340

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Slide 2: Three Topics Relating to Nano Info Diffusion We see three complementary approaches to improve information sharing and awareness - Modeling - it's possible - Metadata -...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Dr. Daniel Giammar | Photosynthetic Antenna Research Center  

NLE Websites -- All DOE Office Websites (Extended Search)

2014 Dr. Daniel Giammar The Chemistry and Engineering for Producing and Supplying Clean Drinking Water Original Event Info: November 22, 2014 - 10:30am Brauer Hall 012,...

342

In the News | Photosynthetic Antenna Research Center  

NLE Websites -- All DOE Office Websites (Extended Search)

2014 Dr. Daniel Giammar The Chemistry and Engineering for Producing and Supplying Clean Drinking Water Original Event Info: Read more about Dr. Daniel Giammar July 31, 2014 The...

343

Southline Transmission Line | Open Energy Information  

Open Energy Info (EERE)

Impact Statement for the Southline Transmission Line Project General NEPA Document Info Energy Sector Transmission Environmental Analysis Type EIS Applicant Southline...

344

E-Print Network 3.0 - agro-industrial products materiels Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Mackenzie Summary: Poverty Alleviation through Cleaner Energy from Agro- industries in Africa (PACEAA) - 10 countries S... :www.applesonline.info 12;Two large UNEPGEF...

345

C117_05_13  

NLE Websites -- All DOE Office Websites (Extended Search)

OSTI--C117 (0513) Search: * Deep web databases * Thousands of authoritative science websites * Content from 15 federal science agencies * 200 million pages of science info and...

346

Saunders, A.D., Larsen, H.C., and Wise, S.W., Jr. (Eds.), 1998 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 152  

E-Print Network (OSTI)

(Sinton and Duncan, this volume). The lava may be grouped into three main lithostratigraphic forma- tions

347

Annual Report, 2007 THE COLLEGE OF SCIENCE  

E-Print Network (OSTI)

&M distinction as the only math department nationwide to merit multiple selec- tions. Nick Suntzeff earned

Behmer, Spencer T.

348

Ground-Water Recharge in the Arid and Semiarid Southwestern United States --  

E-Print Network (OSTI)

by the international boundary with Mexico. Hyperarid condi- tions occur in Imperial Valley and Death Valley

349

Long-Term Planning for Nuclear Energy Systems Under Deep Uncertainty  

E-Print Network (OSTI)

Ethics, Implementa- tion, Uncertainties. Nuclear Energy Agency, Organization for Economic Co- Operation and Development,

Kim, Lance Kyungwoo

2011-01-01T23:59:59.000Z

350

Ris Energy Report 3 Introduction  

E-Print Network (OSTI)

, and biogas can be reformed directly. Efficiencies for hydrogen produc- tion from biomass, biogas and coal

351

Proceedings of the 2000 IEEE InternationalConference on Robotics& Automation  

E-Print Network (OSTI)

, are widely used in scientific and engineering applica- tions. Propeller and turbine blades, or ships, auto

352

PERMANENT GENETIC RESOURCES NOTE 1239 equilibrium (Table 1), probably due to Wahlund effect or  

E-Print Network (OSTI)

amplifica- tion while TnM50 [(GGTAGAA)7] produced uncorrectable stutter peaks. Poor amplification, also

Steve Kemp

353

ARCHITECTURE Magazine by  

E-Print Network (OSTI)

such exploita- tion if now elusive `clean coal' tech- nologies do not fully materialise. Nuclear energy

Perez, Richard R.

354

A fast-response microfiber coupler tip high temperature sensor Ming Ding*a  

E-Print Network (OSTI)

, and electrical sources like power supply noise, electromagnetic interference (EMI), or radia- tion from lightning

355

Single-Site Vanadyl Activation, Functionalization, and Reoxidation Reaction Mechanism for Propane Oxidative Dehydrogenation on the Cubic V4O10 Cluster  

E-Print Network (OSTI)

, and mixed metal oxide (MMO) catalysts for selective oxidation and ammoxida- tion of propene to acrolein

Goddard III, William A.

356

Self-Powered Processors Andrew Putnam, Luis Ceze Bryna Hazelton  

E-Print Network (OSTI)

-gap configura- tions using Silvaco ATLAS device physics simulation software [1]. The hammer-anvil operates

Ceze, Luis

357

n October, the Council completed the first-ever  

E-Print Network (OSTI)

. The first is to reform all existing production and mitiga- tion hatcheries to eliminate or minimize

358

44 BioTechniques Vol. 36, No. 1 (2004) 1.Fashena, S.J., I. Serebriiskii, and E.A. Gole-  

E-Print Network (OSTI)

.H. Schiestl. 1991. Applica- tions of high efficiency lithium acetate transfor- mation of intact yeast cells

Wangh, Lawrence J.

359

Heavy-Duty Truck Idling Characteristics: Results from a Nationwide Survey  

E-Print Network (OSTI)

Richmond, Virginia; and Troutdale, Oregon. These loca- tions64); Richmond (42); and Troutdale (88). The variability

Lutsey, Nicholas P.; Brodrick, Christie-Joy; Sperling, Dan; Oglesby, Carollyn

2004-01-01T23:59:59.000Z

360

JOURNAL OF GEOPHYSICAL RESEARCH, VOL. ???, XXXX, DOI:10.1029/, What is the skill of ocean tracers in reducing uncertainties  

E-Print Network (OSTI)

in current Earth system models and (ii) imperfect knowledge of model parameters. Ocean tracers observa- tions

Haran, Murali

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Atmos. Chem. Phys., 10, 53715389, 2010 www.atmos-chem-phys.net/10/5371/2010/  

E-Print Network (OSTI)

% prompt and 30% slow evapora- tion) at a site northwest from the metropolitan area (PEMEX Correspondence

Meskhidze, Nicholas

362

The process of developing a strategy of sustainable development in the Pamir  

E-Print Network (OSTI)

activities such as mineral exploitation and hydroelectricity genera- tion. Tertiary sector activities

Richner, Heinz

363

Public Health in East and Southeast Asia: Challenges and Opportunities in the Twenty-First Century  

E-Print Network (OSTI)

ecological retrogression. The main source of outdoor air pollu- tion in most Asian cities is vehicle

Detels, Roger; Sullivan, Sheena G.; Tan, Chorh Chuan

2012-01-01T23:59:59.000Z

364

Introduction Ideally, fishery biologists dream of a  

E-Print Network (OSTI)

vegeta- tion (SAV) on unconsolidated sediments or unconsolidated sediments. Continu- ous coral habitat

365

SNAP: A Software Package for User-Guided Geodesic Snake Segmentation  

E-Print Network (OSTI)

segmentation pipeline, including image preprocessing, bubble initializa- tion and parameter control smoothness guarantees stability in t

Gerig, Guido

366

Honors Day ........................................................................................ 2 Alumnus Profile: Leigh Harwood ....................................................... 4  

E-Print Network (OSTI)

and their characteriza- tion. Pengcheng Dai's Floating Zone Furnace can produce large, ultra pure single crystals

Tennessee, University of

367

A.A. 2014/2015 LM-41 -Medicina e chirurgia  

E-Print Network (OSTI)

