National Library of Energy BETA

Sample records for industry survey mailing

  1. CMI Industry Survey | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CMI Industry Survey Thank you for your interest in Critical Materials Institute Education, Training and Outreach. Please share how you are interested in education and training about critical materials. There are additional comment boxes below to allow for any additional ideas you may have. My name is: * I would like to be contacted by telephone, so I am providing a phone number: I would like to be contacted by e-mail; please use this e-mail address: My role in education and outreach about

  2. Aftertreatment Research Prioritization: A CLEERS Industrial Survey...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Research Prioritization: A CLEERS Industrial Survey Aftertreatment Research Prioritization: A CLEERS Industrial Survey Presentation given at the 2007 Diesel Engine-Efficiency &...

  3. Geothermal industry employment: Survey results & analysis

    SciTech Connect (OSTI)

    Not Available

    2005-09-01

    The Geothermal Energy Association (GEA) is ofteh asked about the socioeconomic and employment impact of the industry. Since available literature dealing with employment involved in the geothermal sector appeared relatively outdated, unduly focused on certain activities of the industry (e.g. operation and maintenance of geothermal power plants) or poorly reliable, GEA, in consultation with the DOE, decided to conduct a new employment survey to provide better answers to these questions. The main objective of this survey is to assess and characterize the current workforce involved in geothermal activities in the US. Several initiatives have therefore been undertaken to reach as many organizations involved in geothermal activities as possible and assess their current workforce. The first section of this document describes the methodology used to contact the companies involved in the geothermal sector. The second section presents the survey results and analyzes them. This analysis includes two major parts. The first part analyzes the survey responses, presents employment numbers that were captured and describes the major characteristics of the industry that have been identified. The second part of the analysis estimates the number of workers involved in companies that are active in the geothermal business but did not respond to the survey or could not be reached. Preliminary conclusions and the study limits and restrictions are then presented. The third section addresses the potential employment impact related to manufacturing and construction of new geothermal power facilities. Indirect and induced economic impacts related with such investment are also investigated.

  4. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  5. Industry survey for horizontal wells. Final report

    SciTech Connect (OSTI)

    Wilson, D.D.; Kaback, D.S. [CDM Federal Programs Corp., Denver, CO (United States); Denhan, M.E. [Westinghouse Savannah River Co., Aiken, SC (United States); Watkins, D. [CDM Federal Programs Corp., Aiken, SC (United States)

    1993-07-01

    An international survey of horizontal environmental wells was performed during May and June of 1993. The purpose of the survey was to provide the environmental industry with an inventory of horizontal environmental wells and information pertaining to the extent of the use of horizontal environmental wells, the variety of horizontal environmental well applications, the types of geologic and hydrogeologic conditions within which horizontal environmental wells have been installed, and the companies that perform horizontal environmental well installations. Other information, such as the cost of horizontal environmental well installations and the results of tests performed on the wells, is not complete but is provided as general information with the caveat that the information should not be used to compare drilling companies. The result of the survey is a catalogue of horizontal environmental wells that are categorized by the objective or use of the wells, the vertical depth of the wells, and the drilling company contracted to install the wells.

  6. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. Geothermal Energy Growth Continues, Industry Survey Reports

    Broader source: Energy.gov [DOE]

    A survey released by the Geothermal Energy Association (GEA) shows continued growth in the number of new geothermal power projects under development in the United States, a 20% increase since January of this year.

  8. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  9. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  10. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  11. Energy conservation by hyperfiltration: food industry background literature survey

    SciTech Connect (OSTI)

    Not Available

    1980-04-15

    The application of hyperfiltration to selected food product streams and food processing wastewaters for energy conservation was examined. This literature survey had led to the following conclusions: no research has been conducted in the food industry using membranes with hot process streams due to the temperature limitation (< 40/sup 0/C) of the typically studied cellulose acetate membranes; based on the bench-scale research reviewed, concentration of fruit and vegetable juices with membranes appears to be technically feasible; pretreatment and product recovery research was conducted with membranes on citrus peel oil, potato processing and brine wastewaters and wheys. The experiments demonstrated that these applications are feasible; many of the problems that have been identified with membranes are associated with either the suspended solids or the high osmotic pressure and viscosity of many foods; research using dynamic membranes has been conducted with various effluents, at temperatures to approx. 100/sup 0/C, at pressures to 1200 psi and with suspended solids to approx. 2%; and, the dynamic membrane is being prototype tested by NASA for high temperature processing of shower water. The literature review substantiates potential for dynamic membrane on porous stainless tubes to process a number of hot process and effluent streams in the food processing industry. Hot water for recycle and product concentrations are major areas with potential for economic application. The two plants involved in the first phase of the project should be reviewed to identify potential energy conservation applications. As many as possible of the conservation applications should be tested during the screening phase at each site. The most promising applications at each site should be evaluated more intensively to establish engineering estimates of the economics of this technology for the canned fruit and vegetable segment of the food industry.

  12. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  13. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  14. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  15. Manufacturing-Industrial Energy Consumption Survey(MECS) Historical...

    U.S. Energy Information Administration (EIA) Indexed Site

    reports, data tables and questionnaires Released: May 2008 The Manufacturing Energy Consumption Survey (MECS) is a periodic national sample survey devoted to measuring...

  16. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  17. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  18. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  19. Microsoft Word - Wind Industry Work Order Information Flow Survey...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... summarizes the findings of a preliminary survey of wind turbine maintenance management. ... With current mobile technology CMMS can solve many of the challenges associated with ...

  20. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  1. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  2. Workforce Development: A Survey of Industry Needs and Training Approaches

    SciTech Connect (OSTI)

    Ventre, Jerry; Weissman, Jane

    2009-04-01

    This paper presents information and data collected during 2008 on PV workforce needs by the Interstate Renewable Energy Council for the U.S. Department of Energy. The data was collected from licensed contractors, PV practitioners, educators and expert instructors at training sessions, and at focus group and advisory committee meetings. Respondents were primarily from three states: Florida, New York and California. Other states were represented, but to a lesser extent. For data collection, a 12-item questionnaire was developed that addressed key workforce development issues from the perspectives of both the PV industry and training institutions. A total of 63 responses were collected, although not every respondent answered every question. Industry representatives slightly outnumbered the educators, although the difference in responses was not significant.

  3. Survey of US Department of Defense Manufacturing Technology Program activities applicable to civilian manufacturing industries. Final report

    SciTech Connect (OSTI)

    Azimi, S.A.; Conrad, J.L.; Reed, J.E.

    1985-03-01

    Intent of the survey was to identify and characterize activities potentially applicable to improving energy efficiency and overall productivity in the civilian manufacturing industries. The civilian industries emphasized were the general manufacturing industries (including fabricated metals, glass, machinery, paper, plastic, textile, and transportation equipment manufacturing) and the primary metals industries (including primary aluminum, copper, steel, and zinc production). The principal steps in the survey were to: develop overview taxonomies of the general manufacturing and primary metals industries as well as specific industry taxonomies; identify needs and opportunities for improving process energy efficiency and productivity in the industries included; identify federal programs, capabilities, and special technical expertise that might be relevant to industry's needs and opportunities; contact federal laboratories/facilities, through visits and other forms of inquiry; prepare formatted profiles (descriptions) potentially applicable work efforts; review findings with industry; and compile and evaluate industry responses.

  4. CHP Industrial Bottoming and Topping Cycle with Energy Information Administration Survey Data

    U.S. Energy Information Administration (EIA) Indexed Site

    CHP Industrial Bottoming and Topping Cycle with Energy Information Administration Survey Data Paul Otis, August 14, 2015 Independent Statistics & Analysis www.eia.gov U.S. Energy Information Administration Washington, DC 20585 This paper is released to encourage discussion and critical comment. The analysis and conclusions expressed here are those of the authors and not necessarily those of the U.S. Energy Information Administration. DISCUSSION PAPER SERIES August 2015 Paul Otis | U.S.

  5. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  6. Industrial Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Industrial Industrial Manufacturing Buildings Industrialmanufacturing buildings are not considered commercial, but are covered by the Manufacturing Energy Consumption Survey...

  7. INTERNAL REPAIR OF GAS PIPLINES SURVEY OF OPERATOR EXPERIENCE AND INDUSTRY NEEDS REPORT

    SciTech Connect (OSTI)

    Ian D. Harris

    2003-09-01

    A repair method that can be applied from the inside of a gas transmission pipeline (i.e., a trenchless repair) is an attractive alternative to conventional repair methods since the need to excavate the pipeline is precluded. This is particularly true for pipelines in environmentally sensitive and highly populated areas. The objectives of the project are to evaluate, develop, demonstrate, and validate internal repair methods for pipelines; develop a functional specification for an internal pipeline repair system; and prepare a recommended practice for internal repair of pipelines. The purpose of this survey is to better understand the needs and performance requirements of the natural gas transmission industry regarding internal repair. A total of fifty-six surveys were sent to pipeline operators. A total of twenty completed surveys were returned, representing a 36% response rate, which is considered very good given the fact that tailored surveys are known in the marketing industry to seldom attract more than a 10% response rate. The twenty survey responses produced the following principal conclusions: (1) Use of internal weld repair is most attractive for river crossings, under other bodies of water (e.g., lakes and swamps) in difficult soil conditions, under highways, under congested intersections, and under railway crossings. All these areas tend to be very difficult and very costly if, and where, conventional excavated repairs may be currently used. (2) Internal pipe repair offers a strong potential advantage to the high cost of horizontal direct drilling (HDD) when a new bore must be created to solve a leak or other problem in a water/river crossing. (3) The typical travel distances required can be divided into three distinct groups: up to 305 m (1,000 ft.); between 305 m and 610 m (1,000 ft. and 2,000 ft.); and beyond 914 m (3,000 ft.). In concept, these groups require pig-based systems; despooled umbilical systems could be considered for the first two groups. For the last group a self-propelled system with an onboard self-contained power and welding system is required. (4) Pipe size range requirements range from 50.8 mm (2 in.) through 1,219.2 mm (48 in.) in diameter. The most common size range for 80% to 90% of operators surveyed is 508 mm to 762 mm (20 in. to 30 in.) diameter, with 95% using 558.8 mm (22 in.) diameter pipe.

  8. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  9. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  10. Tax and Fiscal Policies for Promotion of Industrial EnergyEfficiency: A Survey of International Experience

    SciTech Connect (OSTI)

    Price, Lynn; Galitsky, Christina; Sinton, Jonathan; Worrell,Ernst; Graus, Wina

    2005-09-15

    The Energy Foundation's China Sustainable Energy Program (CSEP) has undertaken a major project investigating fiscal and tax policy options for stimulating energy efficiency and renewable energy development in China. This report, which is part of the sectoral sub-project studies on energy efficiency in industry, surveys international experience with tax and fiscal policies directed toward increasing investments in energy efficiency in the industrial sector. The report begins with an overview of tax and fiscal policies, including descriptions and evaluations of programs that use energy or energy-related carbon dioxide (CO2) taxes, pollution levies, public benefit charges, grants or subsidies, subsidized audits, loans, tax relief for specific technologies, and tax relief as part of an energy or greenhouse gas (GHG) emission tax or agreement scheme. Following the discussion of these individual policies, the report reviews experience with integrated programs found in two countries as well as with GHG emissions trading programs. The report concludes with a discussion of the best practices related to international experience with tax and fiscal policies to encourage investment in energy efficiency in industry.

  11. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  12. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  13. Locations of Industrial Assessment Centers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers (IACs) Locations of Industrial Assessment Centers ... John Gardner Phone: (208) 426-5702 E-mail: jgardner@boisestate.edu Address: CAES Energy ...

  14. Industry

    SciTech Connect (OSTI)

    Bernstein, Lenny; Roy, Joyashree; Delhotal, K. Casey; Harnisch, Jochen; Matsuhashi, Ryuji; Price, Lynn; Tanaka, Kanako; Worrell, Ernst; Yamba, Francis; Fengqi, Zhou; de la Rue du Can, Stephane; Gielen, Dolf; Joosen, Suzanne; Konar, Manaswita; Matysek, Anna; Miner, Reid; Okazaki, Teruo; Sanders, Johan; Sheinbaum Parado, Claudia

    2007-12-01

    This chapter addresses past, ongoing, and short (to 2010) and medium-term (to 2030) future actions that can be taken to mitigate GHG emissions from the manufacturing and process industries. Globally, and in most countries, CO{sub 2} accounts for more than 90% of CO{sub 2}-eq GHG emissions from the industrial sector (Price et al., 2006; US EPA, 2006b). These CO{sub 2} emissions arise from three sources: (1) the use of fossil fuels for energy, either directly by industry for heat and power generation or indirectly in the generation of purchased electricity and steam; (2) non-energy uses of fossil fuels in chemical processing and metal smelting; and (3) non-fossil fuel sources, for example cement and lime manufacture. Industrial processes also emit other GHGs, e.g.: (1) Nitrous oxide (N{sub 2}O) is emitted as a byproduct of adipic acid, nitric acid and caprolactam production; (2) HFC-23 is emitted as a byproduct of HCFC-22 production, a refrigerant, and also used in fluoroplastics manufacture; (3) Perfluorocarbons (PFCs) are emitted as byproducts of aluminium smelting and in semiconductor manufacture; (4) Sulphur hexafluoride (SF{sub 6}) is emitted in the manufacture, use and, decommissioning of gas insulated electrical switchgear, during the production of flat screen panels and semiconductors, from magnesium die casting and other industrial applications; (5) Methane (CH{sub 4}) is emitted as a byproduct of some chemical processes; and (6) CH{sub 4} and N{sub 2}O can be emitted by food industry waste streams. Many GHG emission mitigation options have been developed for the industrial sector. They fall into three categories: operating procedures, sector-wide technologies and process-specific technologies. A sampling of these options is discussed in Sections 7.2-7.4. The short- and medium-term potential for and cost of all classes of options are discussed in Section 7.5, barriers to the application of these options are addressed in Section 7.6 and the implication of industrial mitigation for sustainable development is discussed in Section 7.7. Section 7.8 discusses the sector's vulnerability to climate change and options for adaptation. A number of policies have been designed either to encourage voluntary GHG emission reductions from the industrial sector or to mandate such reductions. Section 7.9 describes these policies and the experience gained to date. Co-benefits of reducing GHG emissions from the industrial sector are discussed in Section 7.10. Development of new technology is key to the cost-effective control of industrial GHG emissions. Section 7.11 discusses research, development, deployment and diffusion in the industrial sector and Section 7.12, the long-term (post-2030) technologies for GHG emissions reduction from the industrial sector. Section 7.13 summarizes gaps in knowledge.

  15. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  16. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  17. Walk-through survey report: Control technology for metal reclamation industries at East Penn Manufacturing Company Inc. , Lyon Station, Pennsylvania

    SciTech Connect (OSTI)

    Hall, R.M.

    1994-08-12

    A walk through survey was conducted at the East Penn Manufacturing Company (SIC-3341), Lyon Station, Pennsylvania to identify and evaluate potentially effective controls and work practices in the lead (7439921) reclamation industry. The facility was a secondary lead smelter which operated 7 days a week, and recycled about 20,000 batteries a day, primarily automobile batteries. The company employed automation, local exhaust ventilation, partial enclosures, and enclosed ventilation systems in the reverberatory furnace operations, blast furnace operations, and casting and refinery area to reduce employee exposure to lead. The arsenic (7440382) personal exposure time weighted averages ranged from 0.10 to 1.14 microg/cubic m in the industrial battery breaking area and ranged from nondetected to 6.16 microg/cubic m in the alloying/pots area.

  18. A utility survey and market assessment on repowering in the electric power industry

    SciTech Connect (OSTI)

    Klara, J.M.; Weinstein, R.E.; Wherley, M.R.

    1996-08-01

    Section 1 of this report provides a background about the DOE High Performance Power Systems (HIPPS) program. There are two kinds of HIPPS cycles under development. One team is led by the Foster Wheeler Development Corporation, the other team is led by the United Technologies Research Center. These cycles are described. Section 2 summarizes the feedback from the survey of the repowering needs of ten electric utility companies. The survey verified that the utility company planners favor a repowering for a first-of-a-kind demonstration of a new technology rather than an all-new-site application. These planners list the major factor in considering a unit as a repowering candidate as plant age: they identify plants built between 1955 and 1965 as the most likely candidates. Other important factors include the following: the need to reduce operating costs; the need to perform major maintenance/replacement of the boiler; and the need to reduce emissions. Section 3 reports the results of the market assessment. Using the size and age preferences identified in the survey, a market assessment was conducted (with the aid of a power plant data base) to estimate the number and characteristics of US generating units which constitute the current, primary potential market for coal-based repowering. Nearly 250 units in the US meet the criteria determined to be the potential repowering market.

  19. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  20. Surveys

    Broader source: Energy.gov [DOE]

    Surveys can be a useful way to gauge the opinions of your readers and learn more about your website's audiences, but you'll often need approval from the Office of Management and Budget (OMB) to run...

  1. Results of industry experience survey on coiled tubing uses and failures

    SciTech Connect (OSTI)

    Maldonado, J.G.; Cayard, M.S.; Kane, R.D.

    1999-11-01

    A survey of coiled tubing failures in various field applications was conducted. The survey included the collection of information on failure type, number of strain cycles to failure, service environment, well depth, failure location on the coiled tubing string, and coiled tubing grade employed. The most prevalent causes of failures and the impact of localized corrosion on the performance of coiled tubing were assessed from over thirty case studies herein reported. Pitting and tensile overload were the primary causes for failure in fifty percent of the cases reported from the field. Fatigue and weld area failures were the next most common types of failure. Most failures occurred within the range of 10 to 50 strain cycles. H{sub 2}S and brine/water containing environments were the most prevalent service conditions. Most failures occurred at well depths between 5,001 to 10,000 feet (1,524.3 to 3,048 meters). Also, most failures occurred in the coiled tubing string near the surface (less than 1,000 feet (304.8 meters)). Failures in roughly similar numbers were reported in 70, 80 and 100 coiled tubing grades. The understanding of the principal modes of failure herein reported should help in the development of improved handling and running procedures to minimize coiled tubing failures.

  2. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  3. Industrial hygiene survey report of worker exposures to organotins at Norfolk Naval Shipyard, Portsmouth, Virginia

    SciTech Connect (OSTI)

    Eissler, A.W.; Ferrel, T.W.; Bloom, T.F.; Fajen, J.M.

    1985-06-24

    Breathing-zone samples were analyzed for organotin compounds, copper, and xylene during spray application of organotin containing marine antifouling paint at Norfolk Naval Shipyard, Portsmouth, Virginia, March, 1984. The survey was part of a NIOSH study of occupational exposures to organotin compounds, conducted as a component of an assessment to determine the feasibility of conducting a study of reproductive effects. Company personnel records were reviewed. Work practices were observed. The authors conclude that a potential exists for exposures to organotins and copper. As all employees were wearing respiratory protective equipment, actual exposures may be less than that indicated by the analytical data. The facility could contribute 16 potentially exposed workers to the reproductive effects study.

  4. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  5. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  6. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  7. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  8. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  9. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  14. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Waste Heat Management Options: Industrial Process Heating Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Management Options Industrial Process Heating Systems By Dr. Arvind C. Thekdi E-mail: athekdi@e3minc.com E3M, Inc. August 20, 2009 2 Source of Waste Heat in Industries * Steam ...

  17. Industry Partnerships

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry Partnerships

  18. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  19. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  20. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  1. A Survey of the U.S. ESCO Industry: Market Growth and Development from 2008 to 2011

    SciTech Connect (OSTI)

    Satchwell, Andrew; Goldman, Charles; Larsen, Peter; Gilligan, Donald; Singer, Terry

    2010-06-08

    In this study, LBNL analyzes the current size of the Energy Service Company (ESCO) industry, industry growth projections to 2011, and market trends in order to provide policymakers with a more indepth understanding of energy efficiency activity among private sector firms. We draw heavily on information from interviews with ESCOs conducted from October 2009 to February 2010 and from our review of publicly available financial information regarding individual ESCOs. A significant ramp-up in energy efficiency activities is occurring at the local, state, and federal level. These activities include the establishment in {approx}18 states of statewide energy savings goals to be obtained from adoption of an Energy Efficiency Resource Standard (EERS), legislative or state regulatory directives to obtain all cost-effective demand-side resources (Barbose et al 2009), and a significant increase in federal funding for energy efficiency programs as part of the American Recovery and Reinvestment Act (ARRA). As part of this increased focus on energy efficiency, policymakers are evaluating the role of private sector companies, including ESCOs, in delivering cost-effective energy savings to end-users. The U.S. ESCO industry has long been recognized for its role in successfully delivering comprehensive energy projects in the public sector. This study analyzes the current size of the ESCO industry, industry growth projections, and market trends in order to provide policymakers with a more in-depth understanding of energy efficiency activity among private sector firms. This study may also be of interest to policymakers abroad who are exploring options to encourage development of a private-sector energy services industry in their own countries. This study draws heavily on information from interviews with ESCOs conducted from October 2009 to February 2010 and is part of a series of ESCO industry reports prepared by Lawrence Berkeley National Laboratory (LBNL) in collaboration with the National Association of Energy Services Companies (NAESCO). The analysis builds on previous ESCO industry reports (see Goldman et al. 2005 and Hopper et al. 2007) and provides updated estimates of ESCO industry revenues and ESCO views on perceived trends in costs and savings.