A.A. 2014/2015 LM-41 - Medicina e chirurgia Info Generali Presentazione del Corso INFO Generali Classe LM-41 Medicina e chirurgia Nome inglese Medicine and Surgery Lingua in cui si tiene il corso italiano Indirizzo internet del corso di laurea http://www.medicina.unict.it/ Presidente del CdS PALMERI

Bella, Giampaolo

368

Computer Science ~ BA AFFILIATION PROCEDURES~  

E-Print Network (OSTI)

Technical Electives: 3000+ (3+ crs) from application areas: CS; Bio; Chem; Math; Econ; Psych; etc. [only one Specialization: Three 3000+ courses (3+ crs) from same subject area. CS courses, LING 4474, INFO 4302, INFO 3300, ECON 3130(beginning fall 2013)/ ECON 3190(prior to fall 2013), ENGRD 2700 or MATH 4710 (Taking a 3000

Keinan, Alon

369

Getting Started Advanced Search for Funding Opportunities  

E-Print Network (OSTI)

Getting Started Advanced Search for Funding Opportunities For Assistance Delete Criteria to Update Search Funding ­ Finding Additional Sources Saving and Printing SPIN Search Results Past funding opportunities can be searched in InfoEd to: · find opportunities that were added prior to your account set

Duchowski, Andrew T.

370

x1 EVENTS EVENT HANDLING * 1. Event Handling. This file describe the main event loop, and most of the fu*  

E-Print Network (OSTI)

. The Expose event. + voidicon_expose(win_p); 8. void icon_expose(win_p p) { inti ( p! data.nr; p_outer_windowpane( p! type= diag _icon_win? &info!dw[i]! pane: &info!pw[i]* *! pane; display _icon_graphics(pane! icon, pane!title, pane!visibility); if ((p! type= diag

van Leeuwen, Marc

371

Information Commons Help Desk Internet / Connectivity Wireless Access  

E-Print Network (OSTI)

Information Commons Help Desk Internet / Connectivity ¬Ľ Wireless Access ID #1912 Connecting in the Username and Password fields.5. Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help on this entry Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help

Boonstra, Rudy

372

test1 - Datasets - OpenEI Datasets  

Open Energy Info (EERE)

test1 This is only a test Data and Resources TEST1.1com TESTING More info Go to resource doe test1 test2 test Additional Info Field Value Catalog OpenEI Origination Date 2014-11-12...

373

Geographical Distribution of Biomass Carbon in Tropical Southeast Asian  

NLE Websites -- All DOE Office Websites (Extended Search)

3. Files in this numeric data package 3. Files in this numeric data package File File size Projection number File name (kbytes) File description type File type 1 ndp068.txt 94 Descriptive file (i.e., this n/a ASCII text document) 2 Biomass.e00 59,468 Exported ARC/INFO gridded Albers ARC/INFO (3.75-km) estimates of actual export GRID and potential biomass carbon 3 Biomassx.e00 1,534 Exported ARC/INFO gridded Geographic ARC/INFO (0.25-degree) estimates of export GRID actual and potential biomass carbon 4 ac.dat 24,607 ASCII file of ungenerated Albers GRIDASCII ARC/INFO gridded (3.75- ASCII data

374

Dispersion by chemical reaction of Rocky Mountain Arsenal Basin F waste soils  

SciTech Connect

Many military installations have soil contamination problems that range from heavy metals to petroleum products. Rocky Mountain Arsenal (RMA) Basin F contains high concentrations of salts, heavy metals, ammonia, urea, and organics. The Dispersion by Chemical Reaction (DCR) process leads to a reduction in the mobility of the organic and inorganic constituents by first removing volatile constituents via steam stripping and volatilization, then trapping the nonvolatile contaminants in a nonmobile phase (microencapsulation), and finally compacting the treated material into large soil bodies (macroencapsulation). This report summarizes the results of the DCR testing of soil-amended Basin F sludge from RMA. The primary focus of this study is on pesticide leachability. The DCR process used to treat the Basin F waste soil produced a dry, homogeneous, soil-like material with desirable physical properties that on compaction achieved the following remediation goals: reduction of all leachable volatiles to nondetectable levels, confinement of all metals to below RCRA TCLP levels, and a decrease in pesticide leachability to levels approaching RCRA standards. For example, endrin TCLP concentration was reduced from 74 microgram/L to 20-28 microgram/L (regulatory limit = 20 ug/L). In several cases, reductions in pesticide leachability could be attributed to simple dilution with the calcium oxide (CaO) reagent. However in other cases, microencapsulation and/or macroencapsulation also played a role in reducing pesticide leachability. Additional work is necessary to optimize the amounts of lime-milk, hydrophobic CaO, and benign oil used in the processing of RMA Basin F waste soils. Ideally, the optimum design should achieve the regulatory and client goals, while minimizing materials handling, energy, and reagent inputs.

Payne, J.R.; Marion, G.M.

1997-02-01T23:59:59.000Z

375

MIDC: Links  

NLE Websites -- All DOE Office Websites (Extended Search)

Links Links Other Data Collection Activities Baseline Surface Radiation Network (BSRN) Clear Sky Forcast for NREL/SRRL (or other locations) Colorado Dept. of Public Health & Environment: Air Quality Index (AQI) Reporting System Colorado State University: USDA UV-B Monitoring and Research Program European Skynet Radiometers network (ESR) Jefferson County, Colorado: Jeffco Weather Station NOAA: Climate Monitoring & Diagnostics Laboratory (CMDL) NREL OTF: Reference Meteorological and Irradiance System (RMIS) NREL RReDC: Cooperative Networks for Renewable Resource Measurements (CONFRRM) NREL RReDC: NASA Remote Sensing Validation Data: Saudi Arabia Rocky Mountain Arsenal (RMA): National Wildlife Refuge Sandia National Laboratories: Photovoltaic Systems Evaluation

376

TDAG Research - Argonne National Laboratories, Materials Sicence Division  

NLE Websites -- All DOE Office Websites (Extended Search)

Research Research TDAG Research Background information Originally Environmental Chemistry Team Started in early 90s Field or "On Site" Analytical Method Development Field GC & MS, Mobile Lab (at DOE & DOD sites) Portable XRF (Pb, Hg, As) Chemical Sensors Site Investigations Analysis of environmental samples Analytical Method Development Chemical agent determination (Projects at DPG, APG, RMA) Environmental analysis (EPA methods) Process analysis (CAMDS, AMTEX) Current Capabilities Neutron Activation Facility - Dedicated to NAUTICAS Project for the ONR, but may be available for other projects. (Homeland security, Catalysis studies) ICP/MS Lab - Perkin Elmer. Used for trace characterization of metals GC/MS Lab - Perkin Elmer Clarus 600 GC/MS system. Used for

377

AVAILABLE ONLINE AT: INITIATED BY:  

NLE Websites -- All DOE Office Websites (Extended Search)

the Chief Information Officer the Chief Information Officer U.S. Department of Energy ORDER Washington, D.C. Approved: 5-16-2011 SUBJECT: DEPARTMENT OF ENERGY CYBER SECURITY PROGRAM 1. PURPOSE. To set forth requirements and responsibilities for a Departmental Cyber Security Program (CSP) that protects information and information systems for the Department of Energy (DOE). The CSP requires a Risk Management Approach (RMA) that includes: analysis of threats/risks; risk-based decisions considering security, cost and mission effectiveness; and implementation consistent with guidelines from the National Institute of Standards and Technology (NIST) and Committee on National Security Systems (CNSS) cyber requirements, processes and protections. DOE Oversight is

378

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 1  

SciTech Connect

The scope of this site plan safety submission (SPSS), includes: sampling plan to determine if GB is a contaminant in equipment and piping used in the production and demil processes; monitoring plan for personnel involved in the sampling effort; decon plan for personnel, equipment, and piping should contamination be identified. Additional sections and appendices include: historical use of bldg 1501, 1503, 1504, 1506, 1601, 1602, 1603, 1606; chemical information on GB; safety requirements; medical requirements and first aid procedures; piping drawings; rma sop's for sampling, monitoring, and decon.

Not Available

1988-10-01T23:59:59.000Z

379

Managing environmental information in the age of outsourcing.  

SciTech Connect

As more data gathering, analysis, and tracking tasks are outsourced the need for multiple contractors and military personnel to input, update, access, store, and track Mormation is becoming critical to efficient functioning and managing of environmental projects and programs at military installations. This paper presents two case studies detailing the way two organizations--the Rocky Mountain Arsenal (RMA) in Colorado, and the 611th Air Support Group (611 ASG) in Alaska--are managing complex data using web-based technology. RMA is involved in one of the largest environmental cleanup programs in the Department of Defense. As such, large volumes of environmental data and documents must be generates stored, and tracked. Often these documents are prepared by multiple contractors and are reviewed by several parties or groups. To manage environmental information and to ensure that it meets compliance requirements more efficiently, RMA has developed an electronic document tracking and distribution system. This system allows access to up-to-date information, including a detailed review of all pertinent regulatory and other requirements at RMA. The dynamic system includes milestones, review deadlines, submission deadlines, and other requirements for managing the environmental program. The 611 ASG manages more than 30 remote installations in Alaska, many of which are operated by contractor personnel. These installations contain hundreds of buildings that are constantly being modified because of exposure to harsh arctic climates; some of them have been determined to be eligible for the National Register of Historic Places. To meet regulatory requirements for cultural resources management as well as engineering requirements for upkeep of buildings, a database was developed to store and analyze building data. The database has a web-based interface that allows anyone with the correct access codes to input new data, modify existing data, or query the database using a number of standard reports. This system allows the 611 ASG to centrally manage its building information while also permitting installation contractors to update and use data through the Internet from their remote locations.

Perkins, S.; Smith, K.; Whorton, M.; Williams, G.

1999-03-08T23:59:59.000Z

380

Rotational micro-CT using a clinical C-arm angiography gantry  

SciTech Connect

Rotational angiography (RA) gantries are used routinely to acquire sequences of projection images of patients from which 3D renderings of vascular structures are generated using Feldkamp cone-beam reconstruction algorithms. However, these systems have limited resolution (<4 lp/mm). Micro-computed tomography (micro-CT) systems have better resolution (>10 lp/mm) but to date have relied either on rotating object imaging or small bore geometry for small animal imaging, and thus are not used for clinical imaging. The authors report here the development and use of a 3D rotational micro-angiography (RMA) system created by mounting a micro-angiographic fluoroscope (MAF) [35 {mu}m pixel, resolution >10 lp/mm, field of view (FOV)=3.6 cm] on a standard clinical FPD-based RA gantry (Infinix, Model RTP12303J-G9E, Toshiba Medical Systems Corp., Tustin, CA). RA image sequences are obtained using the MAF and reconstructed. To eliminate artifacts due to image truncation, lower-dose (compared to MAF acquisition) full-FOV (FFOV) FPD RA sequences (194 {mu}m pixel, FOV=20 cm) were also obtained to complete the missing data. The RA gantry was calibrated using a helical bead phantom. To ensure high-quality high-resolution reconstruction, the high-resolution images from the MAF were aligned spatially with the lower-dose FPD images, and the pixel values in the FPD image data were scaled to match those of the MAF. Images of a rabbit with a coronary stent placed in an artery in the Circle of Willis were obtained and reconstructed. The MAF images appear well aligned with the FPD images (average correlation coefficient before and after alignment: 0.65 and 0.97, respectively) Greater details without any visible truncation artifacts are seen in 3D RMA (MAF-FPD) images than in those of the FPD alone. The FWHM of line profiles of stent struts (100 {mu}m diameter) are approximately 192{+-}21 and 313{+-}38 {mu}m for the 3D RMA and FPD data, respectively. In addition, for the dual-acquisition 3D RMA, FFOV FPD data need not be of the highest quality, and thus may be acquired at lower dose compared to a standard FPD acquisition. These results indicate that this system could provide the basis for high resolution images of regions of interest in patients with a reduction in the integral dose compared to the standard FPD approach.

Patel, V.; Hoffmann, K. R.; Ionita, C. N.; Keleshis, C.; Bednarek, D. R.; Rudin, S. [Toshiba Stroke Research Center, Department of Physics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, Department of Physics, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Computer Science, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physics, and Department of Physiology and Biophysics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States)

2008-10-15T23:59:59.000Z

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

A Look at Commercial Buldings in 1995: Characteristics, Energy Consumption, and Energy Expenditures  

U.S. Energy Information Administration (EIA) Indexed Site

DOE/EIA-0625(95) DOE/EIA-0625(95) Distribution Category UC-950 A Look at Commercial Buildings in 1995: Characteristics, Energy Consumption, and Energy Expenditures October 1998 En ergy In for ma tion Ad min istra tion Of fice of En ergy Mar kets and End Use U.S. De part ment of En ergy Wash ing ton, DC 20585 This re port was pre pared by the En ergy In for ma tion Ad min istra tion, the in de pend ent sta tis ti cal and ana lytic agency within the U.S. De part ment of En ergy. The in for ma tion con tained herein should be at trib uted to the En ergy In for ma tion Ad min istra tion and should not be con strued as ad vo cat ing or re flect ing any pol icy po si tion of the De part ment of En ergy or any other or gani za tion. Contacts The En ergy In for ma tion Ad min istra tion (EIA) pre pared this pub li ca tion un der the gen eral di rec tion of W. Cal vin

382

Gordon Research Conferences  

Science Journals Connector (OSTI)

...atom posi-tions, water structure, anisotropic vibra-tions in pancreatic polypeptides...Recent ad-vances in high rate anisotropic etching"; discussion talks. 19 August...Pearce, vice chairperson. S July. Anisotropic polymer systems (James Economy, discussion...

Alexander M. Cruickshank

1982-03-05T23:59:59.000Z

383

Seattle Pacific University Emergency Procedures  

E-Print Network (OSTI)

the Personal Menu then choose the SPU-Alert System. Please contact the CIS Help Desk if you have ques- tions tool used to notify the campus community about any situation or condi- tion that could threaten

Nelson, Tim

384

Project Summary Report 0-1855-S 1 The University of Texas at Austin  

E-Print Network (OSTI)

in the construction of concrete platforms for the offshore oil industry. Headed bars (sometimes referred to as "T not create as much conges- tion. Although used extensively in offshore concrete oil produc- tion platforms

Texas at Austin, University of

385

Gordon Research Conferences  

Science Journals Connector (OSTI)

...Transforma-tions at the Solid-Water Interface." W...ULmitations of the Remediation of Ground Waters Contaminated by Organic...C. Kavanaugh, "Remediation and Engineering Constraints...and Uncertainty in Ground-Water Remedia-tion Modeling...