  2. Employee Surveys

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Employee Surveys

  3. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  4. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  5. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  6. Industrial hygiene walk-through survey report of E. I. Dupont de Nemours and Company, Inc. , Chocolate Bayou Plant, Alvin, Texas

    SciTech Connect (OSTI)

    Fajen, J.M.

    1985-05-01

    A walkthrough survey of EI duPont deNemours and Company, Incorporated, Alvin, Texas was conducted in November, 1984. The purpose of the survey was to obtain information on the 1,3-butadiene monomer manufacturing process and the potential for exposure. The facility manufactured a crude product stream containing 1,3-butadiene as a coproduct of its ethylene process. The crude was refined to a 99.5% 1,3-butadiene product. The refining process occurred in a closed system, tightly maintained for economic, fire, and health-hazard reasons. The product was transferred by way of a pipeline to storage spheres for later transport off site. The facility used an open-loop cylinder (bomb) technique for quality control sampling. All pumps were equipped with single mechanical seals, which were in the process of being replaced by tandem seals. Since 1962, the facility had experienced process changes and three changes of ownership. Because of these changes, records from previous owners of industrial hygiene monitoring were not available. Job titles identified as having potential exposure were processors, wage employee supervisors, production engineers, and laboratory technicians. The author concludes that a closed-loop manual quality-control sampling system should be installed to reduce exposure from this source.

  7. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  8. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  9. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  10. Uranium industry annual 1998

    SciTech Connect (OSTI)

    1999-04-22

    The Uranium Industry Annual 1998 (UIA 1998) provides current statistical data on the US uranium industry`s activities relating to uranium raw materials and uranium marketing. It contains data for the period 1989 through 2008 as collected on the Form EIA-858, ``Uranium Industry Annual Survey.`` Data provides a comprehensive statistical characterization of the industry`s activities for the survey year and also include some information about industry`s plans and commitments for the near-term future. Data on uranium raw materials activities for 1989 through 1998, including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment, are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2008, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, and uranium inventories, are shown in Chapter 2. The methodology used in the 1998 survey, including data edit and analysis, is described in Appendix A. The methodologies for estimation of resources and reserves are described in Appendix B. A list of respondents to the ``Uranium Industry Annual Survey`` is provided in Appendix C. The Form EIA-858 ``Uranium Industry Annual Survey`` is shown in Appendix D. For the readers convenience, metric versions of selected tables from Chapters 1 and 2 are presented in Appendix E along with the standard conversion factors used. A glossary of technical terms is at the end of the report. 24 figs., 56 tabs.

  11. Industrial demand-side management programs: What`s happened, what works, what`s needed

    SciTech Connect (OSTI)

    Jordan, J.A.; Nadel, S.M.

    1993-03-01

    In order to analyze experience to date with industrial demand-side management (DSM), a survey of utilities was conducted and a database of industrial DSM programs was prepared. More than eighty utilities and third-party organizations were interviewed. Data were collected via phone, fax, and/or mail from the utilities and entered into a database. In order to limit the scope of this study, the database contains incentive-based, energy-saving programs and not load management or information-only programs (including technical assistance programs). Programs in the database were divided into four categories: two ``prescriptive rebate`` categories and two ``custom rebate`` categories. The database contains 31 incentive-based, energy-saving industrial DSM programs offered by 17 utilities. The appendix to this report summarizes the results approximately 60 industrial DSM programs. Most of the programs included in the appendix, but not in the database, are either C&I programs for which commercial and industrial data were not disaggregated or new industrial DSM programs for which data are not yet available.

  12. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  13. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  14. The Fuel Cell Industrial Vehicle Jobs Act (H.R. 1659)

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SIMPLE, SMART REFORM TO PROMOTE JOB GROWTH The Fuel Cell Industrial Vehicle Jobs Act (H.R. ... RLIPSEY@MAIL.HOUSE.GOV Your Plan Your Plan H.R. 1659 Example H.R. 1659 Example JOB ...

  15. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  16. 2010 - Federal Viewpoint Survey Reports | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 - Federal Viewpoint Survey Reports 2010 - Federal Viewpoint Survey Reports The 2010 Trend report provides summary results for the Department or Energy's portion of the Federal Employee Viewpoint Survey. The report also shows how the 2010 results compare to the results of previous years. PDF icon Department of Energy: 2010 Federal Employee Viewpoint Survey Trend Report Responsible Contacts Thomasina Mathews PROGRAM MANAGER E-mail thomasina.mathews@hq.doe.gov Phone 202-586-2657 More Documents

  17. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  18. NREL Helps Industry Partner Commercialize Promising Technology For Forest

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Products Industry Industry Partner Commercialize Promising Technology For Forest Products Industry For more information contact: e:mail: Public Affairs Golden, Colo., April 3, 1997 -- The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) recently signed a cooperative research and development agreement (CRADA) with Minerals Technologies, Inc. of Bethlehem, Penn. to conduct research to improve the quality of paper derived from thermomechanical pulp (TMP). The 17-month

  19. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  20. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  1. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  2. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  3. Steel Industry Profile | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... billion in energy costs for heat and power.7 The industry has made significant ... Iron and Steel Institute, Annual Statistical Report 2009 3 U.S. Geological Survey, ...

  4. EIA Energy Efficiency-Table 4f. Industrial Production Indexes...

    Gasoline and Diesel Fuel Update (EIA)

    f Page Last Modified: May 2010 Table 4f. Industrial Production Indexes by Selected Industries, 1998, 2002, and 2006 (2000 100) MECS Survey Years NAICS Subsector and Industry 1998...

  5. FY14-Q1 1.2.1.3.ML.1 INL Biomass Feeding Survey Report

    SciTech Connect (OSTI)

    Tyler L. Westover

    2014-04-01

    Approximately 20 institutions were contacted by telephone and/or electronic mail and requested to provide responses to a survey on feeding biomass feedstock materials. Fourteen individuals responded. Responses from the participants, including information that was offered in addition to answers to the survey questions are summarized in this report, which fully meets the requirements of the milestone.

  6. 2013 - Federal Viewpoint Survey Reports | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 - Federal Viewpoint Survey Reports 2013 - Federal Viewpoint Survey Reports The following highlight report focuses on the Department of Energy's areas of strengths and challenges, identifies areas of progress and opportunities for improvement. The Departments 2013 results are compared with the 2012 Government wide results. PDF icon 2013 FEVS DOE Agency Management Report.pdf Responsible Contacts Thomasina Mathews PROGRAM MANAGER E-mail thomasina.mathews@hq.doe.gov Phone 202-586-2657 More

  7. 2015-Federal Viewpoint Survey Reports | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-Federal Viewpoint Survey Reports 2015-Federal Viewpoint Survey Reports The following highlight report focuses on the Department of Energy's areas of strengths and challenges, identifies areas of progress and opportunities for improvement. The Departments 2015 results are compared with the 2014 Government wide results. PDF icon 2015_FEVS_AMR_Department_of_Energy.pdf PDF icon 2015_FEVS_AES_Department_of_Energy.pdf Responsible Contacts Thomasina Mathews PROGRAM MANAGER E-mail

  8. Aftertreatment Research Prioritization: A CLEERS Industrial Survey

    Broader source: Energy.gov [DOE]

    Presentation given at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT).

  9. Industrial Permit

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Permit Industrial Permit The Industrial Permit authorizes the Laboratory to discharge point-source effluents under the National Pollutant Discharge Elimination System. October 15, 2012 Outfall from the Laboratory's Data Communications Center cooling towers Intermittent flow of discharged water from the Laboratory's Data Communications Center eventually reaches perennial segment of Sandia Canyon during storm events (Outfall 03A199). Contact Environmental Communication & Public

  10. Industrial Users

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    by cosmic-ray-induced neutrons upon miniature electronic devices, such as chips that help control aircraft or complex integrated circuits in automobiles. Industrial User...

  11. OTHER INDUSTRIES

    Broader source: Energy.gov [DOE]

    AMO funded research results in novel technologies in diverse industries beyond the most energy intensive ones within the U.S. Manufacturing sector. These technologies offer quantifiable energy...

  12. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  13. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  14. Industrial Users

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Users - Media Publications and Information The Invisible Neutron Threat Neutron-Induced Failures in Semiconductor Devices Nuclear Science Research at the LANSCE-WNR Facility Links About WNR Industrial Users 4FP30L-A/ICE House 4FP30R/ICE II Media

  15. Industry Economist

    Broader source: Energy.gov [DOE]

    A successful candidate in this position will report to the Manager of Load Forecasting and Analysis of the Customer Services Organization. He/she serves as an industry economist engaged in load...

  16. Industry Perspective

    Broader source: Energy.gov [DOE]

    Fuel cell and biogas industries perspectives. Presented by Mike Hicks, Fuel Cell and Hydrogen Energy Association, at the NREL/DOE Biogas and Fuel Cells Workshop held June 11-13, 2012, in Golden, Colorado.

  17. Industry @ ALS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry @ ALS Industry @ ALS Hewlett Packard Labs Gains Insights with Innovative ALS Research Tools Print Thursday, 05 May 2016 11:21 For the past eight years, Hewlett Packard Labs, the central research organization of Hewlett Packard Enterprise, has been using cutting-edge ALS techniques to advance some of their most promising technological research, including vanadium dioxide phase transitions and atomic movement during memristor operation. Read more... ALS, Molecular Foundry, and aBeam

  18. Buildings Energy Data Book: 2.7 Industrialized Housing (IH)

    Buildings Energy Data Book [EERE]

    1 2007 Top Five Manufacturers of Factory-Built Housing Units (1) Company CMH Manufacturing 20% Champion Enterprises, Inc. 19% Palm Harbor Homes, Inc. 10% Fleetwood Enterprises, Inc. 9% Skyline Corporation 6% Note(s): Source(s): 8,207 376.4 1) Data based on mail-in surveys from manufacturers which may not be entirely complete. 2) Market shares based on total gross sales volume of the factory-built home producers included in the list of the top 25 factory-built producers responding to the survey.

  19. Buildings Energy Data Book: 2.7 Industrialized Housing (IH)

    Buildings Energy Data Book [EERE]

    2 2007 Top Five Manufacturers of Modular/3D Housing Units (1) Company Champion Enterprises, Inc. 27% CMH Manufacturing 14% All American Homes, LLC 10% Palm Harbor Homes, Inc. 10% Excel Homes LLC 7% Note(s): Source(s): 1,200 110.6 1) Data based on mail-in surveys from manufacturers, which may not be entirely complete. 2) Market shares based on total gross sales volume of the Modular/3D home producers included in the list of the top 25 factory-built producers responding to the survey. In 2007,

  20. Buildings Energy Data Book: 2.7 Industrialized Housing (IH)

    Buildings Energy Data Book [EERE]

    3 2007 Top Five Manufacturers of HUD-Code (Mobile) Homes (1) Company CMH Manufacturing 23% Champion Enterprises, Inc. 18% Fleetwood Enterprises, Inc. 12% Palm Harbor Homes 11% Skyline Corporation 8% Note(s): Source(s): 8,207 376 1) Data based on mail-in surveys from manufacturers, which may not be entirely complete. 2) Market shares based on total gross sales volume of the HUD-Code home producers included in the list of the top 25 factory-built producers responding to the survey. In 2007,

  1. Coal industry annual 1997

    SciTech Connect (OSTI)

    1998-12-01

    Coal Industry Annual 1997 provides comprehensive information about US coal production, number of mines, prices, productivity, employment, productive capacity, and recoverable reserves. US Coal production for 1997 and previous years is based on the annual survey EIA-7A, Coal Production Report. This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States. This report includes a national total coal consumption for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. 14 figs., 145 tabs.

  2. Digital Surveying Directional Surveying Specialists | Open Energy...

    Open Energy Info (EERE)

    Surveying Specialists Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Digital Surveying Directional Surveying Specialists Author Directional Surveying...

  3. Commercial / Industrial Lighting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Commercial Program Development Commercial Current Promotions Industrial Federal Agriculture Commercial & Industrial Lighting Efficiency Program The Commercial & Industrial...

  4. Monument Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photographs from the WIPP Permanent Marker Monument Survey John Hart & Associates, 2000 Photograph of the Gnome Marker located about 10 miles SW of the WIPP site For more...

  5. radiological. survey

    National Nuclear Security Administration (NNSA)

    7%2A en NNSA to Conduct Aerial Radiological Surveys Over San Francisco, Pacifica, Berkeley, And Oakland, CA Areas http:nnsa.energy.govmediaroompressreleasesamsca

  6. Survey Consumption

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    purchase diaries from a subset of respondents composing a Household Transportation Panel and is reported separately. Residential Energy Consumption Survey: Consumption and...

  7. ARM User Survey Report: Data Access, Quality, and Delivery

    SciTech Connect (OSTI)

    Mather, JH; Roeder, LR; Sivaraman, C

    2012-06-28

    The objective of this survey was to obtain user feedback to determine how users of the Atmospheric Radiation Measurement (ARM) Climate Research Facility Data Archive interact with the more than 2000 available types of datastreams. The survey also gathered information about data discovery and data quality. The Market and Competitive Analysis group at Pacific Northwest National Laboratory worked with web administrators to develop a landing page from which users could access the survey. A survey invitation was sent by ARM via email to about 6100 users on February 22, 2012. The invitation was also posted on the ARM website and Facebook page. Reminders were sent via e-mail and posted on Facebook while the survey was open, February 22-March 23, 2012.

  8. GEA Industry Briefing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry Briefing GEA Industry Briefing U.S. Department of Energy progress in geothermal energy deployment was addressed at the State of the Industry Geothermal Briefing in Washington, DC on February 24, 2015. Eric Hass, hydrothermal program manager for the Geothermal Technologies Office presented. Exploration drilling in the Wind River Valley basin validates the geothermal resource there. Source: Wyoming State Geological Survey U.S. Department of Energy progress in geothermal energy deployment

  9. Process Heating Assessment and Survey Tool Fact Sheet

    Broader source: Energy.gov [DOE]

    This fact sheet describes how industrial plants can improve their process heating system performance using AMO's Process Heating Assessment and Survey Tool (PHAST)

  10. Process Heating Assessment and Survey Tool | Department of Energy

    Energy Savers [EERE]

    methods to improve thermal efficiency of heating equipment. This tool helps industrial users survey process heating equipment that consumes fuel, steam, or electricity,...

  11. State Geological Survey Contributions to NGDS Data Development...

    Open Energy Info (EERE)

    Arizona Geological Survey Awardee Website http:www.azgs.az.gov Partner 1 Microsoft Research Partner 2 Energy Industry Metadata Standards Working Group Partner 4 String...

  12. Sustainable Nanomaterials Industry Perspective

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry Perspective U.S. Department of Energy Advanced Manufacturing Office Sustainable ... the forest products industry through innovation 2 The U.S. Forest Products Industry's ...

  13. Roadmap to Guide U.S. Photovoltaics Industry in 21st Century

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Roadmap to Guide U.S. Photovoltaics Industry in 21st Century For more information contact: George Douglas, 303-275-4096 e:mail: George Douglas Golden, Colo., Jan. 20, 2000 - Americans want clean solar electricity. The U.S. photovoltaics industry wants them to have it. Solar-cell manufacturers and suppliers see photovoltaics (PV) producing at least 15 percent of the additional electrical power the United States will need in 2020. But how will the industry bring down costs, overcome market

  14. Buildings Energy Data Book: 2.7 Industrialized Housing (IH)

    Buildings Energy Data Book [EERE]

    4 2004 Top Five Manufacturers of Factory-Fabricated Components (1) Company Carpenter Contractors 175.0 1,130 Automated Building Company 102.5 702 Landmark Truss 45.0 425 Southern Building Products 25.9 180 Dolan Lumber & Truss 25.1 260 Note(s): Source(s): Automated Builder Magazine, Sept. 2005, p. 40-41. 26% 15% 7% 4% 4% 1) Factory-fabricated components include trusses, wall panels, and doors. Data based on mail-in surveys from manufacturers, which may not be entirely complete. 2) Market

  15. Partnerships For Industry - JCAP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    115.jpg Partnerships For Industry Connect With JCAP Contact Us Partnerships For Researchers Partnerships For Industry Visit JCAP Connect with JCAP Contact Us Partnerships For Researchers Partnerships For Industry Visit JCAP partnerships for industry JCAP has established an Industrial Partnership Program. For more information on Industrial Partnership Program or to learn more about other modes of industrial interactions with JCAP, please contact: California Institute of Technology Office of

  16. Tri-Party Agreement Agencies Annual Hanford Public Involvement Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Tri-Party Agreement Agencies Annual Hanford Public Involvement Survey 1. How do you usually receive information about Hanford topics? (Please select all that apply) Response Percent Response Count Advisory Board 23.7% 22 Citizens Group 32.3% 30 Ecology website 21.5% 20 Hanford.gov website 33.3% 31 Hanford Listserv (email) 54.8% 51 Hanford Mailing (postal) 12.9% 12 Newspaper 48.4% 45 Radio 26.9% 25 Social Media (Facebook, Twitter, etc.) 26.9% 25 Television 17.2% 16 Work Announcements 11.8% 11 I

  17. Carbon Emissions: Food Industry

    U.S. Energy Information Administration (EIA) Indexed Site

    Food Industry Carbon Emissions in the Food Industry The Industry at a Glance, 1994 (SIC Code: 20) Total Energy-Related Emissions: 24.4 million metric tons of carbon (MMTC) -- Pct....

  18. Chemicals Industry Vision

    SciTech Connect (OSTI)

    none,

    1996-12-01

    Chemical industry leaders articulated a long-term vision for the industry, its markets, and its technology in the groundbreaking 1996 document Technology Vision 2020 - The U.S. Chemical Industry. (PDF 310 KB).

  19. EIA Energy Efficiency-Table 3d. Value Added by Selected Industries...

    Gasoline and Diesel Fuel Update (EIA)

    d Page Last Modified: May 2010 Table 3d. Value Added1 by Selected Industries, 1998, 2002, and 2006 (Current Brillion Dollars) MECS Survey Years NAICS Subsector and Industry 1998...

  20. EIA Energy Efficiency-Table 4d. Value Added by Selected Industries...

    Gasoline and Diesel Fuel Update (EIA)

    d Page Last Modified: May 2010 Table 4d. Value Added1 by Selected Industries, 1998, 2002, and 2006 (Billion 2000 Dollars 2) MECS Survey Years NAICS Subsector and Industry 1998 2002...

  1. EIA Energy Efficiency-Table 4e. Gross Output by Selected Industries...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    e Page Last Modified: May 2010 Table 4e. Gross Output1by Selected Industries, 1998, 2002, and 2006 (Billion 2000 Dollars 2) MECS Survey Years NAICS Subsector and Industry 1998 2002...

  2. EIA Energy Efficiency-Table 3e. Gross Output by Selected Industries...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    e Page Last Modified: May 2010 Table 3e. Gross Output1 by Selected Industries, 1998, 2002, and 2006 (Current Billion Dollars) MECS Survey Years NAICS Subsector and Industry 1998...

  3. Assessment of the percent status of burning refuse-derived fuel as a fuel supplement in the cement kiln industry

    SciTech Connect (OSTI)

    1981-09-01

    The purpose of the project was to solicit information on the use of refuse-derived fuel (RDF) in cement kilns by survey, follow up the mailed survey with telephone calls to the recipients, and assemble collected information into a report. A list of companies that had some experience with RFD was compiled and is presented in Appendix A. The procedure for conducting the survey is explained. A copy of the questionnaire is presented in Appendix B. The letters of response are reproduced in Appendix C. Two completed forms were received and clear conclusions are summarized. The effort was terminated and no final report was assembled.

  4. Chemical Industry Corrosion Management

    SciTech Connect (OSTI)

    2003-02-01

    Improved Corrosion Management Could Provide Significant Cost and Energy Savings for the Chemical Industry. In the chemical industry, corrosion is often responsible for significant shutdown and maintenance costs.

  5. Industrial | Open Energy Information

    Open Energy Info (EERE)

    Trends Despite a 54-percent increase in industrial shipments, industrial energy consumption increases by only 19 percent from 2009 to 2035 in the AEO2011 Reference case....

  6. Electric Utility Industry Update

    Broader source: Energy.gov [DOE]

    Presentation—given at the April 2012 Federal Utility Partnership Working Group (FUPWG) meeting—covers significant electric industry trends and industry priorities with federal customers.

  7. LS Industrial Systems Co Ltd formerly LG Industrial Systems ...

    Open Energy Info (EERE)

    LS Industrial Systems Co Ltd formerly LG Industrial Systems Jump to: navigation, search Name: LS Industrial Systems Co Ltd (formerly LG Industrial Systems) Place: Anyang,...

  8. Manufacturing Energy Consumption Survey (MECS) - Data - U.S. Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration (EIA) 1 MECS Survey Data 2010 | 2006 | 2002 | 1998 | 1994 | 1991 | Archive Data Methodology & Forms + EXPAND ALL Consumption of Energy for All Purposes (First Use) Total Primary Consumption of Energy for All Purposes by Census Region, Industry Group, and Selected Industries, 1991: Part 1 (Estimates in Btu or Physical Units) XLS Total Primary Consumption of Energy for All Purposes by Census Region, Industry Group, and Selected Industries, 1991: Part 2 (Estimates

  9. Statistics for Industry Groups and Industries, 2003

    SciTech Connect (OSTI)

    2009-01-18

    Statistics for the U.S. Department of Commerce including types of manufacturing, employees, and products as outlined in the Annual Survey of Manufacturers (ASM).

  10. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  11. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  12. Career Map: Industrial Engineer

    Broader source: Energy.gov [DOE]

    The Wind Program's Career Map provides job description information for Industrial Engineer positions.

  13. Users from Industry

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Users from Industry Users from Industry Print The Advanced Light Source (ALS) welcomes industrial users from large and small companies whose projects advance scientific knowledge, investigate the development of new products and manufacturing methods, and/or provide economic benefits and jobs to the economy. The nature of industrial research can be different from traditional university and government sponsored projects, so the ALS has created unique opportunities for new and existing industrial

  14. 2012 NERSC User Survey Text

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2012 User Survey Text 2010/2011 User Survey Results 2009/2010 User Survey Results 2008/2009 User Survey Results 2007/2008 User Survey Results 2006 User Survey Results 2005 User Survey Results 2004 User Survey Results 2003 User Survey Results 2002 User Survey Results 2001 User Survey Results 2000 User Survey Results 1999 User Survey Results 1998 User Survey Results HPC Requirements for Science HPC Workshop Reports NERSC Staff Publications & Presentations Journal Cover Stories Galleries

  15. User-needs study for the 1992 Commercial Buildings Energy Consumption Survey. [Energy Consumption Series

    SciTech Connect (OSTI)

    Not Available

    1992-09-01

    The Commercial Buildings Energy Consumption Survey (CBECS) that is conducted by the Energy Information Administration (EIA) is the primary source of energy data for commercial buildings in the United States. The survey began in 1979 and has subsequently been conducted in 1983, 1986, and 1989. The next survey will cover energy consumption during the year 1992. The building characteristic data will be collected between August 1992 and early December 1992. Requests for energy consumption data are mailed to the energy suppliers in January 1993, with data due by March 1993. Before each survey is sent into the field, the data users' needs are thoroughly assessed. The purpose of this report is to document the findings of that user-needs assessment for the 1992 survey.

  16. User-needs study for the 1992 Commercial Buildings Energy Consumption Survey

    SciTech Connect (OSTI)

    Not Available

    1992-09-01

    The Commercial Buildings Energy Consumption Survey (CBECS) that is conducted by the Energy Information Administration (EIA) is the primary source of energy data for commercial buildings in the United States. The survey began in 1979 and has subsequently been conducted in 1983, 1986, and 1989. The next survey will cover energy consumption during the year 1992. The building characteristic data will be collected between August 1992 and early December 1992. Requests for energy consumption data are mailed to the energy suppliers in January 1993, with data due by March 1993. Before each survey is sent into the field, the data users` needs are thoroughly assessed. The purpose of this report is to document the findings of that user-needs assessment for the 1992 survey.

  17. Survey and evaluation of available thermal insulation materials for use on solar heating and cooling systems

    SciTech Connect (OSTI)

    Not Available

    1980-03-01

    This is the final report of a survey and evaluation of insulation materials for use with components of solar heating and cooling systems. The survey was performed by mailing questionnaires to manufacturers of insulation materials and by conducting an extensive literature search to obtain data on relevant properties of various types of insulation materials. The study evaluated insulation materials for active and passive solar heating and cooling systems and for multifunction applications. Primary and secondary considerations for selecting insulation materials for various components of solar heating and cooling systems are presented.

  18. Outlook optimistic for 1997 E and P industry

    SciTech Connect (OSTI)

    Popov, S.

    1997-01-01

    The ninth annual Arthur Andersen Oil and Gas Industry Outlook Survey of company executives` forecasts for the US exploration and production industry were presented last month at the 17th Annual Energy Symposium. The consulting firm surveyed the chief financial officers of more than 350 US E and P companies, with 92 companies responding, including 8 majors, 9 large and 75 small independents. Overall, top E and P company executives predict 1997 to be a healthy year for the oil and gas industry. The paper discusses demand and supply, oil and gas prices, capital spending, employment, rig counts and availability, problems and opportunities.

  19. EERE INDUSTRY DAY

    Broader source: Energy.gov [DOE]

    On September 23-24, 2015 the inaugural EERE Industry Day was held at Oak Ridge National Laboratory to foster relationships and encourage dialog among researchers, industry representatives, and U.S. Department of Energy representatives.

  20. First high-temperature electronics products survey 2005.

    SciTech Connect (OSTI)

    Normann, Randy Allen

    2006-04-01

    On April 4-5, 2005, a High-Temperature Electronics Products Workshop was held. This workshop engaged a number of governmental and private industry organizations sharing a common interest in the development of commercially available, high-temperature electronics. One of the outcomes of this meeting was an agreement to conduct an industry survey of high-temperature applications. This report covers the basic results of this survey.

  1. Industrial Carbon Management Initiative

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Small- and medium-sized manufacturers may be eligible to receive a no-cost assessment provided by DOE Industrial Assessment Centers (IACs). Teams located at 24 universities around the country conduct the energy audits to identify opportunities to improve productivity, reduce waste, and save energy. IACs typically identify more than $130,000 in potential annual savings opportunities for

  2. Industrial Green | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Energy Efficiency Basics Industrial Energy Efficiency Basics The industrial sector is vital to the U.S. economy, but at the same time consumes the most energy in the country to manufacture products we use every day. Among the most energy-intensive industries are aluminum, chemicals, forest product, glass, metal casting, mining, petroleum refining, and steel. The energy supply chain begins with electricity, steam, natural gas, coal, and other fuels supplied to a manufacturing plant

  3. Geothermal Industry Partnership Opportunities

    Broader source: Energy.gov [DOE]

    Here you'll find links to information about partnership opportunities and programs for the geothermal industry.

  4. Industrial Strength Pipes

    Energy Science and Technology Software Center (OSTI)

    2006-01-23

    Industrial Strength Pipes (ISP) is a toolkit for construction pipeline applications using the UNIX pipe and filter model.

  5. Robotic Surveying

    SciTech Connect (OSTI)

    Suzy Cantor-McKinney; Michael Kruzic

    2007-03-01

    ZAPATA ENGINEERING challenged our engineers and scientists, which included robotics expertise from Carnegie Mellon University, to design a solution to meet our client's requirements for rapid digital geophysical and radiological data collection of a munitions test range with no down-range personnel. A prime concern of the project was to minimize exposure of personnel to unexploded ordnance and radiation. The field season was limited by extreme heat, cold and snow. Geographical Information System (GIS) tools were used throughout this project to accurately define the limits of mapped areas, build a common mapping platform from various client products, track production progress, allocate resources and relate subsurface geophysical information to geographical features for use in rapidly reacquiring targets for investigation. We were hopeful that our platform could meet the proposed 35 acres per day, towing both a geophysical package and a radiological monitoring trailer. We held our breath and crossed our fingers as the autonomous Speedrower began to crawl across the playa lakebed. We met our proposed production rate, and we averaged just less than 50 acres per 12-hour day using the autonomous platform with a path tracking error of less than +/- 4 inches. Our project team mapped over 1,800 acres in an 8-week (4 days per week) timeframe. The expertise of our partner, Carnegie Mellon University, was recently demonstrated when their two autonomous vehicle entries finished second and third at the 2005 Defense Advanced Research Projects Agency (DARPA) Grand Challenge. 'The Grand Challenge program was established to help foster the development of autonomous vehicle technology that will some day help save the lives of Americans who are protecting our country on the battlefield', said DARPA Grand Challenge Program Manager, Ron Kurjanowicz. Our autonomous remote-controlled vehicle (ARCV) was a modified New Holland 2550 Speedrower retrofitted to allow the machine-actuated functions to be controlled by an onboard computer. The computer-controlled Speedrower was developed at Carnegie Mellon University to automate agricultural harvesting. Harvesting tasks require the vehicle to cover a field using minimally overlapping rows at slow speeds in a similar manner to geophysical data acquisition. The Speedrower had demonstrated its ability to perform as it had already logged hundreds of acres of autonomous harvesting. This project is the first use of autonomous robotic technology on a large-scale for geophysical surveying.

  6. Photovoltaics industry profile

    SciTech Connect (OSTI)

    1980-10-01

    A description of the status of the US photovoltaics industry is given. Principal end-user industries are identified, domestic and foreign market trends are discussed, and industry-organized and US government-organized trade promotion events are listed. Trade associations and trade journals are listed, and a photovoltaic product manufacturers list is included. (WHK)

  7. Industrial Dojo Program Fosters Industrial Internet Development...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dojo,' Contributes to Open Source to Foster Continued Development of the Industrial Internet Click to email this to a friend (Opens in new window) Share on Facebook (Opens in new...

  8. 2003 survey of Canadian radiation oncology residents

    SciTech Connect (OSTI)

    Yee, Don . E-mail: donyee@cancerboard.ab.ca; Fairchild, Alysa; Keyes, Mira; Butler, Jim; Dundas, George

    2005-06-01

    Purpose: Radiation oncology's popularity as a career in Canada has surged in the past 5 years. Consequently, resident numbers in Canadian radiation oncology residencies are at all-time highs. This study aimed to survey Canadian radiation oncology residents about their opinions of their specialty and training experiences. Methods and Materials: Residents of Canadian radiation oncology residencies that enroll trainees through the Canadian Resident Matching Service were identified from a national database. Residents were mailed an anonymous survey. Results: Eight of 101 (7.9%) potential respondents were foreign funded. Fifty-two of 101 (51.5%) residents responded. A strong record of graduating its residents was the most important factor residents considered when choosing programs. Satisfaction with their program was expressed by 92.3% of respondents, and 94.3% expressed satisfaction with their specialty. Respondents planning to practice in Canada totaled 80.8%, and 76.9% plan to have academic careers. Respondents identified job availability and receiving adequate teaching from preceptors during residency as their most important concerns. Conclusions: Though most respondents are satisfied with their programs and specialty, job availability and adequate teaching are concerns. In the future, limited time and resources and the continued popularity of radiation oncology as a career will magnify the challenge of training competent radiation oncologists in Canada.

  9. Conduct an In-Plant Pumping System Survey; Industrial Technologies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Even one pump can consume substantial energy. A continuously operated centrifugal pump driven by a fully loaded 100-horsepower motor requires 726,000 kWh per year. This costs more ...

  10. A survey of fatigue monitoring in the nuclear power industry

    SciTech Connect (OSTI)

    Ware, A.G.

    1991-12-31

    The original design of nuclear power plants addressed fatigue concerns by including calculations of projected fatigue usage for specific components; the calculations were based on estimates of the number and severity of expected transients over the 40-year design life of the plants. In some cases, the transients occurring in the plants are not as severe as was anticipated in the original design analyses, while in other cases events have occurred that were not anticipated in the design basis documents. Field failures caused by fatigue have identified some of those cases. In response, several organizations in the United States and overseas have developed fatigue monitoring programs to more accurately estimate the fatigue usage. One basic approach consists of reconstructing the fatigue usage to date based on the transients recorded in the operating history instead of those projected in the design documents. Another approach includes monitoring the plant instrumentation to determine actual values for parameters such as temperature and pressure and using the measured values in the fatigue usage calculations instead of the values projected in the design documents. The use of existing plant instrumentation to measure temperature, pressure, flow rate, etc., along with the incorporation of conservative assumptions, had generally proven adequate for estimating fatigue usage; however, in some cases additional instrumentation installed for local monitoring can provide a more accurate estimate, especially where thermal stratification is known to occur. Fatigue monitoring can aid in identifying fatigue concerns not anticipated in the original design and for reducing the excessive conservatism in some of the original design calculations so that the fatigue lives of these components can be justified as they age. Fatigue monitoring can also assist efforts to reduce ongoing fatigue usage through design modifications and operating procedure changes.

  11. A survey of fatigue monitoring in the nuclear power industry

    SciTech Connect (OSTI)

    Ware, A.G.

    1991-01-01

    The original design of nuclear power plants addressed fatigue concerns by including calculations of projected fatigue usage for specific components; the calculations were based on estimates of the number and severity of expected transients over the 40-year design life of the plants. In some cases, the transients occurring in the plants are not as severe as was anticipated in the original design analyses, while in other cases events have occurred that were not anticipated in the design basis documents. Field failures caused by fatigue have identified some of those cases. In response, several organizations in the United States and overseas have developed fatigue monitoring programs to more accurately estimate the fatigue usage. One basic approach consists of reconstructing the fatigue usage to date based on the transients recorded in the operating history instead of those projected in the design documents. Another approach includes monitoring the plant instrumentation to determine actual values for parameters such as temperature and pressure and using the measured values in the fatigue usage calculations instead of the values projected in the design documents. The use of existing plant instrumentation to measure temperature, pressure, flow rate, etc., along with the incorporation of conservative assumptions, had generally proven adequate for estimating fatigue usage; however, in some cases additional instrumentation installed for local monitoring can provide a more accurate estimate, especially where thermal stratification is known to occur. Fatigue monitoring can aid in identifying fatigue concerns not anticipated in the original design and for reducing the excessive conservatism in some of the original design calculations so that the fatigue lives of these components can be justified as they age. Fatigue monitoring can also assist efforts to reduce ongoing fatigue usage through design modifications and operating procedure changes.

  12. A National Perspective on Energy and Industry

    U.S. Energy Information Administration (EIA) Indexed Site

    Using EIA's Energy Consumption Surveys to Analyze Energy Programs and Policies Steven Nadel American Council for an Energy-Efficient Economy EIA 2008 Energy Conference, April 7-8, 2008 The American Council for an Energy Efficient Economy (ACEEE) * Non-profit (501c (3)) dedicated to advancing energy efficiency through research and dissemination. * ~25 staffers in Washington DC, Delaware, Michigan and Wisconsin * Focus on End-Use Efficiency in Industry, Buildings, Utilities, Transportation, &

  13. STEP Participant Survey Report

    Broader source: Energy.gov [DOE]

    STEP Participant Survey Report, from the Tool Kit Framework: Small Town University Energy Program (STEP).

  14. Systems and Industry Analyses

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    systems and industry analyses Go to the NETL Gasification Systems Program's Systems and Industry Analyses Studies Technology & Cost/Performance Studies NETL Gasification Systems Program's Systems and Industry Analyses Studies provide invaluable information, and help to ensure that the technologies being developed are the best ones to develop. System studies are often used to compare competing technologies, determine the best way to integrate a technology with other technologies, and predict

  15. Users from Industry

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    industrial users from large and small companies whose projects advance scientific knowledge, investigate the development of new products and manufacturing methods, andor...

  16. Presentations for Industry

    Broader source: Energy.gov [DOE]

    Learn energy-saving strategies from leading manufacturing companies and energy experts. The presentations are organized below by topic area. In addition, industrial energy managers, utilities, and...

  17. Appendix C - Industrial technologies

    SciTech Connect (OSTI)

    None, None

    2002-12-20

    This report describes the results, calculations, and assumptions underlying the GPRA 2004 Quality Metrics results for all Planning Units within the Office of Industrial Technologies.

  18. Window Industry Technology Roadmap

    SciTech Connect (OSTI)

    None, None

    2000-04-01

    The Window Industry Technology Roadmap looks at the trends in window design and installation in 2000 and projects trends for the future.

  19. About Industrial Distributed Energy

    Broader source: Energy.gov [DOE]

    The Advanced Manufacturing Office's (AMO's) Industrial Distributed Energy activities build on the success of predecessor DOE programs on distributed energy and combined heat and power (CHP) while...

  20. Commercial & Industrial Demand Response

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Skip navigation links Smart Grid Demand Response Agricultural Residential Demand Response Commercial & Industrial Demand Response Cross-sector Demand Response...

  1. Keystone coal industry manual

    SciTech Connect (OSTI)

    Not Available

    1993-01-01

    The 1994 Keystone Coal Industry Manual is presented. Keystone has served as the one industry reference authority for the many diverse organizations concerned with the supply and utilization of coal in the USA and Canada. Through the continuing efforts of coal producers, buyers, users, sellers, and equipment designers and manufacturers, the coal industry supplies an abundant and economical fuel that is indispensable in meeting the expanding energy needs of North America. The manual is divided into the following sections: coal sales companies, coal export, transportation of coal, consumer directories, coal associations and groups, consulting and financial firms, buyers guide, industry statistics and ownership, coal preparation, coal mine directory, and coal seams.

  2. Midwest Industrial Energy Efficiency Handbook

    SciTech Connect (OSTI)

    2010-06-25

    This Industrial Technologies Program handbook connects industry with the various energy efficiency resources available in the midwest.

  3. The methanol industry`s missed opportunities

    SciTech Connect (OSTI)

    Stokes, C.A.

    1995-12-31

    Throughout its history the methanol industry has been backward in research and development and in industry cooperation on public image and regulatory matters. It has been extremely reticent as to the virtue of its product for new uses, especially for motor fuel. While this is perhaps understandable looking back, it is inexcusable looking forward. The industry needs to cooperate on a worldwide basis in research and market development, on the one hand, and in image-building and political influence, on the other, staying, of course, within the US and European and other regional antitrust regulations. Unless the industry develops the motor fuel market, and especially the exciting new approach through fuel cell operated EVs, to siphon off incremental capacity and keep plants running at 90% or more of capacity, it will continue to live in a price roller-coaster climate. A few low-cost producers will do reasonably well and the rest will just get along or drop out here and there along the way, as in the past. Having come so far from such a humble beginning, it is a shame not to realize the full potential that is clearly there: a potential to nearly double sales dollars without new plants and to produce from a plentiful resource, at least for the next half-century, all the methanol that can be imagined to be needed. Beyond that the industry can turn to renewable energy--the sun--via biomass growth, to make their product. In so doing, it can perhaps apply methanol as a plant growth stimulant, in effect making the product fully self-sustainable. The world needs to know what methanol can do to provide--economically and reliably--the things upon which a better life rests.

  4. Uranium industry annual 1996

    SciTech Connect (OSTI)

    1997-04-01

    The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry`s activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs.

  5. Utility FGD Survey, January--December 1989

    SciTech Connect (OSTI)

    Hance, S.L.; McKibben, R.S.; Jones, F.M. )

    1992-03-01

    The Utility flue gas desulfurization (FGD) Survey report, which is generated by a computerized data base management system, represents a survey of operational and planned domestic utility flue gas desulfurization (FGD) systems. It summarizes information contributed by the utility industry, system and equipment suppliers, system designers, research organizations, and regulatory agencies. The data cover system design, fuel characteristics, operating history, and actual system performance. Also included is a unit-by-unit discussion of problems and solutions associated with the boilers, scrubbers, and FGD systems. The development status (operational, under construction, or in the planning stages), system supplier, process, waste disposal practice, and regulatory class are tabulated alphabetically by utility company.

  6. NEPA Litigation Surveys

    Broader source: Energy.gov [DOE]

    CEQ publishes surveys on NEPA litigation on an annual basis. These surveys identify the number of cases involving a NEPA based cause of action, Federal agencies that were identified as a lead...

  7. 2002 Manufacturing Energy Consumption Survey - User Needs Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    2002 Manufacturing Energy Consumption Survey: User-Needs Survey View current results. We need your help in designing the next Energy Consumption Survey (MECS) As our valued...

  8. AASG State Geological Survey

    Broader source: Energy.gov [DOE]

    presentation at the April 2013 peer review meeting held in Denver, Colorado.Contributions to the NGDSAASG State Geological Survey

  9. ORISE: Characterization surveys

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Characterization surveys An ORISE technicians performs a characterization survey The Oak Ridge Institute for Science and Education (ORISE) performs independent, objective characterization surveys to define the extent of radiological contamination at sites scheduled for decontamination and decommissioning (D&D). A fundamental aspect of all D&D projects, characterization surveys provide guidance to determine the best remediation procedures and are a cost-effective method of ensuring a site

  10. CASL Industry Council Meeting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 CASL Industry Council Meeting March 26-27, 2013 - Cranberry Township, PA Minutes The sixth meeting of the Industry Council (IC) for the Consortium for Advanced Simulation of Light Water Reactors (CASL) was held on March 26-27, 2013 at Westinghouse in Cranberry Township, PA. The first day of the Industry Council was chaired by John Gaertner and the second day was chaired by Heather Feldman. The meeting attendees and their affiliations are listed on Attachment 1 to these minutes. Attendance was

  11. CASL Industry Council Meeting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry Council Meeting 4 - 5 November 2015 Meeting Minutes The autumn 2015 meeting of the Industry Council (IC) for the Consortium for Advanced Simulation of Light Water Reactors (CASL) was held on 4 - 5 November 2015 at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, TN. The first day of meeting was a joint meeting of the CASL Industry and Science Councils and was held at the Spallation Neutron Source (SNS) facility at ORNL. An independent IC meeting was held the morning of the second

  12. Industrial process surveillance system

    DOE Patents [OSTI]

    Gross, K.C.; Wegerich, S.W.; Singer, R.M.; Mott, J.E.