Carlyle B. Storm

1994-02-18T23:59:59.000Z

386

Salinity Gradient Power: Utilizing Vapor Pressure Differences  

Science Journals Connector (OSTI)

...high cost, degradation, polariza-tion, and solution pretreatment require-ments. In principle, however, most desa-lination schemes that are reversible are capable of producing power in salina-tion. The scheme we report here does not require...

MARK OLSSON; GERALD L. WICK; JOHN D. ISAACS

1979-10-26T23:59:59.000Z

387

TRAILS, a Toolkit for Efficient, Realistic and Evolving Models of Mobility, Faults and Obstacles in Wireless Networks  

E-Print Network (OSTI)

This functionality is implemented in a simple and flexible architecture, that follows design patterns, object to function due to enviromental func- tions. Also, researchers make a lot of simplifying assump- tions

Zaroliagis, Christos D.

388

Industry  

E-Print Network (OSTI)

of environmentally sound technology, SMEs may not have theSMEs. Energy efficiency and other GHG mitiga- tion technologies

Bernstein, Lenny

2008-01-01T23:59:59.000Z

389

of a thirty attends the  

E-Print Network (OSTI)

of Ed ves to help stu deemed critica uage immersio 0 weeks. Ther you can app tion process lik plication

Li, X. Rong

390

S_ Science Service Feature Released on receipt  

E-Print Network (OSTI)

cavern has two openings at different levels. In winter the circula- tion is reversed, at the top as from

391

Revised Version Physical Review D 77; 094011 (2008) DESY 08008  

E-Print Network (OSTI)

There was recently much activity in the phenomenol- ogy of hadronic heavy quark pair production in connec- tion

392

Apex Exponents for Polymer-Probe Interactions Michael Slutsky,1  

E-Print Network (OSTI)

, the resulting phenomenol- ogy is rather similar. Indeed, one of the technical innova- tions of this Letter

Kantor, Yacov

393

ENERGY ANALYSIS PROGRAM FY-1979.  

E-Print Network (OSTI)

for Combus- tion Turbine-Steam Turbine Combined Cycle Powercycle system and a steam turbine design, respectively. The

Authors, Various

2013-01-01T23:59:59.000Z

394

THE PASSIVE SOLAR DESIGN PROCESS FOR A SMALL OFFICE/LABORATORY BUILDING  

E-Print Network (OSTI)

and underground thermal storage), the passive solar redesignCollec- tion, storage, and distribution of solar energy in

Andersson, Brandt

2011-01-01T23:59:59.000Z

395

Forage analysis can help you determine  

E-Print Network (OSTI)

for informa- tion on purchasing a bale probe. Round Bales Sample cores should be taken midway up the side

396

Real-Time Spatio-Temporal Query Processing in Mobile Ad-Hoc Sensor Networks  

E-Print Network (OSTI)

that has multiple sensors (e.g., mo- tion sensors, acoustic sensors, infrared light emitting diodes, and pa

397

INVITED COMMENTARY Hippocampal Function, Declarative  

E-Print Network (OSTI)

- tion is further composed of the dentate gyrus, the fields of the cornu Ammonis (CA), and subiculum

Wagner, Anthony

398

Current Biology 22, 16761680, September 25, 2012 2012 Elsevier Ltd All rights reserved http://dx.doi.org/10.1016/j.cub.2012.06.067 A Genetic Basis for Altered  

E-Print Network (OSTI)

in the cornu ammonis fields of adult hippocampus, which may thus lead to an abnormal modula- tion in the sexual

Halazonetis, Thanos

399

UNCORRECTEDPROOF SNB 9420 111  

E-Print Network (OSTI)

@mail.sdsu.edu, samk@digitaladdis.com (S.K. Kassegne). tions such as marine vehicle propulsion, electromagnetic breaks

Kassegne, Samuel Kinde

400

SPECIAL ISSUE PAPER 687 Numerical modelling of oblique shock and detonation  

E-Print Network (OSTI)

complica- tion arises if the wedge is placed in the middle of a channel, as may be found in scramjet

Texas at Arlington, University of

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Wyomingís ďRosyĒ Financial Picture  

E-Print Network (OSTI)

J. (2011b) ďWyoming Clean Coal Efforts Advance,Ē Casperadministra- tion pushes for clean-coal and carbon capture

Schuhmann, Robert A.; Skopek, Tracy A.

2012-01-01T23:59:59.000Z

402

E-Print Network 3.0 - antiproton powered propulsion Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Particularly measurements of antiproton... resistance, cosmic radiation, electromagnetic interference, power consump- tion and data communication. 3... . Antiproton channel The...

403

E-Print Network 3.0 - ams radiocarbon analysis Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

deposi- tion, evaporation, precipitation, transport, etc. Atmospheric ... Source: Oak Ridge National Laboratory, Carbon Dioxide Information Analysis Center, Global Ocean...

404

electronic reprint Acta Crystallographica Section D  

E-Print Network (OSTI)

and pronounced anisotropy of the diffrac- tion pattern of the protein crystals. A posteriori re-refinement

Glykos, Nikolaos

405

One-pass tillage equipment outstrips conventional tillage method  

E-Print Network (OSTI)

Btu) of energy is expended in tillage opera- tions in California; almost all of this energy is derived from diesel

Upadhyaya, Shrinivasa K.; Lancas, Kleber P.; Santos-Filho, Abilio G.; Raghuwanshi, Narendra S.

2001-01-01T23:59:59.000Z

406

To link to this article : DOI:10.1109/LSP.2013.2296138  

E-Print Network (OSTI)

it for publica- tion was Prof. Ba-Tuong Vo. O. Besson is with the ISAE, Department Electronics Optronics Signal

Boyer, Edmond

407

168 IEEE SIGNAL PROCESSING LETTERS, VOL. 21, NO. 2, FEBRUARY 2014 Joint Bayesian Estimation of Close Subspaces  

E-Print Network (OSTI)

it for publica- tion was Prof. Ba-Tuong Vo. O. Besson is with the ISAE, Department Electronics Optronics Signal

Dobigeon, Nicolas

408

THE CORROSION OF SILICATE MATERIALS BY HYDROGEN GAS AND HYDROFLUORIC ACID SOLUTION  

E-Print Network (OSTI)

occurring in the coal gasifier and then find- ing a methodmaterial for the coal gasifier applica- tion. The corrosion

Tso, Stephen T.

2011-01-01T23:59:59.000Z

409

SOLAR ENERGY PROGRAM. CHAPTER FROM THE ENERGY AND ENVIRONMENT ANNUAL REPORT 1978  

E-Print Network (OSTI)

Berkeley, California 94720 SOLAR ENERGY Introductionutiliza- tion of solar energy in northern California. Shouldindividual solar stations currently in northern California

authors, Various

2011-01-01T23:59:59.000Z

410

CollegeofEngineering College of Engineering  

E-Print Network (OSTI)

Engineering, Neural Engineering, Bioinformatics and Genomics, and Nanobiomolecular Engineering targeting and transport, biotransduc- tion, imaging and inducible bioactivity, computational genomics

Illinois at Chicago, University of

411

A Coordinate Gradient Descent Method for l1-regularized Convex ...  