    1998-06-09

    A system and method are disclosed for monitoring an industrial process and/or industrial data source. The system includes generating time varying data from industrial data sources, processing the data to obtain time correlation of the data, determining the range of data, determining learned states of normal operation and using these states to generate expected values, comparing the expected values to current actual values to identify a current state of the process closest to a learned, normal state; generating a set of modeled data, and processing the modeled data to identify a data pattern and generating an alarm upon detecting a deviation from normalcy. 96 figs.

  13. Industrial Process Surveillance System

    DOE Patents [OSTI]

    Gross, Kenneth C.; Wegerich, Stephan W; Singer, Ralph M.; Mott, Jack E.

    2001-01-30

    A system and method for monitoring an industrial process and/or industrial data source. The system includes generating time varying data from industrial data sources, processing the data to obtain time correlation of the data, determining the range of data, determining learned states of normal operation and using these states to generate expected values, comparing the expected values to current actual values to identify a current state of the process closest to a learned, normal state; generating a set of modeled data, and processing the modeled data to identify a data pattern and generating an alarm upon detecting a deviation from normalcy.

  14. Industrial process surveillance system

    DOE Patents [OSTI]

    Gross, Kenneth C.; Wegerich, Stephan W.; Singer, Ralph M.; Mott, Jack E.

    1998-01-01

    A system and method for monitoring an industrial process and/or industrial data source. The system includes generating time varying data from industrial data sources, processing the data to obtain time correlation of the data, determining the range of data, determining learned states of normal operation and using these states to generate expected values, comparing the expected values to current actual values to identify a current state of the process closest to a learned, normal state; generating a set of modeled data, and processing the modeled data to identify a data pattern and generating an alarm upon detecting a deviation from normalcy.

  15. Macro Industrial Working Group

    U.S. Energy Information Administration (EIA) Indexed Site

    2025 * What you'll see today - Shipments - Industrial energy use (total and excluding both refining and lease &plant fuel) * AEO2015 Reference and selected side cases * AEO2015 v. ...

  16. Presentations for Industry

    Broader source: Energy.gov [DOE]

    Industrial energy managers, utilities, and energy management professionals can find online trainings and information dissemination at no-cost. AMO has provided these energy-saving strategies from leading manufacturing companies and energy experts through several different presentation series.

  17. Caraustar Industries Energy Assessment

    SciTech Connect (OSTI)

    2010-06-25

    This plant-wide assessment case study is about commissioned energy assessments by the U.S. Department of Energy Industrial Technologies Program at two of Caraustar's recycled paperboard mills.

  18. Uranium Industry Annual, 1992

    SciTech Connect (OSTI)

    Not Available

    1993-10-28

    The Uranium Industry Annual provides current statistical data on the US uranium industry for the Congress, Federal and State agencies, the uranium and electric utility industries, and the public. The feature article, ``Decommissioning of US Conventional Uranium Production Centers,`` is included. Data on uranium raw materials activities including exploration activities and expenditures, resources and reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities including domestic uranium purchases, commitments by utilities, procurement arrangements, uranium imports under purchase contracts and exports, deliveries to enrichment suppliers, inventories, secondary market activities, utility market requirements, and uranium for sale by domestic suppliers are presented in Chapter 2.

  19. Industrial Fuel Flexibility Workshop

    SciTech Connect (OSTI)

    none,

    2006-09-01

    On September 28, 2006, in Washington, DC, ITP and Booz Allen Hamilton conducted a fuel flexibility workshop with attendance from various stakeholder groups. Workshop participants included representatives from the petrochemical, refining, food and beverage, steel and metals, pulp and paper, cement and glass manufacturing industries; as well as representatives from industrial boiler manufacturers, technology providers, energy and waste service providers, the federal government and national laboratories, and developers and financiers.

  20. Industrial Energy Efficiency

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Barriers to Industrial Energy Efficiency Report to Congress June 2015 United States Department of Energy Washington, DC 20585 Department of Energy | June 2015 Message from the Assistant Secretary The industrial sector has shown steady progress in improving energy efficiency over the past few decades and energy efficiency improvements are expected to continue. Studies suggest, however, that there is potential to accelerate the rate of adopting energy efficient technologies and practices that

  1. CASL Industry Council Members:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CASL Industry Council Members: We are looking forward to hosting you at the upcoming CASL Industry Council Meeting on Tuesday, April 12, 2016 through Wednesday, April 13, 2016 at the following location: ALOFT Greenville Downtown Converge Conference Room 5 North Laurens Street Greenville, SC 29601 864-297-6100 Meeting Contact: Lorie Fox (865) 548-5178 Lodging: ALOFT Greenville Downtown: http://www.aloftgreenvilledowntown.com/ Hotel Information * Check-in time: 4 PM * Checkout time: 12 PM * Fast

  2. Environmental Survey preliminary report

    SciTech Connect (OSTI)

    Not Available

    1988-04-01

    This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Sandia National Laboratories conducted August 17 through September 4, 1987. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with Sandia National Laboratories-Albuquerque (SNLA). The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at SNLA, and interviews with site personnel. 85 refs., 49 figs., 48 tabs.

  3. 2014 NERSC User Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Survey 2014 NERSC User Survey December 17, 2014 by Francesca Verdier Please take a few minutes to fill out NERSC's annual user survey. Your feedback is important because it allows us to judge the quality of our services, give DOE information on how we are doing, and point us to areas in which we can improve. The survey is on the web at the URL: https://www.nersc.gov/news-publications/publications-reports/user-surveys/2014/ and covers the allocation year 2014. Subscribe via RSS Subscribe

  4. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  5. Industry Cluster Development Grant winners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry Cluster Development Grant winners Community Connections: Your link to news and ... All Issues submit Industry Cluster Development Grant winners Recipients include Picuris ...

  6. Eolica Industrial | Open Energy Information

    Open Energy Info (EERE)

    Industrial Jump to: navigation, search Name: Eolica Industrial Place: Sao Paulo, Sao Paulo, Brazil Zip: 01020-901 Sector: Wind energy Product: Brazil based wind turbine steel...

  7. Guardian Industries | Open Energy Information

    Open Energy Info (EERE)

    Industries Jump to: navigation, search Name: Guardian Industries Place: Auburn Hills, MI Website: www.guardian.com References: Results of NREL Testing (Glass Magazine)1 Guardian...

  8. QER- Comment of Industrial Energy Consumer Group

    Broader source: Energy.gov [DOE]

    Thanks Tony. We'll be announcing dates for a number of other meetings in the next few days so hopefully you'll be able to participate in one of those, or have some of your member companies join. Regards, Karen Karen G. Wayland, Ph.D. Deputy Director for State, Local and Tribal Cooperation Energy Policy and Systems Analysis U.S. Department of Energy 1000 Independence Ave. SW Washington, DC 20585 Phone: +1 (202) 586-1347 Cell: +1 (240) 751-8483 From: Buxton, Anthony W. Sent: Thursday, June 12, 2014 11:44 AM To: Wayland, Karen Subject: Re: Save the Date: June 19 QER meeting on Water-Energy Nexus Thank you, Karen. Our participation in the Providence hearing was a very positive and useful experience. IECG will be unable to attend the San Francisco hearing for obvious reasons, though it is always a temptation. IECG appreciates the effort going into and the significance of the Review and will continue to observe and comment as appropriate. We have become increasingly concerned recently about whether the Federal Power Act and related statutes provide adequate authority for the federal government and related energy institutions ( NERC) to take the actions necessary to ensure the supply of energy to America on a reliable and low cost basis. The decision of the D.C. Circuit Court of Appeals invalidating FERC's Order 750 and the consequent challenges to Order 1000 on the same basis exemplify this difficulty. The states are generally without adequate powers and legal authority as well, save for several large states. The RTOs are an ongoing answer from FERC, but they also are limited by the Federal Power Act. We urge attention to this important issue. Thank you again for your New England hearings and for your excellent work. Tony Buxton Counsel to Industrial Energy Consumer Group. From: Wayland, Karen [mailto:Karen.Wayland@Hq.Doe.Gov] Sent: Thursday, June 12, 2014 11:22 AM Eastern Standard Time To: Wayland, Karen Subject: Save the Date: June 19 QER meeting on Water-Energy Nexus Thank you for your interest in the Quadrennial Energy Review (QER), and apologies for any duplicate emails. The next stakeholders meeting for the QER will focus on the Water-Energy Nexus. The meeting will be held at the San Francisco City Hall on June 19 at 9 am. Doors open at 8 am. We will be posting an agenda and background memo on the QER website over the next week at http://www.energy.gov/epsa/events/qer-public-meeting-water-energy-nexus, so check back regularly. We encourage you to attend and participate, and to share the meeting information with your lists. Please note that we are extending the comment period for stakeholders during the open mic session from 3 minutes (as described in the Federal Register notice) to 5 minutes to give stakeholders adequate time to make substantive statements. We look forward to hearing from you! Information on past meetings, including panelists' statements and summaries of discussions, as well the list of upcoming meetings, can be found at www.energy.gov/qer. Regards, Karen Wayland Karen G. Wayland, Ph.D. Deputy Director for State, Local and Tribal Cooperation Energy Policy and Systems Analysis U.S. Department of Energy 1000 Independence Ave. SW Washington, DC 20585 In accordance with Internal Revenue Service Circular 230, we hereby advise you that if this E-mail or any attachment hereto contains any tax advice, such tax advice was not intended or written to be used, and it cannot be used, by any taxpayer for the purpose of avoiding penalties that may be imposed on the taxpayer by the Internal Revenue Service. This E-Mail may contain information that is privileged, confidential and / or exempt from discovery or disclosure under applicable law. Unintended transmission shall not constitute waiver of the attorney-client or any other privilege. If you are not the intended recipient of this communication, and have received it in error, please do not distribute it and notify me immediately by E-mail at abuxton@preti.com or via telephone at 207.791.3000 and delete the original message. Unless expressly stated in this e-mail, nothing in this message or any attachment should be construed as a digital or electronic signature or as a legal opinion.

  9. Industrial demand side management: A status report

    SciTech Connect (OSTI)

    Hopkins, M.F.; Conger, R.L.; Foley, T.J.

    1995-05-01

    This report provides an overview of and rationale for industrial demand side management (DSM) programs. Benefits and barriers are described, and data from the Manufacturing Energy Consumption Survey are used to estimate potential energy savings in kilowatt hours. The report presents types and examples of programs and explores elements of successful programs. Two in-depth case studies (from Boise Cascade and Eli Lilly and Company) illustrate two types of effective DSM programs. Interviews with staff from state public utility commissions indicate the current thinking about the status and future of industrial DSM programs. A comprehensive bibliography is included, technical assistance programs are listed and described, and a methodology for evaluating potential or actual savings from projects is delineated.

  10. Emulsified industrial oils recycling

    SciTech Connect (OSTI)

    Gabris, T.

    1982-04-01

    The industrial lubricant market has been analyzed with emphasis on current and/or developing recycling and re-refining technologies. This task has been performed for the United States and other industrialized countries, specifically France, West Germany, Italy and Japan. Attention has been focused at emulsion-type fluids regardless of the industrial application involved. It was found that emulsion-type fluids in the United States represent a much higher percentage of the total fluids used than in other industrialized countries. While recycling is an active matter explored by the industry, re-refining is rather a result of other issues than the mere fact that oil can be regenerated from a used industrial emulsion. To extend the longevity of an emulsion is a logical step to keep expenses down by using the emulsion as long as possible. There is, however, another important factor influencing this issue: regulations governing the disposal of such fluids. The ecological question, the respect for nature and the natural balances, is often seen now as everybody's task. Regulations forbid dumping used emulsions in the environment without prior treatment of the water phase and separation of the oil phase. This is a costly procedure, so recycling is attractive since it postpones the problem. It is questionable whether re-refining of these emulsions - as a business - could stand on its own if these emulsions did not have to be taken apart for disposal purposes. Once the emulsion is separated into a water and an oil phase, however, re-refining of the oil does become economical.

  11. Advanced technology options for industrial heating equipment research

    SciTech Connect (OSTI)

    Jain, R.C.

    1992-10-01

    This document presents a strategy for a comprehensive program plan that is applicable to the Combustion Equipment Program of the DOE Office of Industrial Technologies (the program). The program seeks to develop improved heating equipment and advanced control techniques which, by improvements in combustion and beat transfer, will increase energy-use efficiency and productivity in industrial processes and allow the preferred use of abundant, low grade and waste domestic fuels. While the plan development strategy endeavors to be consistent with the programmatic goals and policies of the office, it is primarily governed by the needs and concerns of the US heating equipment industry. The program, by nature, focuses on energy intensive industrial processes. According to the DOE Manufacturing Energy Consumption Survey (MECS), the industrial sector in the US consumed about 21 quads of energy in 1988 in the form of coal, petroleum, natural gas and electricity. This energy was used as fuels for industrial boilers and furnaces, for agricultural uses, for construction, as feedstocks for chemicals and plastics, and for steel, mining, motors, engines and other industrial use over 75 percent of this energy was consumed to provide heat and power for manufacturing industries. The largest consumers of fuel energy were the primary metals, chemical and allied products, paper and allied products, and stone, clay and glass industry groups which accounted for about 60% of the total fuel energy consumed by the US manufacturing sector.

  12. behavioral-survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evacuation Behavior Survey for No-Notice Emergency Scenarios" Presentation at the 93rd TRB Annual Meeting at the Traveler Behavior and Values Committee (ADB10) - Behavioral Process subcommittee; January 13, 2014 Joshua Auld, Vadim Sokolov, Rene Bautista, Angela Fontes Transportation Research and Analysis Computing Center Argonne National Laboratory Biography The presentation details a survey on evacuation response behavior that was conducted as a part of the RTSTEP project. The survey was

  13. tracc-evacuation-survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Survey Announcement SURVEY: The Transportation Research and Analysis computing center is conducting a survey to help with improvement of emergency evacuation planning in Chicago TRACC researchers under a contract with the City of Chicago are developing a model which predicts a response of a transportation network to an evacuation event. Emergency responders from OEMC and other local emergency management personal are to use the model results for "intuition training" purposes and

  14. Community Leaders Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Community Leaders Survey Community Leaders Survey This survey is a tracking study commissioned by the Lab that helps measure perceived progress in maintaining community relationships and listening and responding to the needs of Northern New Mexico communities. Results help shape and direct the Lab's contributions to the region's future. Latest results show nine-in-ten of the community leaders express satisfaction with LANL's economic impact on the region. Study measures changes in leaders'

  15. Industrial Energy Efficiency Assessments | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Energy Efficiency Assessments Industrial Energy Efficiency Assessments Details about the Industrial Energy Efficiency Assessments program and its implementation in ...

  16. Clean Energy Manufacturing Initiative Industrial Efficiency and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Efficiency and Energy Productivity Video Clean Energy Manufacturing Initiative Industrial Efficiency and Energy Productivity Video Addthis Description Industrial ...

  17. Industrial Energy Efficiency Assessments | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Energy Efficiency Assessments Industrial Energy Efficiency Assessments Details about the Industrial Energy Efficiency Assessments program and its implementation in...

  18. Solar industrial process heat

    SciTech Connect (OSTI)

    Lumsdaine, E.

    1981-04-01

    The aim of the assessment reported is to candidly examine the contribution that solar industrial process heat (SIPH) is realistically able to make in the near and long-term energy futures of the United States. The performance history of government and privately funded SIPH demonstration programs, 15 of which are briefly summarized, and the present status of SIPH technology are discussed. The technical and performance characteristics of solar industrial process heat plants and equipment are reviewed, as well as evaluating how the operating experience of over a dozen SIPH demonstration projects is influencing institutional acceptance and economoc projections. Implications for domestic energy policy and international implications are briefly discussed. (LEW)

  19. 2004 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    13 | Next 2004 User Survey Results Table of Contents Response Summary Respondent Demographics Overall Satisfaction and Importance All Satisfaction, Importance and Usefulness...

  20. 2006 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to provide overall comments about NERSC: Here are the survey results: Respondent Demographics Overall Satisfaction and Importance All Satisfaction, Importance and Usefulness...

  1. 2005 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 | Next 2005 User Survey Results Table of Contents Response Summary Respondent Demographics All Satisfaction, Importance and Usefulness Ratings Hardware Resources Software...

  2. 2003 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 | Next 2003 User Survey Results Table of Contents Response Summary Respondent Demographics Overall Satisfaction and Importance All Satisfaction Topics and Changes from...

  3. Homeowner and Contractor Surveys

    Broader source: Energy.gov [DOE]

    Better Buildings Neighborhood Program Data and Evaluation Peer Exchange Call: Homeowner and Contractor Surveys, Call Slides and Discussion Summary, January 19, 2012.

  4. ORISE: Characterization surveys

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    objective characterization surveys to define the extent of radiological contamination at sites scheduled for decontamination and decommissioning (D&D). A fundamental...

  5. TPA Public Involvement Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hanford Tri-Party Agencies' Annual Public Involvement Survey Activities for Calendar Year 2008 Nolan Curtis Washington State Department of Ecology Nuclear Waste Program August 5,...

  6. PIA - Industrial Hygiene Analytical System (IHAS) | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Hygiene Analytical System (IHAS) PIA - Industrial Hygiene Analytical System (IHAS) PIA - Industrial Hygiene Analytical System (IHAS) PDF icon PIA - Industrial Hygiene ...

  7. 2011 NERSC User Survey (Read Only)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2010/2011 User Survey Results Survey Text 2009/2010 User Survey Results 2008/2009 User Survey Results 2007/2008 User Survey Results 2006 User Survey Results 2005 User Survey Results 2004 User Survey Results 2003 User Survey Results 2002 User Survey Results 2001 User Survey Results 2000 User Survey Results 1999 User Survey Results 1998 User Survey Results HPC Requirements for Science HPC Workshop Reports NERSC Staff Publications & Presentations Journal Cover Stories Galleries facebook icon

  8. UAIEE and Industrial Assessment Centers

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    55-62011| Industrial Assessment Centers * Started in 1976 * Currently 26 Centers across the US * Almost...

  9. Manufacturing Energy Consumption Survey (MECS) - Data - U.S. Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration (EIA) 4 MECS Survey Data 2010 | 2006 | 2002 | 1998 | 1994 | 1991 | Archive Data Methodology & Forms + EXPAND ALL Consumption of Energy for All Purposes (First Use) Total First Use (formerly Primary Consumption) of Energy for All Purposes by Census Region, Census Division, Industry Group, and Selected Industries, 1994: Part 1 (Estimates in Btu or Physical Units) XLS Total First Use (formerly Primary Consumption) of Energy for All Purposes by Census Region,

  10. Petroleum industry in Iran

    SciTech Connect (OSTI)

    Farideh, A.

    1981-01-01

    This study examines the oil industry in Iran from the early discovery of oil nearly two hundred years ago in Mazandaran (north part) to the development of a giant modern industry in the twentieth century. Chapter I presents a brief historical setting to introduce the reader to the importance of oil in Iran. It focuses on the economic implications of the early oil concessions in the period 1901 to 1951. Chapter II discusses the nationalization of the Iranian oil industry and creation of NIOC in 1951 and the international political and economic implication of these activities. Chapter III explains the activities of NIOC in Iran. Exploration and drilling, production, exports, refineries, natural gas, petrochemicals and internal distributions are studied. Chapter IV discusses the role of the development planning of Iran. A brief presentation of the First Development Plan through the Fifth Development Plan is given. Sources and uses of funds by plan organization during these Five Plans is studied. The Iran and Iraq War is also studied briefly, but the uncertainty of its resolution prevents any close analysis of its impact on the Iranian oil industry. One conclusion, however, is certain; oil has been a vital resource in Iran's past and it will remain the lifetime of its economic development in the future.

  11. Industry Partners Panel

    Broader source: Energy.gov [DOE]

    Industry Panel presenters include: Michael G. Andrew, Director - Academic and Technical Programs, Advanced Products and Materials, Johnson Controls Power Solutions Michael A. Fetcenko, Vice President and Managing Director, BASF Battery Materials – Ovonic, BASF Corporation Adam Kahn, Founder and CEO, AKHAN Technologies, Inc. Stephen E. Zimmer, Executive Director, United States Council for Automotive Research (USCAR)

  12. Industrial Assessment Centers Identifying Energy Savings in Water...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    West Virginia University Director: Dr. B. Gopalakrishnan (304) 293-4607, 3709 Bhaskaran.Gopalakrishnan@ mail.wvu.edu DOE Headquarters Program Manager: John Smegal ...

  13. North Carolina Geological Survey | Open Energy Information

    Open Energy Info (EERE)

    Address: 1612 Mail Service Center Place: North Carolina Zip: 27699-1612 Website: www.geology.enr.state.nc.us Coordinates: 35.67, -78.66 Show Map Loading map......

  14. Wyoming coal mining. A wage and employment survey, 1982

    SciTech Connect (OSTI)

    Not Available

    1982-04-01

    The Wyoming Department of Labor and Statistics initiated a wage and employment survey of the State's coal mining industry during the first quarter of 1982. The survey was designed to update the statistics obtained in the 1979 survey of Wyoming's coal mines. Specifically, data were collected to: (1) estimate the number of workers in selected occupational categories; (2) determine the average straight-time hourly wage in each occupational category; (3) determine the number of workers covered by a collective bargaining agreement in each occupational category; (4) review the employer contributions to employee fringe benefit programs; (5) establish bench mark data for Wyoming's underground coal mines.

  15. Wyoming coal mining: a wage and employment survey, 1984

    SciTech Connect (OSTI)

    Wessel, L.E.

    1984-05-01

    The Wyoming Department of Labor and Statistics initiated a wage and employment survey of the State's coal mining industry during the first quarter of 1984. The survey was designed to update the statistics obtained in the 1982 survey of Wyoming's coal mines. Specifically, data were collected to: (1) estimate the number of workers in selected occupational categories; (2) determine the average straight-time hourly wage in each occupational category; (3) determine the number of workers covered by a collective bargaining agreement in each occupational category; and (4) review the employer contributions to employee fringe benefit programs. 11 references, 5 figures, 6 tables.

  16. Fact #666: March 14, 2011 Survey says Electric Vehicle Prices are Key

    Broader source: Energy.gov [DOE]

    November/December 2010 surveys of 1,716 drivers and 123 automobile industry executives indicate that both groups believe a low electric vehicle price would motivate consumers to switch from a...

  17. Coal industry annual 1993

    SciTech Connect (OSTI)

    Not Available

    1994-12-06

    Coal Industry Annual 1993 replaces the publication Coal Production (DOE/FIA-0125). This report presents additional tables and expanded versions of tables previously presented in Coal Production, including production, number of mines, Productivity, employment, productive capacity, and recoverable reserves. This report also presents data on coal consumption, coal distribution, coal stocks, coal prices, coal quality, and emissions for a wide audience including the Congress, Federal and State agencies, the coal industry, and the general public. In addition, Appendix A contains a compilation of coal statistics for the major coal-producing States. This report does not include coal consumption data for nonutility Power Producers who are not in the manufacturing, agriculture, mining, construction, or commercial sectors. This consumption is estimated to be 5 million short tons in 1993.

  18. Energy conservation in the primary aluminum and chlor-alkali industries

    SciTech Connect (OSTI)

    Not Available

    1980-10-01

    The primary aluminum and chlor-alkali industries together use nearly 13% of the electrical energy consumed by US industry. As part of its mission to promote energy conservation in basic US industries, the DOE surveys the present technological status of the major electrochemical industries and evaluates promising technological innovations that may lead to reduced energy requirements. This study provides technical and economic analyses in support of a government program of research and development in advanced electrolytic technology. This program is intended to supplement the development efforts directed toward energy savings by private industry. Sections II and III of this report cover aluminum and chlorine production processes only, since these two industries represent over 90% of the electrical energy requirements of all electrolytic industries in the United States. Section IV examines barriers to accelerated research and development by the electrolytic industries, and makes suggestions for government actions to overcome these barriers.

  19. Industrial Analytics Corporation

    SciTech Connect (OSTI)

    Industrial Analytics Corporation

    2004-01-30

    The lost foam casting process is sensitive to the properties of the EPS patterns used for the casting operation. In this project Industrial Analytics Corporation (IAC) has developed a new low voltage x-ray instrument for x-ray radiography of very low mass EPS patterns. IAC has also developed a transmitted visible light method for characterizing the properties of EPS patterns. The systems developed are also applicable to other low density materials including graphite foams.

  20. wave energy industry research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    industry research - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  1. Automotive Turbocharging: Industrial Requirements and Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Turbocharging: Industrial Requirements and Technology Developments Automotive Turbocharging: Industrial Requirements and Technology Developments Significant improvements in ...

  2. Survey of neutron radiography facilities

    SciTech Connect (OSTI)

    Imel, G.R.; McClellan, G.G.

    1996-08-01

    A directory of neutron radiography facilities around the world was informally compiled about ten years ago under the auspices of the American Society for Testing and Materials (ASTM), Subcommittee E7.05 (Radiology, Neutron). The work lay dormant for a number of years, but was revived in earnest in the fall of 1995. At that time, letters were mailed to all the facilities with available addresses in the original directory, requesting updated information. Additionally, information was gathered at the Second Topical meeting on neutron Radiography Facility System Design and Beam Characterization (November, 1995, Shonan Village, Japan). A second mailing was sent for final confirmation and updates in January, 1996. About 75% of the information in the directory has now been confirmed by the facility management. This paper presents a summary of the information contained in the facility directory. An electronic version of the directory in Wordperfect 6.1, uuencode, or rtf format is available by sending e-mail to the authors at imel{at}anl.gov or imel{at}baobab.cad.cea.fr. A WWW site for the directory is presently under construction.

  3. Industrial Dojo Program Fosters Industrial Internet Development | GE Global

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Launches Cloud Foundry 'Industrial Dojo,' Contributes to Open Source to Foster Continued Development of the Industrial Internet Click to email this to a friend (Opens in new window) Share on Facebook (Opens in new window) Click to share (Opens in new window) Click to share on LinkedIn (Opens in new window) Click to share on Tumblr (Opens in new window) GE Launches Cloud Foundry 'Industrial Dojo,' Contributes to Open Source to Foster Continued Development of the Industrial Internet

  4. Dark Energy Survey

    ScienceCinema (OSTI)

    Roodman, Aaron; Nord, Brian; Elliot, Ann

    2014-08-12

    Members of the Dark Energy Survey collaboration explain what they hope to learn by studying the southern sky with the world's most advanced digital camera, mounted on a telescope in Chile.

  5. 2000 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    "NERSC has been the most stable supercomputer center in the country particularly with the migration from the T3E to the IBM SP". "Makes supercomputing easy." Below are the survey...

  6. Dark Energy Survey

    SciTech Connect (OSTI)

    Roodman, Aaron; Nord, Brian; Elliot, Ann

    2012-12-06

    Members of the Dark Energy Survey collaboration explain what they hope to learn by studying the southern sky with the world's most advanced digital camera, mounted on a telescope in Chile.

  7. Benchmarking survey for recycling.

    SciTech Connect (OSTI)

    Marley, Margie Charlotte; Mizner, Jack Harry

    2005-06-01

    This report describes the methodology, analysis and conclusions of a comparison survey of recycling programs at ten Department of Energy sites including Sandia National Laboratories/New Mexico (SNL/NM). The goal of the survey was to compare SNL/NM's recycling performance with that of other federal facilities, and to identify activities and programs that could be implemented at SNL/NM to improve recycling performance.

  8. Industrial Process Heating - Technology Assessment

    Energy Savers [EERE]

    Industrial Process Heating - Technology Assessment 1 2 Contents 3 4 1. Introduction to the Technology/System ............................................................................................... 2 5 1.1. Industrial Process Heating Overview ............................................................................................ 2 6 2. Technology Assessment and Potential ................................................................................................. 6 7 2.1. Status

  9. Forest Products Industry Technology Roadmap

    SciTech Connect (OSTI)

    none,

    2010-04-01

    This document describes the forest products industry's research and development priorities. The original technology roadmap published by the industry in 1999 and was most recently updated in April 2010.

  10. Reid Industries | Open Energy Information

    Open Energy Info (EERE)

    Reid Industries Jump to: navigation, search Name: Reid Industries Address: PO Box 503 Place: San Francisco, CA Zip: 94104 Phone Number: 415-947-1050 Coordinates: 37.7923058,...

  11. 2014 ALCF User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    survey, improved questions, and a representative user response to the survey. Demographics ALCF users are located around the world and are representative across different...

  12. Enviromech Industries | Open Energy Information

    Open Energy Info (EERE)

    search Name: Enviromech Industries Place: Thousands Palms, California Zip: 92276 Product: Alternative fuel system design and integration company. References: Enviromech...

  13. CEMI Industrial Efficiency (text version)

    Broader source: Energy.gov [DOE]

    Below is the text version for the Clean Energy Manufacturing Initiative Industrial Efficiency and Energy Productivity Video.  

  14. Recent developments: Industry briefs

    SciTech Connect (OSTI)

    1990-04-01

    Recent nuclear industry briefs are presented. These briefs include: Soviet Union to build Iran nuclear plant; Dension announces cuts in Elliot Lake production; Soviet environmental study delays Rostov startup; Cogema closes two mines; Namibian sanctions lifted by USA and Canada; US Energy and Kennecott restructors joint venture; Australians reelect Hawke; China to buy Soviet nuclear plant; Olympic Dam`s first sale of concentrates to USA; Uranevz buys one-third of Cogema`s Rabbit Lake operations; East and West Germany forming joint nuclear law; and Nova Scotia extends uranium exploration plan.

  15. Coal Industry Annual 1995

    SciTech Connect (OSTI)

    1996-10-01

    This report presents data on coal consumption, coal distribution, coal stocks, coal prices, coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States. This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 21 million short tons for 1995.

  16. Coal industry annual 1996

    SciTech Connect (OSTI)

    1997-11-01

    This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States.This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 24 million short tons for 1996. 14 figs., 145 tabs.

  17. NEPA Litigation Surveys | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NEPA Litigation Surveys NEPA Litigation Surveys CEQ publishes surveys on NEPA litigation on an annual basis. These surveys identify the number of cases involving a NEPA based cause...

  18. Utility FGD survey, January--December 1988

    SciTech Connect (OSTI)

    Hance, S.L.; McKibben, R.S.; Jones, F.M. )

    1991-09-01

    The Utility FGD Survey report, which is generated by a computerized data base management system, represents a survey of operational and planned domestic utility flue gas desulfurization (FGD) systems. It summarizes information contributed by the utility industry, system and equipment suppliers, system designers, research organizations, and regulatory agencies. The data cover system design, fuel characteristics, operating history, and actual system performance. Also included is a unit-by-unit discussion of problems and solutions associated with the boilers, scrubbers, and FGD systems. The development status (operational, under construction, or in the planning stages), system supplier, process, waste disposal practice, and regulatory class are tabulated alphabetically by utility company. Simplified process flow diagrams of FGD systems, definitions, and a glossary of terms are attached to the report. Current data for domestic FGD systems show systems in operation, systems under construction, and systems planned. The current total FGD-controlled capacity in the United States is 67,091 MW.

  19. User Survey | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Survey User Survey Results The ALCF conducts yearly surveys to gain a better understanding of how we can improve the user experience at ALCF. Below are the numeric results of these surveys. 2014 ALCF User Survey Results 2013 ALCF User Survey Results 2012 ALCF User Survey Results 2011 ALCF User Survey Results 2010 ALCF User Survey Results 2009 ALCF User Survey Results 2008 ALCF User Survey Results

  20. 2001 FEMP Customer Survey Appendices

    SciTech Connect (OSTI)

    None

    2009-01-18

    Appendix A: Survey Instrument; Appendix B: Detailed Responses; Appendix C: Adoption and Diffusion of Innovations

  1. STEP Participant Survey Executive Summary

    Broader source: Energy.gov [DOE]

    STEP Participant Survey Executive Summary, from the Tool Kit Framework: Small Town University Energy Program (STEP).

  2. Local Option- Industrial Facilities and Development Bonds

    Broader source: Energy.gov [DOE]

    Under the Utah Industrial Facilities and Development Act, counties, municipalities, and state universities in Utah may issue Industrial Revenue Bonds (IRBs) or Industrial Development Bonds (IDBs)...

  3. Energy Intensity Indicators: Industrial Source Energy Consumption

    Broader source: Energy.gov [DOE]

    The industrial sector comprises manufacturing and other nonmanufacturing industries not included in transportation or services. Manufacturing includes 18 industry sectors, generally defined at the...

  4. Industrial Energy Efficiency: Designing Effective State Programs...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency: Designing Effective State Programs for the Industrial Sector Industrial Energy Efficiency: Designing Effective State Programs for the Industrial Sector This ...

  5. MRL Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    MRL Industries Inc Jump to: navigation, search Name: MRL Industries Inc Place: Sonora, California Zip: 95370 Sector: Solar Product: MRL Industries is a US company committed to...

  6. Industrial Assessment Centers Update, March 2015 | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Read the Industrial Assessment Centers (IAC) Update -- March 2015 Industrial Assessment Centers Quarterly Update, March 2015 More Documents & Publications Industrial Assessment...

  7. Assessment of Replicable Innovative Industrial Cogeneration Applicatio...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Replicable Innovative Industrial Cogeneration Applications, June 2001 Assessment of Replicable Innovative Industrial Cogeneration Applications, June 2001 U.S. industrial facilities ...

  8. Ternion Bio Industries | Open Energy Information

    Open Energy Info (EERE)

    Ternion Bio Industries Jump to: navigation, search Logo: Ternion Bio Industries Name: Ternion Bio Industries Address: 1060 Minnesota Ave., Suite 6 Place: San Jose, California Zip:...

  9. Industrial Assessment Centers (IACs) | Department of Energy

    Office of Environmental Management (EM)

    Technical Assistance Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Small- and medium-sized manufacturers may be...

  10. Lien Hwa Industrial Corporation | Open Energy Information

    Open Energy Info (EERE)

    Lien Hwa Industrial Corporation Jump to: navigation, search Name: Lien Hwa Industrial Corporation Place: Taipei, Taiwan Product: Lien Hwa Industrial Corporation is an agricultural,...

  11. Equity Industrial Partners | Open Energy Information

    Open Energy Info (EERE)

    Equity Industrial Partners Jump to: navigation, search Name Equity Industrial Partners Facility Equity Industrial Partners Sector Wind energy Facility Type Community Wind Facility...

  12. TG Agro Industrial | Open Energy Information

    Open Energy Info (EERE)

    TG Agro Industrial Jump to: navigation, search Name: TG Agro Industrial Place: Brazil Product: Maranhao-based ethanol producer. References: TG Agro Industrial1 This article is a...

  13. Biofuel Industries Group LLC | Open Energy Information

    Open Energy Info (EERE)

    Industries Group LLC Jump to: navigation, search Name: Biofuel Industries Group LLC Place: Adrian, Michigan Zip: 49221 Product: Biofuel Industries Group, LLC owns and operates the...

  14. Meehan s Industrial | Open Energy Information

    Open Energy Info (EERE)

    Meehan s Industrial Jump to: navigation, search Name: Meehan's Industrial Place: Milton, Ontario, Canada Zip: L9T 5C1 Product: Meehan's Industrial is a manufacturer, project...

  15. Advanced Biofuels Industry Roundtable - List of Participants...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Industry Roundtable - List of Participants Advanced Biofuels Industry Roundtable - List of Participants List of Participants from the May 18 Advanced Biofuels Industry ...

  16. Analysis of the Efficiency of the U.S. Ethanol Industry 2007 | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Analysis of the Efficiency of the U.S. Ethanol Industry 2007 Analysis of the Efficiency of the U.S. Ethanol Industry 2007 The survey covers plant operations in corn dry mills, wet mills,plant type, ownership structure, capacity, feedstocks, production volumes, coproducts, PDF icon anl_ethanol_analysis_2007.pdf More Documents & Publications Current State of the U.S. Ethanol Industry Contribution of the Ethanol Industry to the Economy of the United States EA-1628: Final

  17. Federal laboratory nondestructive testing research and development applicable to industry

    SciTech Connect (OSTI)

    Smith, S.A.; Moore, N.L.

    1987-02-01

    This document presents the results of a survey of nondestructive testing (NDT) and related sensor technology research and development (R and D) at selected federal laboratories. Objective was to identify and characterize NDT activities that could be applied to improving energy efficiency and overall productivity in US manufacturing. Numerous federally supported R and D programs were identified in areas such as acoustic emissions, eddy current, radiography, computer tomography and ultrasonics. A Preliminary Findings Report was sent to industry representatives, which generated considerable interest.

  18. Macro-Industrial Working Group Meeting 2: Industrial updates...

    U.S. Energy Information Administration (EIA) Indexed Site

    Industrial Team, MIWG 2, February 18, 2016 2 Technology ... & pump standards - Clean Power Plan: Part of AEO2016 ... Energy Consumption by Fuel Coal Natural Gas Purchased ...

  19. Chemical production from industrial by-product gases: Final report

    SciTech Connect (OSTI)

    Lyke, S.E.; Moore, R.H.

    1981-04-01

    The potential for conservation of natural gas is studied and the technical and economic feasibility and the implementation of ventures to produce such chemicals using carbon monoxide and hydrogen from byproduct gases are determined. A survey was performed of potential chemical products and byproduct gas sources. Byproduct gases from the elemental phosphorus and the iron and steel industries were selected for detailed study. Gas sampling, preliminary design, market surveys, and economic analyses were performed for specific sources in the selected industries. The study showed that production of methanol or ammonia from byproduct gas at the sites studied in the elemental phosphorus and the iron and steel industries is technically feasible but not economically viable under current conditions. Several other applications are identified as having the potential for better economics. The survey performed identified a need for an improved method of recovering carbon monoxide from dilute gases. A modest experimental program was directed toward the development of a permselective membrane to fulfill that need. A practical membrane was not developed but further investigation along the same lines is recommended. (MCW)

  20. Solar Site Survey Toolkit

    Broader source: Energy.gov [DOE]

    After a couple outings, a principal technologist at Sandia National Laboratories saw a need for a travel kit that would have the necessary tools to make the task of site surveys more manageable and safer. They have had great success using the kit in the field already.

  1. Industrial Hygiene | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hygiene Ames Laboratory's Industrial Hygiene (IH) Program is dedicated to providing employees a workplace free from or protected against recognized hazards that could potentially cause illness or injury. The basic principles of industrial hygiene are applied: Anticipation, recognition, evaluation and control of workplace hazards. The industrial hygienist participates on Readiness Review committees to assist in anticipation and recognition of chemical, physical, biological, or ergonomic hazards.

  2. Industrial Geospatial Analysis Tool for Energy Evaluation (IGATE-E)

    SciTech Connect (OSTI)

    Alkadi, Nasr E; Starke, Michael R; Ma, Ookie; Nimbalkar, Sachin U; Cox, Daryl

    2013-01-01

    IGATE-E is an energy analysis tool for industrial energy evaluation. The tool applies statistical modeling to multiple publicly available datasets and provides information at the geospatial resolution of zip code using bottom up approaches. Within each zip code, the current version of the tool estimates electrical energy consumption of manufacturing industries based on each type of industries using DOE s Industrial Assessment Center database (IAC-DB) and DOE s Energy Information Administration Manufacturing Energy Consumption Survey database (EIA-MECS DB), in addition to other commercially available databases such as the Manufacturing News database (MNI, Inc.). Ongoing and future work include adding modules for the predictions of fuel energy consumption streams, manufacturing process steps energy consumption, major energy intensive processes (EIPs) within each industry type among other metrics of interest. The tool provides validation against DOE s EIA-MECS state level energy estimations and permits several statistical examinations. IGATE-E is intended to be a decision support and planning tool to a wide spectrum of energy analysts, researchers, government organizations, private consultants, industry partners, and alike.

  3. Greenline Industries | Open Energy Information

    Open Energy Info (EERE)

    Industries Place: San Rafael, California Zip: 94901 Product: Small to medium scale biodiesel plants designer and producer. They also run a biodiesel plant in Vallejo,...

  4. Collaborating with Industry for Innovation

    SciTech Connect (OSTI)

    2004-03-01

    This is a brochure describing Laboratory Coordinating Council's network of labs and facilities to promote partnership between industry and national laboratories.

  5. Jax Industries | Open Energy Information

    Open Energy Info (EERE)

    Jax Industries Place: Hillsboro, Oregon Product: Developer of recharge systems for CZ process silicon ingot growers, some of which produce PV silicon feedstock. Coordinates:...

  6. DMI Industries | Open Energy Information

    Open Energy Info (EERE)

    (NASDAQ: OTTR), is a diversified heavy steel manufacturer with a primary concentration on wind tower fabrication. References: DMI Industries1 This article is a stub....