E-Print Network (OSTI)

Apr 16, 2008 ... ... each requiring n floating-point opera- tions, plus one sorting which requires O(

2008-04-23T23:59:59.000Z

412

Powering mm-Size Wireless Implants for Brain-Machine Interfaces  

E-Print Network (OSTI)

applica- tions include bio-fuel cells utilizing glucose frombatteries [Roundy04] Glucose bio-fuel cell utilizing glucose

Mark, Michael

2011-01-01T23:59:59.000Z

413

A Statistical Rainfall-Runoff Mixture Model with Heavy-Tailed Components  

E-Print Network (OSTI)

is relevant for hydroelectricity planning, irrigation and flood preven-19 tion. It is a well-known fact among

Paris-Sud XI, Université de

414

HEIGHTS initial simulation of discharge produced plasma hydrodynamics and radiation  

E-Print Network (OSTI)

and radia- tion of two-gas mixtures in dense plasma focus DPF de- vices in the presence of impurities

Harilal, S. S.

415

Stochastic models of solute transport in highly heterogeneous geologic media  

E-Print Network (OSTI)

Research and Development Founda- tion Grant Assistance Program, Project RG0-20101-RW40, with the Institute of Nuclear

Goloviznin, V.M.

2010-01-01T23:59:59.000Z

416

Sanitizable Signatures in XML Signature --Performance, Mixing Properties, and  

E-Print Network (OSTI)

]. Additionally, a redac- tion based scheme proposed by Miyazaki et al. [16] was implemented to allow performance

Posegga, Joachim

417

MILLIMETER AND SUBMILLIMETER WAVE ABSORPTION BY ATMOSPHERIC POLLUTANTS AND CONSTITUENTS  

E-Print Network (OSTI)

tion due to the Doppler effect becomes significant. At theDoppler broadening. If the broadening due to collisional effects

Kolbe, W.F.

2014-01-01T23:59:59.000Z

418

Tables Of Contents, Vol 1-43  

Science Journals Connector (OSTI)

apparent dissociation constants of phosphoric acid in seawater . ... tions of organic carbon in seawater ∑ 264 ... occurring during seawater sample storage .

Web Editor

2000-06-23T23:59:59.000Z

419

Bill Bradbury Jennifer Anders  

E-Print Network (OSTI)

in the region. Thermoelectric and hydroelectric power sta- tions were soon being built by mining and textile

420

Fall 06  

E-Print Network (OSTI)

Description: All fields of science and engineering are concerned with upscaling ... tion planning, chemical and electrical engineering, and flight mechanics.

1910-60-42T23:59:59.000Z

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Xanthomonas oryzae pathovars: model pathogens of a model crop.  

E-Print Network (OSTI)

as applica- tion of agrochemicals at the maximum tillering1960s, different kinds of agrochemicals were developed from

NiŮo-Liu, David O; Ronald, Pamela C; Bogdanove, Adam J

2006-01-01T23:59:59.000Z

422

The Annals of Applied Statistics 2009, Vol. 3, No. 1, 117143  

E-Print Network (OSTI)

of stellar evolu- tion. 1. Introduction. For most of their lives, stars are powered by thermonuclear fusion

van Dyk, David

423

INTRODUCTION ossil fuels help drive the world  

E-Print Network (OSTI)

sources to enhanced oil recovery (EOR) opera- tions, where it is injected into oil reservoirs.4 Large

424

Space Sci Rev (2008) 141: 13 DOI 10.1007/s11214-008-9474-5  

E-Print Network (OSTI)

. The exact means of solar wind energy transforma- tion and release within the magnetosphere are not yet known

California at Berkeley, University of

425

SI Group Scheduling Page  

NLE Websites -- All DOE Office Websites (Extended Search)

Personnel On-Call Page Beamline Validation Schedule Group Organizational Chart Reviews Presentations Group Scheduling Page Project Scheduling Information Ops Scheduling Info Project / Scheduling Info APS fy2005 Annual Schedule ( html ) PSS Validation Schedule APS fy2006 Annual Schedule (html) PSS Validation Teams Latest Machine Studies Schedule (pdf) (html) New Builds Schedule (For SI GROUP Reference Only) Parasitic Beam Operations Schedule Ops Scheduling Page Shutdown Information Work Schedules August/September Shutdown Shutdown Work List Validation Schedule Safety Info Work Request Links ISM Core Functions Enter / Search Work Requests APS Safety Page Modify / Approve Work Requests Radiation Safety Policy APS TMS Training Profiles MSDS Search This page maintained by Joe Budz

426

REEGLE - Clean Energy Information Gateway | Open Energy Information  

Open Energy Info (EERE)

REEGLE - Clean Energy Information Gateway REEGLE - Clean Energy Information Gateway (Redirected from Reegle Search Engine for Renewable Energy and Energy Efficiency) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: reegle.info - clean energy information portal Agency/Company /Organization: Renewable Energy and Energy Efficiency Partnership (REEEP) Sector: Climate, Energy Focus Area: Renewable Energy, Biomass, Energy Efficiency, People and Policy, Solar, Wind Phase: Evaluate Options, Prepare a Plan, Develop Finance and Implement Projects Topics: Background analysis, Implementation, Low emission development planning, -LEDS, Policies/deployment programs Resource Type: Dataset, Maps, Publications Website: www.reegle.info/ Web Application Link: www.reegle.info/ RelatedTo: REEEP Toolkits

427

International Energy Outlook 1998  

Gasoline and Diesel Fuel Update (EIA)

8) 8) Dis tri bu tion Cate gory UC-950 In ter na tional En ergy Out look 1998 April 1998 En ergy In for ma tion Ad min istra tion Of fice of In te grated Analy sis and Fore cast ing U.S. De part ment of En ergy Wash ing ton, DC 20585 This re port was pre pared by the En ergy In for ma tion Ad min istra tion, the in de pend ent sta tis ti cal and ana lyti cal agency within the De part ment of En ergy. The in for ma tion con tained herein should be at trib uted to the En ergy In for ma tion Ad min istra tion and should not be con strued as ad vo cat ing or re flect ing any pol icy po si tion of the De part ment of En ergy or of any other or gani za tion. Con tacts The Inter na tional Energy Out look is pre pared by the Energy Infor ma tion Admin istra tion (EIA). Gen eral

428

Car negie Mellon Univer sity.  