  7. Industrial Feedstock Flexibility Workshop Results

    SciTech Connect (OSTI)

    Ozokwelu, Dickson; Margolis, Nancy; Justiniano, Mauricio; Monfort, Joe; Brueske, Sabine; Sabouni, Ridah

    2009-08-01

    This report (PDF 649 KB) summarizes the results of the 2009 Industrial Feedstock Flexibility Workshop, which took place in Atlanta, GA on August 19-20, 2009.

  8. Commercial & Industrial Renewable Energy Grants

    Broader source: Energy.gov [DOE]

    The New Hampshire Public Utilities Commission (PUC) offers grant funding for renewable energy projects installed at commercial, industrial, public, non-profit, municipal or school facilities, or ...

  9. Industrial energy management and utilization

    SciTech Connect (OSTI)

    Witte, L.C.; Schmidt, P.S.; Brown, D.

    1986-01-01

    This text covers the principles of industrial energy conservation and energy conservation applications, with emphasis on the energy-intensive industries. Topics covered include energy consumption, alternative energy sources, elements of energy audits, economic investment analysis, management of energy conservation programs, boilers and fired heaters, steam and condensate systems, classification and fouling of heat exchangers, heat transfer augmentation, waste heat sources, heat recovery equipment, properties and characteristics of insulation, energy conservation in industrial buildings, cogeneration, power circuit components and energy conversion devices, electrical energy conservation. A review of the fundamentals of fluid mechanics, heat transfer, and thermodynamics, as well as examples, problems, and case studies from specific industries are included.

  10. Industry Interactive Procurement System (IIPS)

    Broader source: Energy.gov [DOE]

    Presentation on DOE’s Industry Interactive Procurement System (IIPS) presented at the PEM fuel cell pre-solicitation meeting held May 26, 2005 in Arlington, VA.

  11. Guiding Principles for Successfully Implementing Industrial Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDUSTRIAL TECHNOLOGIES PROGRAM Guiding Principles for Successfully Implementing Industrial Energy Assessment Recommendations April 2011 (DRAFT) Acknowledgement Guiding Principles ...

  12. INDUSTRIAL SCALE DEMONSTRATION OF SMART MANUFACTURING ACHIEVING...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDUSTRIAL SCALE DEMONSTRATION OF SMART MANUFACTURING ACHIEVING TRANSFORMATIONAL ENERGY PRODUCTIVITY GAINS INDUSTRIAL SCALE DEMONSTRATION OF SMART MANUFACTURING ACHIEVING ...

  13. Guiding Principles for Successfully Implementing Industrial Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guiding Principles for Successfully Implementing Industrial Energy Assessment Recommendations Guiding Principles for Successfully Implementing Industrial Energy Assessment ...

  14. Midstate Electric Cooperative - Commercial and Industrial Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial and Industrial Energy Efficiency Rebate Program Midstate Electric Cooperative - Commercial and Industrial Energy Efficiency Rebate Program < Back Eligibility Commercial...

  15. Southeast Electronic Book of Industrial Resources

    SciTech Connect (OSTI)

    2010-06-25

    This Industrial Technologies Program handbook connects industry with the various energy efficiency resources available in the midwest.

  16. China National Machinery Industry Complete Engineering Corporation...

    Open Energy Info (EERE)

    Industry Complete Engineering Corporation CMCEC Jump to: navigation, search Name: China National Machinery Industry Complete Engineering Corporation (CMCEC) Place: Beijing,...

  17. Kerala Industrial Infrastructure Development Corporation Kinfra...

    Open Energy Info (EERE)

    Kerala Industrial Infrastructure Development Corporation Kinfra Jump to: navigation, search Name: Kerala Industrial Infrastructure Development Corporation (Kinfra) Place:...

  18. Funding Opportunity Webinar - Building America Industry Partnerships...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Webinar - Building America Industry Partnerships for High Performance Housing Innovations (Text Version) Funding Opportunity Webinar - Building America Industry Partnerships for ...

  19. ITP Industrial Materials: Development and Commercialization of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ITP Industrial Materials: Development and Commercialization of Alternative Carbon Fiber Precursors and Conversion Technologies ITP Industrial Materials: Development and...

  20. Advanced Manufacturing Office (Formerly Industrial Technologies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Manufacturing Office (Formerly Industrial Technologies Program) Advanced Manufacturing Office (Formerly Industrial Technologies Program) Presented at the NREL Hydrogen and Fuel ...

  1. Industries & Technologies | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources » Industries & Technologies Industries & Technologies The Advanced Manufacturing Office (AMO) emphasizes innovative technologies to increase manufacturing agility and open new markets. AMO also maintains a range of projects, analyses, protocols, and strategies to reduce industrial energy intensity and carbon emissions in specific industries and technology areas: Industries Aluminum Chemicals Forest Products Glass Metal Casting Mining Other Industries Petroleum

  2. AVLIS industrial access program

    SciTech Connect (OSTI)

    Not Available

    1984-11-15

    This document deals with the procurements planned for the construction of an Atomic Vapor Laser Isotope Separation (AVLIS) production plant. Several large-scale AVLIS facilities have already been built and tested; a full-scale engineering demonstration facility is currently under construction. The experience gained from these projects provides the procurement basis for the production plant construction and operation. In this document, the status of the AVLIS process procurement is presented from two viewpoints. The AVLIS Production Plant Work Breakdown Structure is referenced at the level of the items to be procured. The availability of suppliers for the items at this level is discussed. In addition, the work that will result from the AVLIS enrichment plant project is broken down by general procurement categories (construction, mechanical equipment, etc.) and the current AVLIS suppliers are listed according to these categories. A large number of companies in all categories are currently providing AVLIS equipment for the Full-Scale Demonstration Facility in Livermore, California. These companies form an existing and expanding supplier network for the AVLIS program. Finally, this document examines the relationship between the AVLIS construction project/operational facility and established commercial suppliers. The goal is to utilize existing industrial capability to meet the needs of the project in a competitive procurement situation. As a result, costs and procurement risks are both reduced because the products provided come from within the AVLIS suppliers' experience base. At the same time, suppliers can benefit by the potential to participate in AVLIS technology spin-off markets. 35 figures.

  3. Industrial Technologies - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Technologies » Technology Marketing Summaries Site Map Printable Version Share this resource About Search Categories (15) Advanced Materials Biomass and Biofuels Building Energy Efficiency Electricity Transmission Energy Analysis Energy Storage Geothermal Hydrogen and Fuel Cell Hydropower, Wave and Tidal Industrial Technologies Marketing Summaries (355) Solar Photovoltaic Solar Thermal Startup America Vehicles and Fuels Wind Energy Partners (27) Visual Patent Search Success Stories

  4. Industrial energy management and utilization

    SciTech Connect (OSTI)

    Witte, L.C.; Schmidt, P.S.; Brown, D.R.

    1988-01-01

    This book presents a study of the technical, economic and management principles of effective energy use. The authors report on: energy consumption, conservation, and resources. They present an analysis of thermal-fluid systems. Energy conservation in combustion systems. Heat exchangers, heat recovery, energy conservation in industrial buildings, and industrial cogeneration are discussed.

  5. ARM User Survey Report

    SciTech Connect (OSTI)

    Roeder, LR

    2010-06-22

    The objective of this survey was to obtain user feedback to, among other things, determine how to organize the exponentially growing data within the Atmospheric Radiation Measurement (ARM) Climate Research Facility, and identify users’ preferred data analysis system. The survey findings appear to have met this objective, having received approximately 300 responses that give insight into the type of work users perform, usage of the data, percentage of data analysis users might perform on an ARM-hosted computing resource, downloading volume level where users begin having reservations, opinion about usage if given more powerful computing resources (including ability to manipulate data), types of tools that would be most beneficial to them, preferred programming language and data analysis system, level of importance for certain types of capabilities, and finally, level of interest in participating in a code-sharing community.

  6. Sloan digital sky survey

    SciTech Connect (OSTI)

    Kent, S.M.; Stoughton, C.; Newberg, H.; Loveday, J.; Petravick, D.; Gurbani, V.; Berman, E.; Sergey, G.; Lupton, R.

    1994-04-01

    The Sloan Digital Sky Survey will produce a detailed digital photometric map of half the northern sky to about 23 magnitude using a special purpose wide field 2.5 meter telescope. From this map we will select {approximately} 10{sup 6} galaxies and 10{sup 5} quasars, and obtain high resolution spectra using the same telescope. The imaging catalog will contain 10{sup 8} galaxies, a similar number of stars, and 10{sup 6} quasar candidates.

  7. Manufacturing Energy Consumption Survey (MECS) - Data - U.S. Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration (EIA) 2 MECS Survey Data 2010 | 2006 | 2002 | 1998 | 1994 | 1991 | Archive Data Methodology & Forms all tables + EXPAND ALL Consumption of Energy for All Purposes (First Use) Values RSE Table 1.1 By Mfg. Industry & Region (physical units) XLS PDF XLS Table 1.2 By Mfg. Industry & Region (trillion Btu) XLS PDF XLS Table 1.3 By Value of Shipments & Employment Size Category & Region XLS PDF Table 1.4 Number of Establishments Using Energy Consumed

  8. Manufacturing Energy Consumption Survey (MECS) - Data - U.S. Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration (EIA) 10 MECS Survey Data 2010 | 2006 | 2002 | 1998 | 1994 | 1991 | Archive Data Methodology & Forms + EXPAND ALL Consumption of Energy for All Purposes (First Use) Table 1.1 By Mfg. Industry & Region (physical units) XLS PDF Table 1.2 By Mfg. Industry & Region (trillion Btu) XLS PDF Table 1.3 By Value of Shipments & Employment Size Category & Region XLS PDF Table 1.4 Number of Establishments Using Energy Consumed for All Purpose XLS PDF Table

  9. 2013 Survey of Non-Starch Ethanol and Renewable Hydrocarbon Biofuels Producers

    SciTech Connect (OSTI)

    Schwab, A.; Geiger, J.; Lewis, J.

    2015-01-01

    In order to understand the status of the industry for non-starch ethanol and renewable hydrocarbon biofuels as of the end of calendar year 2013, the National Renewable Energy Laboratory (NREL) conducted the first of what is anticipated to be an annual survey of U.S. non-starch ethanol and renewable hydrocarbon biofuels producers. This report presents the results of this initial survey and describes the survey methodology. Subsequent surveys will report on the progress over time of the development of these facilities and companies.

  10. Public perceptions of industrial risks: the context of public attitudes toward radioactive waste

    SciTech Connect (OSTI)

    Earle, T.C.

    1981-06-01

    A survey was made to determine the public risk perception of several industrial hazards. A free response approach was used in order for respondents to generate their own alternatives. The general class of hazard investigated here included all hazardous industrial facilities. The free response survey was used to study public perception of: (a) the closeness of the nearest hazardous industrial facility (as estimated by the respondent); (b) the sort of facility it is; (c) the sorts of risk associated with it; and (d) the persons placed at risk by it. Respondents also identified the risks of, and the persons placed at risk by, both a toxic chemical disposal facility and a nuclear waste disposal facility. Results of this study thus can inform us of the unprompted concerns of the public regarding a wide variety of industrial facilities.

  11. Analysis of the Efficiency of the U.S. Ethanol Industry 2007

    SciTech Connect (OSTI)

    Wu, May

    2008-03-27

    In 2007, the Renewable Fuels Association (RFA) conducted a survey of US ethanol production plants to provide an assessment of the current US ethanol industry. The survey covers plant operations in both corn dry mills and wet mills. In particular, it includes plant type, ownership structure, capacity, feedstocks, production volumes, coproducts, process fuel and electricity usage, water consumption, and products transportation and distribution. This report includes a summary and analysis of these results.

  12. Chinese Geological Survey | Open Energy Information

    Open Energy Info (EERE)

    Chinese Geological Survey Jump to: navigation, search Name: Chinese Geological Survey Place: China Sector: Geothermal energy Product: Chinese body which is involved in surveys of...

  13. Commercial Grade Dedication Survey and Training | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Survey and Training Commercial Grade Dedication Survey and Training The following is a sample plan to perform a CGD survey. The checklist items are included. In addition to,...

  14. Design Code Survey Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Design Code Survey Form Design Code Survey Form Survey of Safety Software Used in Design of Structures, Systems, and Components 1. Introduction The Department's Implementation Plan ...

  15. Mining Industry Energy Bandwidth Study

    SciTech Connect (OSTI)

    none,

    2007-07-01

    The Industrial Technologies Program (ITP) relies on analytical studies to identify large energy reduction opportunities in energy-intensive industries and uses these results to guide its R&D portfolio. The energy bandwidth illustrates the total energy-saving opportunity that exists in the industry if the current processes are improved by implementing more energy-efficient practices and by using advanced technologies. This bandwidth analysis report was conducted to assist the ITP Mining R&D program in identifying energy-saving opportunities in coal, metals, and mineral mining. These opportunities were analyzed in key mining processes of blasting, dewatering, drilling, digging, ventilation, materials handling, crushing, grinding, and separations.

  16. ORNL-5680 Radiological Surveys

    Office of Legacy Management (LM)

    DOVEV-0005/l (Supplement) ORNL-5680 Radiological Surveys of Properties in the Middlesex, New Jersey, Area R. W. Leggett D. L. Anderson F. F. Haywood D. J. Christian W. D. Cottrell R. W. Doane D. J. Crawford W. H. Shinpaugh E. B. Wagner T. E. Myrick W. A. Goldsmith Printed in the United States of America. Available from National Technical Information Service U.S. Department of Commerce 5285 Port Royal Road, Springfield, Virginia 22161 NTIS price codes-Printed Copy: A07 Microfiche ,401 I I This

  17. Industrial Demand Module - NEMS Documentation

    Reports and Publications (EIA)

    2014-01-01

    Documents the objectives, analytical approach, and development of the National Energy Modeling System (NEMS) Industrial Demand Module. The report catalogues and describes model assumptions, computational methodology, parameter estimation techniques, and model source code.

  18. Industrial Hygienist/Health Physicist

    Broader source: Energy.gov [DOE]

    A successful candidate in this position wil l serve as an Industrial Hygienist/Health Physicist in the Operations and Oversight Division, providing technical oversight of the Oak Ridge National...

  19. 2014 Total Electric Industry- Customers

    U.S. Energy Information Administration (EIA) Indexed Site

    Customers (Data from forms EIA-861- schedules 4A, 4B, 4D, EIA-861S and EIA-861U) State Residential Commercial Industrial Transportation Total New England 6,243,013 862,269 28,017 8 ...

  20. "2014 Total Electric Industry- Customers"

    U.S. Energy Information Administration (EIA) Indexed Site

    Customers" "(Data from forms EIA-861- schedules 4A, 4B, 4D, EIA-861S and EIA-861U)" "State","Residential","Commercial","Industrial","Transportation","Total" "New England",6243013,8...

  1. United States Electricity Industry Primer

    Broader source: Energy.gov [DOE]

    The United States Electricity Industry Primer provides a high-level overview of the U.S. electricity supply chain, including generation, transmission, and distribution; markets and ownership structures, including utilities and regulatory agencies; and system reliability and vulnerabilities.

  2. Industrial Process Heating - Technology Assessment

    Energy Savers [EERE]

    ... energy used 75 in lower temperature industrial process ... F. and where there is availability of low cost 77 fuel or by ... products 533 Water treatment chemistry 534 535 Sensors ...

  3. Industry Cluster Development Grant winners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry Cluster Development Grant winners Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue:May 2016 all issues All Issues » submit Industry Cluster Development Grant winners Recipients include Picuris Pueblo and Rio Arriba County February 1, 2015 A new community mural on the Hunter Ford facility in Española celebrates the building's planned revitalization and the future location of the Northern New Mexico Food Hub. A new community

  4. Industrial Plans for AEO2014

    U.S. Energy Information Administration (EIA) Indexed Site

    30, 2013 | Washington, DC WORKING GROUP PRESENTATION FOR DISCUSSION PURPOSES DO NOT QUOTE OR CITE AS RESULTS ARE SUBJECT TO CHANGE Industrial team plans for AEO2014 Overview -- AEO2014 * Process flow status & updates * Other model updates * Major data updates * CHP updates 2 Industrial Team Washington DC, July 30, 2013 WORKING GROUP PRESENTATION FOR DISCUSSION PURPOSES DO NOT QUOTE OR CITE AS RESULTS ARE SUBJECT TO CHANGE Process flow models * General: - Replace energy consumption based on

  5. CMMS in the Wind Industry

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10617P Unlimited_Release Printed January 2013 CMMS in the Wind Industry Dennis Belanger MRG, Vice President Doug Hart MRG Consultant Bob Crull MRG Consultant Brian Maier MRG Consultant Management Resources Group, Inc. 27 Glen Road, Sandy Hook, CT 06482 Abstract Through a wide variety of activities and interactions, Sandia has observed limited adoption of electronic work orders in the wind industry. To explore some of the contributing factors for this limited adoption, the CREW team looked to

  6. Working with SRNL - AMC - Industry

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry The dynamic, long-term relationships that would emerge from this laboratory, industry, and academic collaborative would generate new concepts and approaches that not only "spin in" modern manufacturing methods that support DOE mission success but also "spin out" new innovations to support overall chemical and manufacturing competitiveness within the United States. Technology and innovation are being driven by the need to work smarter to reduce risk. The Advanced

  7. Assessing the Control Systems Capacity for Demand Response in California Industries

    SciTech Connect (OSTI)

    Ghatikar, Girish; McKane, Aimee; Goli, Sasank; Therkelsen, Peter; Olsen, Daniel

    2012-01-18

    California's electricity markets are moving toward dynamic pricing models, such as real-time pricing, within the next few years, which could have a significant impact on an industrial facility's cost of energy use during the times of peak use. Adequate controls and automated systems that provide industrial facility managers real-time energy use and cost information are necessary for successful implementation of a comprehensive electricity strategy; however, little is known about the current control capacity of California industries. To address this gap, Lawrence Berkeley National Laboratory, in close collaboration with California industrial trade associations, conducted a survey to determine the current state of controls technologies in California industries. This,study identifies sectors that have the technical capability to implement Demand Response (DR) and Automated Demand Response (Auto-DR). In an effort to assist policy makers and industry in meeting the challenges of real-time pricing, facility operational and organizational factors were taken into consideration to generate recommendations on which sectors Demand Response efforts should be focused. Analysis of the survey responses showed that while the vast majority of industrial facilities have semi- or fully automated control systems, participation in Demand Response programs is still low due to perceived barriers. The results also showed that the facilities that use continuous processes are good Demand Response candidates. When comparing facilities participating in Demand Response to those not participating, several similarities and differences emerged. Demand Response-participating facilities and non-participating facilities had similar timings of peak energy use, production processes, and participation in energy audits. Though the survey sample was smaller than anticipated, the results seemed to support our preliminary assumptions. Demonstrations of Auto-Demand Response in industrial facilities with good control capabilities are needed to dispel perceived barriers to participation and to investigate industrial subsectors suggested of having inherent Demand Response potential.

  8. Tips and Tricks of Incorporating Industry Standards into a Library Collection

    SciTech Connect (OSTI)

    Abbott, Jennifer; Sandberg, Tami

    2015-11-05

    Professional literature on the incorporation of industry standards into a library collection is somewhat limited. The objective of this presentation is to discuss the intricate details of acquiring, managing, and delivering electronic industry standards to library patrons in a seamless manner. Lessons learned regarding vendor selection and license agreements will also be discussed. Results from a survey administer at the National Renewable Energy Laboratory will be used to analyze how collection policies can properly be developed to incorporate industry standards into a library setting. The key points of acquisition decisions, avoidance of liability issues, and cost will be addressed.

  9. Market Report for the Industrial Sector, 2009

    SciTech Connect (OSTI)

    Sastri, Bhima; Brueske, Sabine; de los Reyes, Pamela; Jamison, Keith; Justiniano, Mauricio; Margolis, Nancy; Monfort, Joe; Raghunathan, Anand; Sabouni, Ridah

    2009-07-01

    This report provides an overview of trends in industrial-sector energy use. It focuses on some of the largest and most energy-intensive industrial subsectors and several emerging technologies that could transform key segments of industry.

  10. Solventus Industrial SL | Open Energy Information

    Open Energy Info (EERE)

    Name: Solventus Industrial SL Place: Alczar de San Juan, Spain Zip: 13600 Product: Spanish project developer and engineering. References: Solventus Industrial SL1 This...

  11. IMPACTS: Industrial Technologies Program, Summary of Program...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    support of the Industrial Technologies Program's (ITP's) mission to improve the energy intensity of the U.S. industrial sector, the Save Energy Now Initiative (formerly the ...

  12. Pennsylvania's Comprehensive, Statewide, Pro-Active Industrial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    formerly the Industrial Technologies Program) has developed multiple resources and a best practices suite of tools to help industrial manufacturers reduce their energy intensity. ...

  13. Industrial Assessment Centers Help Students, Communities Learn...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers Help Students, Communities Learn About Energy Efficiency Industrial Assessment Centers Help Students, Communities Learn About Energy Efficiency March ...