E-Print Network (OSTI)

1 211 M lti edia and Ani ation er vi es 212 21 e ote C sto er nter a tion 21 22r ansr i tion er vi an esor e er vi es M lti edia and Ani ation er vi es e ote C sto er nter a tionr ansr i tion er vi es Call

429

IBM Blue Gene Parallel Supercomputer, Brookhaven National Laboratory, (BNL)  

NLE Websites -- All DOE Office Websites (Extended Search)

L L Overview Simple Example: Compile, Link, Run Compiler Invocation Compile and Link Tips Batch Job Submission Applications Support Math Libraries MPI Version IBM Fortran Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Current Fortran compiler version number can be determined on fen by typing: ls /opt/ibmcmp/xlf/bg, will be highest number listed. IBM C/C++ Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Linux Manual: Go to XL C/C++ for Linux, choose the Product Library link, then select current version number in tab at page top. (Current C/C++

430

RHIC II Science Workshop  

NLE Websites -- All DOE Office Websites (Extended Search)

Working Groups and Convenors Working Groups and Convenors The purpose of these Working Groups is to provide an organized way for the community to refine the science agenda for the RHIC II upgrades, and make a compelling case for these upgrades to the broad nuclear physics community. A document summarizing the Working Group results, with a sharp focus on the science case for RHIC II, will be produced early in 2006. Electromagnetic Probes Convenors: Ralf Rapp, Zhangbu Xu, Gabor David Email list info Website Heavy Flavor Convenors: Ramona Vogt, Thomas Ullrich, Tony Frawley Email list info Website High pT Convenors: Denes Molnar, Saskia Mioduszewski, Kirill Filimonov Internal working group web page Email list info Equation of State Convenors: Steffen Bass, Julia Velkovska, Helen Caines Email list info

431

Template:ExplorationTechnique | Open Energy Information  

Open Energy Info (EERE)

'ExplorationTechnique' template. To define a new Exploration 'ExplorationTechnique' template. To define a new Exploration Technique, please use the Exploration Technique Form. Parameters Definition - A link to the OpenEI definition of the technique (optional) ExplorationGroup - ExplorationSubGroup - ParentExplorationTechnique - parent technique for relationship tree LithologyInfo - the type of lithology information this technique could provide StratInfo - the type of stratigraphic and/or structural information this technique could provide HydroInfo - the type of hydrogeology information this technique could provide ThermalInfo - the type of temperature information this technique could provide EstimatedCostLowUSD - the estimated value only of the low end of the cost range (units described in CostUnit) EstimatedCostMedianUSD - the estimated value only of the median cost

432

Template:ExplorationGroup | Open Energy Information  

Open Energy Info (EERE)

ExplorationGroup ExplorationGroup Jump to: navigation, search This is the 'ExplorationGroup' template. To define a new Exploration Technique, please use the Exploration Group Form. Parameters Definition - A link to the OpenEI definition of the technique (optional) ExplorationGroup - ExplorationSubGroup - LithologyInfo - the type of lithology information this technique could provide StratInfo - the type of stratigraphic and/or structural information this technique could provide HydroInfo - the type of hydrogeology information this technique could provide ThermalInfo - the type of temperature information this technique could provide EstimatedCostLowUSD - the estimated value only of the low end of the cost range (units described in CostUnit) EstimatedCostMedianUSD - the estimated value only of the median cost

433

Network  

NLE Websites -- All DOE Office Websites (Extended Search)

Site Feedback: info@es.net About ESnet A Nationwide Platform for Science Discovery The Energy Sciences Network (ESnet) is a high-performance, unclassified national network built to...

434

Document (194k)  

NLE Websites -- All DOE Office Websites (Extended Search)

8 Named Ranges 19 HTGR Cost Summary List Info HTGR Capital Cost O&Ms Yearly Fuel Cost Decomissioning Full Results Correlations CEPCI CEPCIYEAR CycChoice HeatorPower IRT Number PCyc...

435

New Products  

Science Journals Connector (OSTI)

...Finally, as a personal pipetting system, Liquidator 96 fits any benchtop or laminar-flow cabinet making it suitable for cleanroom conditions. Mettler Toledo For info: 800-472-4646 www.mt.com/liquidator Electronically submit your new product...

2014-01-03T23:59:59.000Z

436

E-Print Network 3.0 - alpha -fetoprotein controls Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Engineering ; Mathematics 65 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

437

E-Print Network 3.0 - alpha 1-microglobulin destroys Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Technologies and Information Sciences 4 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

438

E-Print Network 3.0 - alpha -chloro ethers Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Technologies and Information Sciences 31 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

439

E-Print Network 3.0 - alpha indirect conversion Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Technologies and Information Sciences 77 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

440

E-Print Network 3.0 - alpha -reductase activity Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Biology and Medicine ; Chemistry 82 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


442

Modelo Hidrulico Operacional del Oeste de Puerto Rico  

E-Print Network (OSTI)

más reciente para la modelación de sistemas complejos de redes de tuberías, InfoWater. La modelación

Gilbes, Fernando

443

Response Against Hacking and Malicious Code in P2P  

Science Journals Connector (OSTI)

We have analyzed attacks on and threats to information security, and analyzed information security service in order to provide safe P2P service from these threats. And we have proposed a method to provide info...

Wongoo Lee; Sijung Kim; Bonghan Kim

2006-01-01T23:59:59.000Z

444

Maps & Web Mapping: An Introduction to Cartography Edition (2015)  

E-Print Network (OSTI)

Maps & Web Mapping: An Introduction to Cartography 1st Edition (2015) By Keith Clarke Links Showcase Site http://www.pearsonhighered.com/clarke-1e-info/index.html Catalog Link Maps & Web Mapping

Clarke, Keith

445

K&L GATES LLP 1601 K STREET, N.W.  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 17, 2014). 10 U.S. ENERGY INFO. ADMIN., Review of Emerging Resources: U.S. Shale Gas and Shale Oil Plays (2011). 8 DC-9824999 v1 No person shall export any natural gas...

446

Last Updated 3.22.2013 NIH Activitiesand Resources  

E-Print Network (OSTI)

Measure Up? Speaker: James Marshall, Ph.D., Department of Educational Technology, San Diego State University 1:00- 2:00 p.m. Online Register / More Info 11/15/2012 Converting SMEs (Subject Matter Experts

Rau, Don C.

447

Microsoft Word - ISDAC_orientation_pkt.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and...

448

E-Print Network 3.0 - accomplishing expanded civilian Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

as some of the best in the Navy. The Tech Co n- nection expanded its summer camp program and other... civilians. Please call 656-2734 for info. Child Development...

449

ESnet History  

NLE Websites -- All DOE Office Websites (Extended Search)

(Globally) 1 510-486-7607 (Globally) Report Network Problems: trouble@es.net Provide Web Site Feedback: info@es.net ESnet History View ESnet's 25-year anniversary timeline in...

450

Microsoft Office Outlook - Memo Style  

National Nuclear Security Administration (NNSA)

are the liquid fuel usages and amounts used at RSL (we have info on liquid fuel storage tanks)? Do they only store jet JP-8 fuel and no other liquid fuels? RSL have a total of 9...

451

Heart Donít Panic! Hack it!  

Science Journals Connector (OSTI)

It seems appropriate that the Ars Electronica, whose overarching motto this year is ďInfoWarĒ, would host a ďHackertreffĒ (Hackersí meeting) as part of the Festival. The time is right: hackers are back. And si...

Patrice Riemens

1998-01-01T23:59:59.000Z

452

Physics Today News Picks: A unified picture of laser ... http://blogs.physicstoday.org/newspicks/2008/05/a_uni... 1 of 4 05/26/2008 10:15 AM  

E-Print Network (OSTI)

Telescope ¬Ľ Request product info COMPANY SPOTLIGHT CCD and TDI free seminar Learn about CCD devices Today on May 6, 2008 10:00 AM | Permalink SEARCH Search this blog: Search #12;

Rotter, Stefan

453

Slide12 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

right volume of a journal, and examine each article one at a time. For relevant articles, I had to copy the citation info by hand and also capture the meat of the article by hand....

454

Counter-Based Power Modeling Methods: Top-Down vs. Bottom-Up  

Science Journals Connector (OSTI)

......fundamental properties. The benefits of having a single model...IEEE/ACM Int. Conf. Grid Computing (GRID) 2010, Piscataway...Bellosa, F. (2000) The Benefits of Event: Driven Energy...info/. [39] SBSIF. SMART specification rev.1......

Ramon Bertran; Marc Gonzŗlez; Xavier Martorell; Nacho Navarro; Eduard Ayguadť

2013-02-01T23:59:59.000Z

455

In Proceedings of the Symposium on Virtual Reality Software and Technology (VRST-97), Lausanne, Switzerland, September 1517, 1997, pp. 8794  

E-Print Network (OSTI)

), 81925 Munich, Germany EE Dept., California Inst. of Technology, MC 136-93, Pasadena, CA 91125 Autodesk-2100 Dept of Comp & Info Science, IUPUI, 723 W. Michigan St, Indianapolis, IN 46202-5132 Email: dieter.koller@autodesk

Barr, Al

456

Dr. Joseph Cullen | Photosynthetic Antenna Research Center  

NLE Websites -- All DOE Office Websites (Extended Search)

Cullen March 22, 2013 Dr. Joseph Cullen "Measuring the Environmental Benefits of Wind Power" Published: March 22, 2013 Original Event info: March 19, 2013 12:00 pm - 1:00 pm...

457

nanoscience nanoelectronics  

E-Print Network (OSTI)

tags: toRSS nanoscience energy nanoelectronics nanomechanics Nanowires Exhibit Giant.info/#[[Nanowires%20Exhibit%... 1/2 #12;Related news list by date, most recent first: nanoscience energy

Espinosa, Horacio D.

458

MANUALE MATLAB A cura di Giuseppe Ciaburro  

E-Print Network (OSTI)

MANUALE MATLAB A cura di Giuseppe Ciaburro http://www.ciaburro.it info@ciaburro.it #12;Indice 1 Introduzione 4 1.1 Matlab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 2 Fondamenti di Matlab 7 2.1 Capacit`a di Matlab

De Marchi, Stefano

459

Switchgrass: a Valuable Biomass Crop for Energy  

Science Journals Connector (OSTI)

The editor, Andrea Monti, assembled a group of distinguished authors who have not only provided comprehensive documentation of research conducted on switchgrass, but also unique and valuable analyses of this info...

David Bransby

2012-09-01T23:59:59.000Z

460

2008 Annual Merit Review Results Summary - 8. High Efficiency...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

technically - there was lots of "info" presented but this reviewer didn't see any clear identification of where the target is and how close they are to achieving it. One final...

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

E-Print Network 3.0 - arcview gis extension Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

of Military Lands (970) 491-2748 cemml@cemml.colostate.edu Summary: using GPS, and spatial data development. ArcInfo, ArcView, ERDAS Imagine, and GRASS are some of the...

462

Culture du corps et technosciences : vers une ę mise ŗ niveau Ľ technique de líhumain? Analyse des reprťsentations du corps soutenues par le mouvement transhumaniste.  

E-Print Network (OSTI)

??LíintťrÍt marquť portť actuellement aux recherches NBIC (nano-bio-info-cognitivo technologies) visant líoptimisation des capacitťs humaines augure díun profond bouleversement dans nos reprťsentations du corps humain etÖ (more)

Robitaille, MichŤle

2008-01-01T23:59:59.000Z

463

H2 Safety Snapshot - Vol. 2, Issue 2, July 2011  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

of Energy Fuel Cell Technologies Program (www.h2bestpractices.orgsafetyplanning) u FMEA Info Centre, a non-commercial web-based inventory dedicated to the promotion of FMEA...

464

New Clues in Predicting Alzheimer's Disease  

ScienceCinema (OSTI)

Theres a new clue in the search to identify the harbingers of Alzheimers disease. More info: http://newscenter.lbl.gov/feature-stories/2008/12/16/predict-alzheimers-disease/

Jagust, William

2013-05-29T23:59:59.000Z

465

QuickStart: Learn DAX Basics in 30 Owen Duncan  

E-Print Network (OSTI)

. Why is DA It's easy to PivotCharts critical sale inventory d important c data. When line info o it. You can ev AX formulas. Bu date ranges? O mulas provide formulas will he e real business cel

Hunt, Galen

466

PDF File Information (pbl/help)  

NLE Websites -- All DOE Office Websites (Extended Search)

Services Site Help > Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov PDF File Information Many of the documents available on the Power...

467

Power Services Site Navigation Aids (pbl/help)  

NLE Websites -- All DOE Office Websites (Extended Search)

Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Site Navigation Aids In addition to the Power Services Site Map and the...

468

OpenEI Community - planning  

Open Energy Info (EERE)

Kicks Off http:en.openei.orgcommunityblogdetailed-planning-kicks

Skype call this morning to discuss details. †More info coming soon

http:en.openei.org...

469

High-Performance Scalable Information Service for the ATLAS Experiment  

E-Print Network (OSTI)

makes this facility very attractive for supporting the ATLASIS) facility has been developed in the scope of the ATLASATLAS/is/RunParams/RunParams.RunInfo One has to take into account that this facility

Kolos, S; Boutsioukis, G; Hauser, R

2012-01-01T23:59:59.000Z

470

Microsoft Word - Other Template.docx  

National Nuclear Security Administration (NNSA)

Edleman 2010 Edleman, A., U.S. Department of Energy, 2010, Personal communication (email) to J. Carilli, U.S. Department of Energy, et al., "RE: Request for GTCC info," January 25...

471

Data:603d6a66-67c9-4aa6-ae2a-3c75d6e9df5f | Open Energy Information  

Open Energy Info (EERE)

Firm Power Rate Sector: Residential Description: Source or reference: http:www.bpa.govFinanceRateInformationRatesInfoPower2014%20Power%20Rate%20Schedules%28FINAL%29.p...

472

Geologic Map of the Valles Caldera | Open Energy Information  

Open Energy Info (EERE)

of the Valles CalderaInfo GraphicMapChart Abstract The Valles caldera, located in the heart of the Jemez Mountains in north-central New Mexico, is the worlds premier example...

473

Geothermal/Geochemical Database | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search OpenEI Reference LibraryAdd to library Chart: GeothermalGeochemical DatabaseInfo GraphicMapChart Author Nevada Bureau of Mines and Geology Published...

474

Aeromagnetic map | Open Energy Information  

Open Energy Info (EERE)

map Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: Aeromagnetic mapInfo GraphicMapChart Cartographer Zietz and Kirby Published U.S. Geological Survey,...

475

University Identity Standards a manual for building a stronger identity  

E-Print Network (OSTI)

Communication and Marketing (UCAM) Rev.10.07 #12;2 UNM brand redesign UCAM (University Communication). quick info #12;1 UNM brand redesign table of contents University Identity Standards Table of Contents..................................................................................................... 2 Image & Identity

New Mexico, University of

476

V-149: Microsoft Internet Explorer Object Access Bug Lets Remote...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary Code...

477

T-699: EMC AutoStart Buffer Overflows Let Remote Users Execute...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EMC AutoStart Technical Info EMC Support Addthis Related Articles U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary Code T-639:...