  14. Superior Energy Performance Industrial Facility Best Practice...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Facility Best Practice Scorecard Superior Energy Performance Industrial Facility Best Practice Scorecard Superior Energy Performance logo Facilities seeking to use the ...

  15. ITP Industrial Distributed Energy: Distributed Energy Program...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ITP Industrial Distributed Energy: Distributed Energy Program Project Profile: Verizon Central Office Building ITP Industrial Distributed Energy: Distributed Energy Program Project ...

  16. Grand Challenge Portfolio: Driving Innovations in Industrial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Grand Challenge Portfolio: Driving Innovations in Industrial Energy Efficiency, January 2011 Grand Challenge Portfolio: Driving Innovations in Industrial Energy Efficiency, January ...

  17. Industrial Assessment Center Awards: Recognizing Excellence in...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Center Awards: Recognizing Excellence in Future Energy Leaders Industrial Assessment Center Awards: Recognizing Excellence in Future Energy Leaders May 5, ...

  18. Sanyo Chemical Industries | Open Energy Information

    Open Energy Info (EERE)

    Industries Jump to: navigation, search Name: Sanyo Chemical Industries Place: Tokyo, Japan Zip: 103-0023 Product: String representation "Sanyo is a petr ... uction process." is...

  19. Toray Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    Industries Inc Jump to: navigation, search Name: Toray Industries Inc Place: Tokyo, Japan Zip: 103 8666 Sector: Carbon, Vehicles, Wind energy Product: String representation "A...

  20. Industrial Utility Webinar: Financial Mechanisms and Incentives

    SciTech Connect (OSTI)

    2010-03-10

    The Industrial Utility Webinars focus on providing utilities with information on how to develop sucessful energy efficeincy programs for industrial energy consumers.

  1. Goat Industries Fuels | Open Energy Information

    Open Energy Info (EERE)

    Industries Fuels Jump to: navigation, search Name: Goat Industries Fuels Place: Gwynedd, Wales, United Kingdom Zip: LL56 4PZ Product: Welsh manufacturer of biodiesel equipment that...

  2. EIS-0428: Mississippi Gasification, LLC, Industrial Gasification...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8: Mississippi Gasification, LLC, Industrial Gasification Facility in Moss Point, MS EIS-0428: Mississippi Gasification, LLC, Industrial Gasification Facility in Moss Point, MS ...

  3. Integrated Biodiesel Industries Ltd | Open Energy Information

    Open Energy Info (EERE)

    Industries Ltd Jump to: navigation, search Name: Integrated Biodiesel Industries Ltd Place: Sao Paulo, Sao Paulo, Brazil Zip: 01418-200 Product: Sao Paulo-based biodiesel producer....

  4. ,"West Virginia Natural Gas Industrial Consumption (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    AM" "Back to Contents","Data 1: West Virginia Natural Gas Industrial Consumption (MMcf)" "Sourcekey","N3035WV2" "Date","West Virginia Natural Gas Industrial Consumption ...

  5. Sierra Pacific Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    Industries Inc Place: California Website: www.spi-ind.com Twitter: @SierraPacificIn Facebook: https:www.facebook.compagesSierra-Pacific-Industries295910403780823 References:...

  6. Residential Building Industry Consulting Services | Open Energy...

    Open Energy Info (EERE)

    Residential Building Industry Consulting Services Jump to: navigation, search Name: Residential Building Industry Consulting Services Place: New York, NY Information About...

  7. Development of Industrially Viable Battery Electrode Coatings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrially Viable Battery Electrode Coatings Development of Industrially Viable Battery Electrode Coatings 2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies ...

  8. Angelantoni Industrie Spa | Open Energy Information

    Open Energy Info (EERE)

    Angelantoni Industrie Spa Jump to: navigation, search Name: Angelantoni Industrie Spa Place: Massa Martana, Italy Zip: 6056 Sector: Renewable Energy Product: String representation...

  9. Qualified Specialists in Industrial Assessment Tools | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Qualified Specialists in Industrial Assessment Tools Qualified Specialists in Industrial Assessment Tools Locate a DOE-trained Qualified Specialist in your area to identify ways to...

  10. PAIS Industries Group | Open Energy Information

    Open Energy Info (EERE)

    PAIS Industries Group Jump to: navigation, search Name: PAIS Industries Group Sector: Solar Product: Plans to supply solar-grade silicon, conditional on an agreement with the Inner...

  11. AEO2016 Preliminary Industrial Output Results

    Gasoline and Diesel Fuel Update (EIA)

    - Enhancements of the industrial output model to incorporate additional detail of chemical, glass, and paper industries. - The extension of the supply matrices allowing for ...

  12. Chemicals Industry Profile | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Chemicals Industry Profile Chemicals Industry Profile Chemical products are essential to ... Economic The United States is the top chemical producer in the world, accounting for ...

  13. Agro Industrial Taruma | Open Energy Information

    Open Energy Info (EERE)

    Industrial Taruma Jump to: navigation, search Name: Agro Industrial Taruma Place: Sao Pedro do Turvo, Sao Paulo, Brazil Zip: 18940-000 Product: Brazil based ethanol producer...

  14. California Solar Energy Industries Association | Open Energy...

    Open Energy Info (EERE)

    Solar Energy Industries Association Jump to: navigation, search Name: California Solar Energy Industries Association Place: Rio Vista, California Zip: 94571 Sector: Solar Product:...

  15. Passive Solar Industries Council | Open Energy Information

    Open Energy Info (EERE)

    Passive Solar Industries Council Jump to: navigation, search Name: Passive Solar Industries Council Place: Ashland, OR Information About Partnership with NREL Partnership with NREL...

  16. Aditya Solar Power Industries | Open Energy Information

    Open Energy Info (EERE)

    Aditya Solar Power Industries Jump to: navigation, search Name: Aditya Solar Power Industries Place: India Sector: Solar Product: Bangalore-based solar project developer....

  17. Phoenix Bio Industries LLC | Open Energy Information

    Open Energy Info (EERE)

    Bio Industries LLC Jump to: navigation, search Name: Phoenix Bio-Industries LLC Place: Goshen, California Zip: 93227 Product: Ethanol producer. Coordinates: 37.988525,...

  18. Canyon Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    Industries Inc Jump to: navigation, search Name: Canyon Industries Inc Place: Deming, Washington State Zip: 98244 Sector: Hydro Product: Canyon Hydro produces a range of small...

  19. Millennium Energy Industries | Open Energy Information

    Open Energy Info (EERE)

    Industries Place: Jordan Zip: 1182 Sector: Solar Product: Jordan-based solar energy firm focused in MENA region. References: Millennium Energy Industries1 This article is a...

  20. Solar Energy Industries Association | Open Energy Information

    Open Energy Info (EERE)

    Solar Energy Industries Association Name: Solar Energy Industries Association Address: 575 7th Street NW 400 Place: Washington, DC Zip: 20004 Number of Employees: 11-50 Year...

  1. Oregon Trail Mushrooms Industrial Low Temperature Geothermal...

    Open Energy Info (EERE)

    Mushrooms Industrial Low Temperature Geothermal Facility Jump to: navigation, search Name Oregon Trail Mushrooms Industrial Low Temperature Geothermal Facility Facility Oregon...

  2. Shanghai Aerospace Industrial General Corporation aka Shanghai...

    Open Energy Info (EERE)

    Industrial General Corporation aka Shanghai Academy of Spaceflight Technology Jump to: navigation, search Name: Shanghai Aerospace Industrial General Corporation (aka Shanghai...

  3. CRV industrial Ltda | Open Energy Information

    Open Energy Info (EERE)

    CRV industrial Ltda Jump to: navigation, search Name: CRV industrial Ltda Place: Carmo do Rio Verde, Goias, Brazil Sector: Biomass Product: Ethanol and biomass energy producer...

  4. Ennis Laundry Industrial Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Ennis Laundry Industrial Low Temperature Geothermal Facility Jump to: navigation, search Name Ennis Laundry Industrial Low Temperature Geothermal Facility Facility Ennis Laundry...

  5. Individual Industrial WPFC Permit | Open Energy Information

    Open Energy Info (EERE)

    Individual Industrial WPFC Permit Jump to: navigation, search OpenEI Reference LibraryAdd to library Reference: Individual Industrial WPFC Permit Published Publisher Not Provided,...

  6. Nongqishi Electric Power Industrial Corporation | Open Energy...

    Open Energy Info (EERE)

    Nongqishi Electric Power Industrial Corporation Jump to: navigation, search Name: Nongqishi Electric Power Industrial Corporation Place: Kuitun City, Xinjiang Autonomous Region,...

  7. Yusheng Industrial Co Ltd | Open Energy Information

    Open Energy Info (EERE)

    Yusheng Industrial Co Ltd Jump to: navigation, search Name: Yusheng Industrial Co., Ltd Place: Hunan Province, China Zip: 415000 Sector: Hydro Product: Hunan-based small hydro...

  8. Industrial Utility Webinar: Natural Gas Efficiency Programs

    SciTech Connect (OSTI)

    2010-04-15

    The Industrial Utility Webinars focus on providing utilities with information on how to develop sucessful energy efficeincy programs for industrial energy consumers.

  9. Industrial Utility Webinar: Public Power Open Session

    SciTech Connect (OSTI)

    2010-02-10

    The Industrial Utility Webinars focus on providing utilities with information on how to develop sucessful energy efficeincy programs for industrial energy consumers.

  10. Colorado Industrial Challenge and Recognition Program

    Broader source: Energy.gov [DOE]

    U.S. Department of Energy Industrial Technologies Program 2009 State Award Fact Sheet that offers details of the Colorado Industrial program.

  11. Triangle biofuels Industries | Open Energy Information

    Open Energy Info (EERE)

    Triangle biofuels Industries Jump to: navigation, search Name: Triangle biofuels Industries Place: Iowa Product: Biodiesel producer developing a 19mlpa plant in Johnston, IA....

  12. Orion Bus Industries | Open Energy Information

    Open Energy Info (EERE)

    Bus Industries Jump to: navigation, search Name: Orion Bus Industries Place: Ontario, Canada Information About Partnership with NREL Partnership with NREL Yes Partnership Type...

  13. Hebei Huazheng Industry | Open Energy Information

    Open Energy Info (EERE)

    Hebei Province, China Zip: 53500 Product: Hebei Huazheng Industry manufactures electrical semiconductor devices. References: Hebei Huazheng Industry1 This article is a stub. You...

  14. Oregon General Industrial Water Pollution Control Facilities...

    Open Energy Info (EERE)

    General Industrial Water Pollution Control Facilities Webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Oregon General Industrial Water Pollution...

  15. Green Energy Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    Industries Inc Jump to: navigation, search Name: Green Energy Industries Inc Region: United States Sector: Marine and Hydrokinetic Website: http: This company is listed in the...

  16. Industrial Technology Research Institute | Open Energy Information

    Open Energy Info (EERE)

    Technology Research Institute Jump to: navigation, search Logo: Industrial Technology Research Institute Name: Industrial Technology Research Institute Address: Rm. 112, Bldg. 24,...

  17. Clean Technology Sustainable Industries Organization | Open Energy...

    Open Energy Info (EERE)

    Sustainable Industries Organization Jump to: navigation, search Name: Clean Technology & Sustainable Industries Organization Place: Royal Oak, Michigan Zip: 48073 Product: A...

  18. Future Bottlenecks for Industrial Water Recycling. (Conference...

    Office of Scientific and Technical Information (OSTI)

    Future Bottlenecks for Industrial Water Recycling. Citation Details In-Document Search Title: Future Bottlenecks for Industrial Water Recycling. Authors: Brady, Patrick V....

  19. Vikram Group of Industries | Open Energy Information

    Open Energy Info (EERE)

    Vikram Group of Industries Jump to: navigation, search Name: Vikram Group of Industries Place: Kolkatta, West Bengal, India Zip: 700001 Product: Kolkata-based tea processing...

  20. South Jersey Industries | Open Energy Information

    Open Energy Info (EERE)

    Jersey Industries Jump to: navigation, search Name: South Jersey Industries Place: Folsom, New Jersey Zip: 8037 Sector: Services Product: An energy services holding company....

  1. AgroIndustrial Capela | Open Energy Information

    Open Energy Info (EERE)

    AgroIndustrial Capela Jump to: navigation, search Name: AgroIndustrial Capela Place: Capela, Sergipe, Brazil Product: Brazil based ethanol producer located in Sergipe, part of...

  2. ITP Aluminum: Aluminum Industry Vision: Sustainable Solutions...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Aluminum Industry Vision: Sustainable Solutions for a Dynamic World ITP Aluminum: Aluminum Industry Vision: Sustainable Solutions for a Dynamic World PDF icon alumvision.pdf More ...

  3. Everbrite Industries Inc | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Everbrite Industries Inc. Place: Toronto, Ontario, Canada Zip: M1R 2T6 Sector: Solar Product: Everbrite Industries is an electrical contractor...

  4. Guardian Industries Corp | Open Energy Information

    Open Energy Info (EERE)

    Industries Corp Jump to: navigation, search Name: Guardian Industries Corp Place: Auburn Hills, Michigan Zip: 48326-1714 Sector: Solar Product: Michigan-based firm that...

  5. Danish Wind Industry Association | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Danish Wind Industry Association Place: Copenhagen V, Denmark Zip: DK-1552 Sector: Wind energy Product: The Danish Wind Industry Association...

  6. Industrial Utility Webinar: Combined Heat and Power

    SciTech Connect (OSTI)

    2010-06-09

    The Industrial Utility Webinars focus on providing utilities with information on how to develop sucessful energy efficeincy programs for industrial energy consumers.

  7. 2015 Uranium Marketing Annual Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration, Form EIA-858 ""Uranium Marketing Annual Survey"" (2015)." " U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 15

  8. Reflection Survey | Open Energy Information

    Open Energy Info (EERE)

    (Gritto, Et Al.) Rye Patch Area Integrated Seismic Studies At The Rye Patch Geothermal Reservoir, Nevada Reflection Survey At Rye Patch Area (Laney, 2005) Rye Patch Area Federal...

  9. Federal Buildings Supplemental Survey -- Overview

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings The Federal Buildings Supplemental Survey 1993 provides building-level energy-related characteristics for a special sample of commercial buildings owned by the...

  10. IRT Surveys | Open Energy Information

    Open Energy Info (EERE)

    consulting in building thermographers and thermal imaging allowing to detect energy loss and increase of energy efficiency. References: IRT Surveys1 This article is a stub....

  11. A National Radiation Oncology Medical Student Clerkship Survey: Didactic Curricular Components Increase Confidence in Clinical Competency

    SciTech Connect (OSTI)

    Jagadeesan, Vikrant S.; Raleigh, David R.; Koshy, Matthew; Howard, Andrew R.; Chmura, Steven J.; Golden, Daniel W.

    2014-01-01

    Purpose: Students applying to radiation oncology residency programs complete 1 or more radiation oncology clerkships. This study assesses student experiences and perspectives during radiation oncology clerkships. The impact of didactic components and number of clerkship experiences in relation to confidence in clinical competency and preparation to function as a first-year radiation oncology resident are evaluated. Methods and Materials: An anonymous, Internet-based survey was sent via direct e-mail to all applicants to a single radiation oncology residency program during the 2012-2013 academic year. The survey was composed of 3 main sections including questions regarding baseline demographic information and prior radiation oncology experience, rotation experiences, and ideal clerkship curriculum content. Results: The survey response rate was 37% (70 of 188). Respondents reported 191 unique clerkship experiences. Of the respondents, 27% (19 of 70) completed at least 1 clerkship with a didactic component geared towards their level of training. Completing a clerkship with a didactic component was significantly associated with a respondent's confidence to function as a first-year radiation oncology resident (Wilcoxon ranksum P=.03). However, the total number of clerkships completed did not correlate with confidence to pursue radiation oncology as a specialty (Spearman ? P=.48) or confidence to function as a first year resident (Spearman ? P=.43). Conclusions: Based on responses to this survey, rotating students perceive that the majority of radiation oncology clerkships do not have formal didactic curricula. Survey respondents who completed a clerkship with a didactic curriculum reported feeling more prepared to function as a radiation oncology resident. However, completing an increasing number of clerkships does not appear to improve confidence in the decision to pursue radiation oncology as a career or to function as a radiation oncology resident. These results support further development of structured didactic curricula for the radiation oncology clerkship.

  12. Steel Industry Energy Bandwidth Study

    SciTech Connect (OSTI)

    none,

    2004-10-01

    ITP conducted a study on energy use and potential savings, or "bandwidth" study, in major steelmaking processes. Intended to provide a realistic estimate of the potential amount of energy that can be saved in an industrial process, the "bandwidth" refers to the difference between the amount of energy that would be consumed in a process using commercially available technology versus the minimum amount of energy needed to achieve those same results based on the 2nd law of thermodynamics. The Steel Industry Energy Bandwidth Study (PDF133 KB) also estimates steel industry energy use in the year 2010, and uses that value as a basis for comparison against the minimum requirements. This energy savings opportunity for 2010 will aid focus on longer term R&D.

  13. The chemical industry, by country

    SciTech Connect (OSTI)

    Not Available

    1995-03-01

    Beijing will be the site for the third ACHEMASIA, international petrochemical and chemical exhibition and conference, May 15--20, 1995. In preparation for this conference, Hydrocarbon Processing contacted executives of petrochemical/chemical industries and trade associations, seeking views on the state of the industry. The Asia-Pacific region is the center of new construction and expanded capacity and also a mixture of mature, developing and emerging petrochemical industries. Established countries must mold and grow with emerging economies as the newcomers access natural resources and develop their own petrochemical infrastructures. The following nation reports focus on product supply/demand trends, economic forecasts, new construction, etc. Space limitations prohibit publishing commentaries from all countries that have petrochemical/chemical capacity. Reports are published from the following countries: Australia, China, Japan, Korea, Malaysia, Philippines, Thailand, and Vietnam.

  14. Survey to determine the value of DYNA

    SciTech Connect (OSTI)

    Walter, J.W.; Bellshaw, D.

    1993-01-01

    This report presents the value of the DYNA software program to US Industry. The software conducts dynamic finite element analysis tailored specifically to simulating high energy impacts, such as car crashes or aircraft collisions with birds. DYNA is available at nearly zero cost to the public in two-dimensional (DYNA2D) and three-dimensional versions (DYNA3D). DYNA has had a major impact on US industry. Measuring this impact using conventional approaches, such as profitability or revenue size, does not apply to DYNA. A new approach is needed that will capture DYNA's value to US industry. Our challenge was two fold: (1) to develop a methodology for valuing technology transferred to the public domain; and (2) to apply this methodology to DYNA. We accomplished the evaluation task by using indirect measurements of value. These indicators encompassed three broad categories, answering three key questions: (1) Use of DYNA and DYNA-like'' codes: Are companies, academic institutions, government agencies actually using DYNA and codes like it (2) Savings generated from using these codes: Is the use of DYNA and codes like it creating a positive economic impact (3) Market size of afl DYNA-like'' codes: Has a commercial market developed for DYNA-like'' codes This study represents the results of interviews with people identified by Lawrence Livermore National Laboratory (LLNL) as users of DYNA. Some of the people surveyed for this study do not use DYNA. They rely upon other dynamic finite element analysis codes. We refer to these individuals as users of DYNA-like'' codes or codes like DYNA.'' Several of the DYNA-like'' codes used DYNA as their core. These codes are descendants of DYNA.

  15. Survey to determine the value of DYNA

    SciTech Connect (OSTI)

    Walter, J.W.; Bellshaw, D.

    1993-01-01

    This report presents the value of the DYNA software program to US Industry. The software conducts dynamic finite element analysis tailored specifically to simulating high energy impacts, such as car crashes or aircraft collisions with birds. DYNA is available at nearly zero cost to the public in two-dimensional (DYNA2D) and three-dimensional versions (DYNA3D). DYNA has had a major impact on US industry. Measuring this impact using conventional approaches, such as profitability or revenue size, does not apply to DYNA. A new approach is needed that will capture DYNA`s value to US industry. Our challenge was two fold: (1) to develop a methodology for valuing technology transferred to the public domain; and (2) to apply this methodology to DYNA. We accomplished the evaluation task by using indirect measurements of value. These indicators encompassed three broad categories, answering three key questions: (1) Use of DYNA and ``DYNA-like`` codes: Are companies, academic institutions, government agencies actually using DYNA and codes like it? (2) Savings generated from using these codes: Is the use of DYNA and codes like it creating a positive economic impact (3) Market size of afl ``DYNA-like`` codes: Has a commercial market developed for ``DYNA-like`` codes? This study represents the results of interviews with people identified by Lawrence Livermore National Laboratory (LLNL) as users of DYNA. Some of the people surveyed for this study do not use DYNA. They rely upon other dynamic finite element analysis codes. We refer to these individuals as users of ``DYNA-like`` codes or ``codes like DYNA.`` Several of the ``DYNA-like`` codes used DYNA as their core. These codes are descendants of DYNA.