478

Site Name : Las Cabras permanent stationAuthor : Sylvain, Marianne, Max Site Code :C A B R date : year 2010 month 03 day 11  

E-Print Network (OSTI)

). Battery : Lucas (12V 75Ah). Power connection : Solar pannels 20w * 2 (parallel plug). Security infos the antenna and solar panels from the horses. . CABR 2/4 #12;CABR 1-2-3 : installation. 4- vue from

Vigny, Christophe

479

Inside this issue: Cultivating Cumberland  

E-Print Network (OSTI)

. Meeting Info NJ Soybean Board Producer Mtg. Community Garden Conf. 3 AMP for On-Farm Direct Marketing customized food safety plans, streamlining the process to achieving Good Agricultural Practices certification

Goodman, Robert M.

480

Weitzlab Cleanroom User Guidelines initial draft 30 MAR 2010 by MBR  

E-Print Network (OSTI)

by MTG CONTACT INFO General questions: Ralph Sperling, sperling@seas.harvard.edu Supplies: Assaf Rotem the spin coater, or any other process that could throw off debris. These are in a tray on the wall

Note: This page contains sample records for the topic "info rma tion" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Risk Analysis 101: Fooled by local robustness . . . again!  

E-Print Network (OSTI)

Sep 24, 2012 ... It is remarkable to what length some risk analysts would go to argue for the use of info-gap's .... In other words, although the set of acceptable.

2012-09-24T23:59:59.000Z

482

1 ACIT Meeting Notes Advisory Committee for Information Technology  

E-Print Network (OSTI)

sets beyond what have been done prior, proprietary info, image manipulation, 3D visualizations, 3D printing for analytic work. · What about support for new faculty? o Expectations are higher. What is being

California at Santa Cruz, University of

483

Interpretive geothermal heat flow map of Colorado | Open Energy...  

Open Energy Info (EERE)

Interpretive geothermal heat flow map of Colorado Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: Interpretive geothermal heat flow map of ColoradoInfo...

484

RAPID/Roadmap/1-WA-a | Open Energy Information  

Open Energy Info (EERE)

Contact" button in the form to provide the contact info, and use the "Add RAPID Roadmap Section" button to provide the roadmap section the contact is associated with. This page's...

485

BPA-2012-00551-FOIA Request  

NLE Websites -- All DOE Office Websites (Extended Search)

Sent: Tuesday, January 10, 2012 11:40 AM To: FOIA Subject: Re: BPA FOIA request Hello, I have not received this info requested and the time allowed has expired. Please...

486

Documentation and evaluation of MŲssbauer data for minerals  

Science Journals Connector (OSTI)

More than 2,500 MŲssbauer spectroscopic studies on minerals have been published since 1960. These papers contain approximately 8,000 sets of MŲssbauer mineral data on at least 400 different minerals. This info...

John G. Stevens; Airat Khasanov; J. William Miller; Herman PollakÖ

487

Property in Personal Data: Second Life of an Old Idea in the Age of Cloud Computing, Chain Informatisation, and Ambient Intelligence  

Science Journals Connector (OSTI)

This contribution proposes to re-examine a familiar idea of property rights in personal data in view of the recent developments in information technology and practices. It shows that, as a result of chain info...

Nadezhda Purtova

2011-01-01T23:59:59.000Z

488

Dienstgebude: Ludwigstr. 27/I, Zi. G 109  

E-Print Network (OSTI)

.physik.uni-muenchen.de/studium/infos_studium/studienberatung Zentrale Studienberatung Studienentscheidung, Studienwahl, Fächerangebot der LMU, Zulassung und Numerus Clausus, Fächerkombinationen, Studienorganisation, formale Fragen rund ums Studium Ludwigstr 27/I, Zi. G

Hofmann, Martin

489

GIS by ESRITM Understanding Map Projections  

E-Print Network (OSTI)

GIS by ESRITM Understanding Map Projections Melita Kennedy and Steve Kopp #12;Copyright © 19942000 in the European Community. ArcInfo, ArcGIS, GIS by ESRI, and the ESRI Press logo are trademarks of Environmental

Ahmad, Sajjad

490

E-Print Network 3.0 - automated military unit Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

and tools... .574.5700 | 310.574.5752 fax | info@ict.usc.edu Military Terrain for Games Pipeline 4.11 Commercial gaming... generated military terrain for use in virtual training...

491

Zentrum fr Graduiertenstudien (ZGS) Bergische Universitt Wuppertal  

E-Print Network (OSTI)

.gesaonline.de Wuppertaler Tafel ( ) Kontakt: Werth 50 * 42275 Wuppertal * 0049 (0)202. 434441 * www.wuppertaler-tafel.de E-Mail: info@wuppertaler-tafel.de : www.tele

Bongartz, Klaus

492

CAMPUS TUTORING RESOURCE GUIDE ACCESS Williston Hall Room 100 PH: (815) 753-0203  

E-Print Network (OSTI)

CAMPUS TUTORING RESOURCE GUIDE ACCESS ­ Williston Hall ­ Room 100 PH: (815) 753-0203 http ACCY 206, 207, 288 ACCESS/PAL Tutoring Various Locations and times 753-0203 For Info Williston 100 Mon

Karonis, Nicholas T.

493

Geologic Map of the Jemez Mountains, New Mexico | Open Energy...  

Open Energy Info (EERE)

MexicoInfo GraphicMapChart Abstract Abstract unavailable Cartographers Robert Leland Smith, Roy A. Bailey and Clarence Samuel Ross Published U.S. Geological Survey, 1970 DOI Not...

494

OpenEI Community - power user  

Open Energy Info (EERE)

helpful information for OpenEI wiki authors

Enabling developers to use energy web services on OpenEI, REEGLE.info, Data.gov and across the web.† We help developers...

495

Integrated Biorefinery Process  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Concept Proof Commercial Sustainability Information Resources Office of Biomass Program, Web Site: http:www1.eere.energy.govbiomass EERE Info Center - www1.eere.energy.gov...

496

E-Print Network 3.0 - air movement impact Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org Summary: ). Including air pollution as a screening criterion acknowledges the health impacts borne by...

497

Nano-Punk For Tomorrow's People  

E-Print Network (OSTI)

Nano-Punk for Tomorrowís People By Christopher NewfieldMikhail Rocoís NBIC (nano- bio-info-cognitive) convergenceset in a Victorian-style nano era. Why Victorian? Perhaps

Newfield, Chris

2006-01-01T23:59:59.000Z

498

advanced search RESEARCH TOOLS  

E-Print Network (OSTI)

( K $ K : Copyright © The Economist Newspaper Limited 2006. All rights reserved. Advertising Info Expressions of Interest for The Development of a New Lignite Mining Facility and Associated New Electric

Boult, Terrance E.

499

American Society of Mammalogists Movements and Denning Habits of a Badger  

E-Print Network (OSTI)

& Conditions of Use, available at . http://www.jstor.org/page/info/about/policies/terms.jsp JSTOR is a not in the Netherlands. Thesis, Rijks-Univ., Utrecht, Netherlands (from Biolo. Abstracts,1953). DAVIS,W. H. 1966

Minnesota, University of

500

244.ps  

E-Print Network (OSTI)

Dec 9, 2000 ... on a Sun Ultra 2 with two UltraSPARC 300 MHz CPUs and 256 MB .... [5] J.E. Beasley, \\OR-Library," http://mscmga.ms.ic.ac.uk/info.html. [6] D.C.†...

2000-12-09T23:59:59.000Z