  16. Energy Industry Days Additional Information

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy (DOE) Office of Energy Efficiency and Renewable Energy is hosting several Energy Industry Day events to promote and publicize opportunities for small businesses seeking to meet DOE support requirements. Opportunities will be available for attendees to learn of potential partnerships with prime and subcontracting companies. These Energy Industry Day events would both support the agency's commitment to DOE's "Small Business First Policy" and would provide dedicated sessions that introduce Energy Service Companies (ESCOs) and other prime contract holders with small business.

  17. Industry turns its attention south

    SciTech Connect (OSTI)

    Marhefka, D.

    1997-08-01

    The paper discusses the outlook for the gas and oil industries in the Former Soviet Union and Eastern Europe. Significant foreign investment continues to elude Russia`s oil and gas industry, so the Caspian nations of Kazakhstan and Azerbaijan are picking up the slack, welcoming the flow of foreign capital to their energy projects. Separate evaluations are given for Russia, Azerbaijan, Kazakhstan, Turkmenistan, Ukraine, Armenia, Belarus, Georgia, Lithuania, Latvia, Estonia, Moldova, Tajikstan, Uzbekistan, Albania, Bulgaria, Croatia, Czech Republic, Hungary, Poland, Romania, Slovakia, Slovenia, and Serbia.

  18. World Congress on Industrial Biotechnology

    Broader source: Energy.gov [DOE]

    Held this year in Montreal, Quebec, the BIO World Congress on Industrial Biotechnology will bring together business leaders, investors, and policy makers in biofuels, biobased products, and renewable chemicals. BETO Demonstration and Market Transformation Program Manager Jim Spaeth and Support Specialist Natalie Roberts will be in attendance.

  19. 2015 NREL Industry Growth Forum

    Broader source: Energy.gov [DOE]

    During NREL’s 2015 Industry Growth Forum, 30 competitively selected clean energy startups will pitch their businesses to investors and compete to win the NREL Best Venture Award.  One of the...

  20. Rebuilding the American Auto Industry

    Broader source: Energy.gov [DOE]

    The Administration made strategic investments to help U.S. auto manufacturers retool to produce the hybrid, electric, and highly fuel efficient advanced vehicles of the future. With the help of these investments -- and the incredible talent and commitment of America's auto workers -- the auto industry is growing again.

  1. Wind Power: Options for Industry

    SciTech Connect (OSTI)

    Not Available

    2003-03-01

    This six-page brochure outlines ways for industry to integrate wind power, including assessing wind power, building wind farms, using a developer, capitalizing on technology, enhancing the corporate image, and preparing RFPs. Company examples and information resources are also provided.

  2. COMPENDIUM: SURVEYS EVALUATING KNOWLEDGE AND OPINIONS CONCERNING HYDROGEN AND FUEL CELL TECHNOLOGIES

    SciTech Connect (OSTI)

    Truett, Lorena Faith; Cooper, Christy; Schmoyer, Richard L

    2008-10-01

    This compendium updates a 2003 literature review of surveys of knowledge and opinions of hydrogen and fuel cell technologies. Its purpose is to ensure that results of comparable surveys are considered in surveys conducted by the U.S. Department of Energy (DOE). Over twice as many studies related to the DOE survey have been published since 2003 than prior to that date. The fact that there have been significantly more studies implies that there have been further demonstration projects and/or increased interest in hydrogen and fuel cell technologies. The primary findings of these 15 new surveys, all of which were conducted in Europe (E) or North America (NA), to the DOE surveys are as follows: 1.Respondents who are more educated are more accepting of hydrogen technologies (NA). 2.Respondents who are more knowledgeable about hydrogen and/or fuel cells are more accepting of hydrogen technologies (E, NA). 3.When asked about issues of trust, respondents generally expressed distrust of the government or political parties but trusted scientists and environmental protection organizations (E). 4.Technical knowledge about hydrogen and fuel cell technologies is low (E, NA). 5.Respondents may express opinions about a technology even when they are lacking in knowledge of that technology (E). 6.Women and men have different priorities when deciding on an automobile purchase (E). 7.Public acceptance to hydrogen is vulnerable to perceptions of decreased safety (E, NA). 8.Public acceptance to hydrogen is vulnerable to perceptions of increased cost (E, NA). The DOE surveys are similar to surveys that examine technical knowledge of hydrogen and fuel cell technologies, although the technical questions are certainly different. The DOE surveys are also similar to the opinion surveys in that they address many of the same issues, such as safety, sources of energy information, or trust. There are many differences between the surveys reviewed in this compendium and the DOE surveys. The information for many of the surveys is collected face-to-face or electronically; however, all of the DOE surveys are conducted via telephone interviews. Most of the surveys concentrated on a specific population group, while the DOE surveys addressed five different populations (general public, students, government agencies, end users, and safety and codes officials). No survey (except the DOE survey) conducted since 2003 surveyed students knowledge and opinions of hydrogen and fuel cells. Although several surveys have solicited opinions of users (e.g., passengers of fuel-cell vehicles), no surveys were conducted of end users (industrial users needing large power supplies, commercial users needing uninterrupted power, or transportation businesses). While the International Organization for Standardization (ISO) has surveyed its membership concerning standards, the population of safety and codes officials has not been surveyed. The greatest impact and importance of the DOE surveys is that five distinct population groups are surveyed for both knowledge and opinions on hydrogen and fuel cells. Knowledge levels can be computed for each population group and can be compared across the populations and across time. Opinions can be compared with knowledge levels. A baseline of knowledge levels was derived using the results of the 2004 surveys; this baseline will be compared with the results of the knowledge evaluation for the surveys of 2008/2009 and 2011/2012. The DOE knowledge and opinion surveys are unique in coverage and purpose. It must be noted, however, that response rates for telephone surveys have decreased dramatically over time. Developments in survey methodology research will have to be followed over the next few years so that necessary adjustments are made in the 20112012 DOE hydrogen survey design, to account for cell-phone-only individuals as well as other changes in telephone usage demographics.

  3. ITP Mining: Water Use in Industries of the Future: Mining Industry |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Water Use in Industries of the Future: Mining Industry ITP Mining: Water Use in Industries of the Future: Mining Industry PDF icon water_use_mining.pdf More Documents & Publications ITP Mining: Energy and Environmental Profile of the U.S. Mining Industry (December 2002) U.S. Mining Industry Energy Bandwidth Study ITP Mining: Mining Industry of the Future Mineral Processing Technology Roadmap

  4. Industrial

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Expand News & Events Skip navigation links Residential Residential Lighting Energy Star Appliances Consumer Electronics Heat Pump Water Heaters Electric Storage Water...

  5. Industrial

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Company, Smoky Canyon Mining, PNL 9344 UC-310 (195) Impact Evaluation of a Slush Chest Bypass Installed at Scott Paper Company; PNL 9466, UC-310 (295) Impact Evaluation of...

  6. Industrial

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    efficiency; or to replace it with a new motor. If the motor rewind resulted in the motor having maintained its original efficiency, it is commonly called a GREEN REWIND....

  7. QUASAR OPTICAL VARIABILITY IN THE PALOMAR-QUEST SURVEY (Journal...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne ; Baltay, Charles ; Coppi, Paolo ; Ellman, Nancy ; Jerke, Jonathan ; ... 06520-8120 (United States), E-mail: anne.bauer@aya.yale.edu Publication Date: 2009-05-10 ...

  8. BLAZAR OPTICAL VARIABILITY IN THE PALOMAR-QUEST SURVEY (Journal...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne ; Baltay, Charles ; Coppi, Paolo ; Ellman, Nancy ; Jerke, Jonathan ; ... 06520-8120 (United States), E-mail: anne.bauer@aya.yale.edu Publication Date: 2009-07-10 ...

  9. Colorado Industrial Energy Challenge | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    State and Utility Engagement Activities » Colorado Industrial Energy Challenge Colorado Industrial Energy Challenge Colorado The U.S. Department of Energy's (DOE's) Advanced Manufacturing Office (AMO; formerly the Industrial Technologies Program) has developed multiple resources and a Best Practices suite of tools to help industrial manufacturers reduce their energy intensity. AMO adopted the Energy Policy Act of 2005 objective of reducing industrial energy intensity 2.5% annually over the next

  10. China develops natural gas industry

    SciTech Connect (OSTI)

    Not Available

    1982-01-01

    As of 1981, more than 60 natural gas fields with a total annual output of 12.74 billion cu m have been discovered in China, placing the country among the top 12 gas producers in the world. In addition, there are prospects for natural gas in the Bohai-North China Basin and the Qaidam Basin, NW. China, providing a base for further expansion of the gas industry. Gas reservoirs have been found in 9 different geologic ages: Sinian, Cambrian, Ordovician, Carboniferous, Permian, Triassic, Jurassic, Tertiary, and Quaternary. Of the 60 gas field now being exploited, there are more than 40 fields in Sichuan. The Sichuan Basin gas industry is described in detail.

  11. Industrial lead paint removal specifications

    SciTech Connect (OSTI)

    Stone, R.C.

    1997-06-01

    The purpose of this paper is to inform the reader as to some of the pertinent rules and regulations promulgated by the Environmental Protection Agency (EPA) and the Occupational Safety and Health Administration (OSHA) that may effect an industrial lead paint removal project. The paper discusses a recommended schedule of procedures and preparations to be followed by the lead paint removal specification writer when analyzing the possible impact of the project on the environment, the public and workers. Implications of the Clean Air Act, the Clean Water Act and the Resource Conservation and Recovery Act (RCRA) along with hazardous waste handling, manifesting, transporting and disposal procedures are discussed with special emphasis placed as to their impact on the writer and the facility owner. As the rules and regulations are highly complex, the writer has attempted to explain the methodology currently being used in state-of-the-art industrial lead abatement specifications.

  12. Fall 1994 wildlife and vegetation survey, Norton Air Force Base, California

    SciTech Connect (OSTI)

    Not Available

    1994-12-15

    The fall 1994 wildlife and vegetation surveys were completed October 3-7, 1994, at Norton Air Force Base (AFB), California. Two biologists from CDM Federal Programs, the U.S. Environmental Protection Agency (EPA) regional biologist and the Oak Ridge National Laboratory (ORNL) lead biologist conducted the surveys. A habitat assessment of three Installation Restoration Project (IRP) sites at Norton Air Force Base was also completed during the fall survey period. The IRP sites include: Landfill No. 2 (Site 2); the Industrial Wastewater Treatment Plant (IWTP) area; and Former Fire Training Area No. 1 (Site 5). The assessments were designed to qualitatively characterize the sites of concern, identify potential ecological receptors, and provide information for Remedial Design/Remedial Action activities. A Reference Area (Santa Ana River Wash) and the base urban areas were also characterized. The reference area assessment was performed to provide a baseline for comparison with the IRP site habitats. The fall 1994 survey is the second of up to four surveys that may be completed. In order to develop a complete understanding of all plant and animal species using the base, these surveys were planned to be conducted over four seasons. Species composition can vary widely during the course of a year in Southern California, and therefore, seasonal surveys will provide the most complete and reliable data to address changes in habitat structure and wildlife use of the site. Subsequent surveys will focus on seasonal wildlife observations and a spring vegetation survey.

  13. Steel Industry Marginal Opportunity Analysis

    SciTech Connect (OSTI)

    none,

    2005-09-01

    The Steel Industry Marginal Opportunity Analysis (PDF347 KB) identifies opportunities for developing advanced technologies and estimates both the necessary funding and the potential payoff. This analysis determines what portion of the energy bandwidth can be captured through the adoption of state-of-the-art technology and practices. R&D opportunities for addressing the remainder of the bandwidth are characterized and plotted on a marginal opportunity curve.

  14. Nuclear Industry Job Descriptions Boilermaker

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Incident Team NNSA houses the Nuclear Incident Team (NIT), which is responsible for deploying assets at the request of coordinating agencies in response to a nuclear or radiological incident. The NIT's mission is to coordinate NNSA assets for deployment, continually monitor deployment activities, and provide situational awareness of activities to NNSA management. The NIT is staffed and fully operational within two hours of notification

    Industry Job Descriptions Boilermaker Skilled craft who

  15. Lab-Corps: Industry Mentor

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry Mentor * EcoSnap-AC Team - Window AC without the need for window * Background - Four start up technology companies - 2 - Software / 2 - Advanced Materials - Current Advisor / Consultant - four technology start-ups 2 Program Perspectives * Invaluable experience for the DOE lab teams - Understanding the technology commercialization process - Validation of the value proposition & market problem - Defining the pathway into markets * Value Chain & Eco System - Structuring a scalable

  16. INDUSTRIAL SAFETY & HEALTH (ISH)

    Office of Environmental Management (EM)

    IIT-Industry Collaboration - Synchrophasor Engineering Research and Training Applicant: Illinois Institute of Technology (IIT) Principal Investigator: Alexander J. Flueck, flueck@iit.edu, 312-567-3625 Project Description Illinois Institute of Technology (IIT) has installed 12 Phasor Measurement Units (PMUs) on its main campus, home to the DOE-funded Perfect Power Microgrid. With the assistance of IIT Facilities, the PMU project has been gathering synchrophasor data from the 4 kV campus

  17. Geodetic Survey | Open Energy Information

    Open Energy Info (EERE)

    At Kilauea Summit Area (Keller, Et Al., 1979) Kilauea Summit Area Results Of An Experimental Drill Hole At The Summit Of Kilauea Volcano, Hawaii Geodetic Survey At Long Valley...

  18. 2014 Manufacturing Energy Consumption Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    U S C E N S U S B U R E A U 2014 Manufacturing Energy Consumption Survey Sponsored by the Energy Information Administration U.S. Department of Energy Administered and Compiled by ...

  19. 2005 Residential Energy Consumption Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    Completed forms are due by March 4, 2006. If you have any questions, please call (toll-free) 1-NNN-NNN-NNNN. Ask for the Supplier Survey Specialist. This report is mandatory under ...

  20. 2005 Residential Energy Consumption Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    Completed forms are due by March 4, 2006. If you have any questions, please call (toll-free) 1-NNN-NNN-NNNN. Ask for the Supplier Survey Specialist.. This report is mandatory under ...

  1. Farm operator perceptions of water quality protective pest management practices: Selected survey findings

    SciTech Connect (OSTI)

    Zimmerman, R.; Blair, J.; Webb, B.

    1995-12-01

    The use of pesticides in agriculture often poses a tension between water quality and environmental protection goals on the one hand and the viability of food supplies on the other hand. Pesticides used for field crops (e.g., corn, soy beans and wheat) have been detected in waterbodies, and according to some studies, are apparently finding their way into water supplies. A considerable amount of discretion is allowed in farm operator`s choice of pest management practices, and voluntary behavior becomes an important factor in promoting environmentally protective practices. Thus, it is important to know the attitudes of farmers who make pest management decisions including pesticide choices, toward the use of various water quality protective pest management practices. A number of studies show that more general environmental attitudes reflect a general world view that shapes attitudes toward particular environmental issues. This paper addresses the relationship between the more general environmental attitudes of farmers to their attitudes toward water quality issues and pest management practices which are protective of water quality. Some of the personal tradeoffs farmers are willing to make to enhance environmental controls on pesticides are also explored. Results are based on preliminary findings from a survey of farm operators who grow corn, soybeans and other field crops in three eastern states. The survey was conducted via a mail questionnaire to 2,700 farmers with telephone follow-up during the Fall of 1994. Implications of the findings for pest management in general are discussed.

  2. Preliminary survey report: control technology for gallium arsenide processing at Morgan Semiconductor Division, Garland, Texas

    SciTech Connect (OSTI)

    Lenihan, K.L.

    1987-03-01

    The report covers a walk through survey made of the Morgan Semiconductor Facility in Garland, Texas, to evaluate control technology for gallium-arsenide dust in the semiconductor industry. Engineering controls included the synthesis of gallium-arsenide outside the crystal pullers to reduce arsenic residues in the pullers, also reducing worker exposure to arsenic during cleaning of the crystal pullers.

  3. I COMPREHENSIVE RADIOLOGICAL SURVEY I

    Office of Legacy Management (LM)

    im I COMPREHENSIVE RADIOLOGICAL SURVEY I Prepared by Oak Ridge Associated Universities Prprd* OFF-SITE PROPERTY H' | Prepared for Office of Operational FORMER LAKE ONTARIO ORDNANCE WORKS SITE Safety U.S. Department LEWISTON, NEW YORK I of Energy i J.D. BERGER i Radiological Site Assessment Program Manpower Education, Research, and Training Division I l*~~~~~~ ~~~~DRAFT REPORT January 1983 I I I ------- COMPREHENSIVE RADIOLOGICAL SURVEY OFF-SITE PROPERTY H' FORMER LAKE ONTARIO ORDNANCE WORKS SITE

  4. Geophex Airborne Unmanned Survey System

    SciTech Connect (OSTI)

    Won, I.L.; Keiswetter, D.

    1995-12-31

    Ground-based surveys place personnel at risk due to the proximity of buried unexploded ordnance (UXO) items or by exposure to radioactive materials and hazardous chemicals. The purpose of this effort is to design, construct, and evaluate a portable, remotely-piloted, airborne, geophysical survey system. This non-intrusive system will provide stand-off capability to conduct surveys and detect buried objects, structures, and conditions of interest at hazardous locations. During a survey, the operators remain remote from, but within visual distance of, the site. The sensor system never contacts the Earth, but can be positioned near the ground so that weak geophysical anomalies can be detected. The Geophex Airborne Unmanned Survey System (GAUSS) is designed to detect and locate small-scale anomalies at hazardous sites using magnetic and electromagnetic survey techniques. The system consists of a remotely-piloted, radio-controlled, model helicopter (RCH) with flight computer, light-weight geophysical sensors, an electronic positioning system, a data telemetry system, and a computer base-station. The report describes GAUSS and its test results.

  5. 2008/2009 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Next 20082009 User Survey Results Table of Contents Response Survey Respondent Demographics Overall Satisfaction and Importance All Satisfaction and Importance Ratings...

  6. Idaho Geological Survey | Open Energy Information

    Open Energy Info (EERE)

    The Idaho Geological Survey is located in Boise, Idaho. About Information on past oil and gas exploration wells in Idaho was transferred to the Idaho Geological Survey in...

  7. radiological. survey | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    survey NNSA to Conduct Aerial Radiological Surveys Over San Francisco, Pacifica, Berkeley, And Oakland, CA Areas A U.S. Department of Energy National Nuclear Security...

  8. FAQs for Survey Forms 804 and 814

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    intended for cracking into olefins. EIA-804 Survey form & instructions Contact: Robert Merriam, (202) 586-4615 EIA-814 Survey form & instructions Contact: Chris Buckner, (202)...

  9. Category:Telluric Survey | Open Energy Information

    Open Energy Info (EERE)

    Pages in category "Telluric Survey" This category contains only the following page. T Telluric Survey Retrieved from "http:en.openei.orgwindex.php?titleCategory:Telluric...

  10. Macro-Industrial Working Group Meeting 2: Industrial updates and Preliminary results

    U.S. Energy Information Administration (EIA) Indexed Site

    Macro-Industrial Working Group Meeting 2: Industrial updates and Preliminary results Macro Industrial Working Group (MIWG) Industrial Team: Kelly Perl, Team Leader; Peter Gross, Susan Hicks, Paul Otis February 18, 2016 | Washington, DC Preliminary Results. Do not Disseminate. AEO2016 additions for the Industrial Demand Module (IDM) * Technology choice models complete; end of 5 year effort * Benchmarking improvements - Individual industry benchmarking of tables complete - On-going effort to

  11. Industrial Utility Webinar: Opportunities for Cost-Effective Energy Efficiency in the Industrial Sector

    SciTech Connect (OSTI)

    2010-01-13

    The Industrial Utility Webinars focus on providing utilities with information on how to develop sucessful energy efficeincy programs for industrial energy consumers.

  12. Tools to Boost Steam System Efficiency, Software Tools for Industry, Industrial Technologies Program (ITP) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-12-01

    This fact sheet describes how the Industrial Technologies Program steam software tools can help industrial plants identify steam system improvements to save energy and money.

  13. Improve Chilled Water System Performance, Software Tools for Industry, Industrial Technologies Program (ITP) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-12-01

    This fact sheet describes how the Industrial Technologies Program Chilled Water System Analysis Tool (CWSAT) can help optimize the performance of of industrial chilled water systems.

  14. Is anyone regulating naturally occurring radioactive material? A state survey

    SciTech Connect (OSTI)

    Gross, E.M.; Barisas, S.G.

    1993-08-01

    As far as we know, naturally occurring radioactive material (NORM) has surrounded humankind since the beginning of time. However, recent data demonstrating that certain activities concentrate NORM have increased concern regarding its proper handling and disposal and precipitated the development of new NORM-related regulations. The regulation of NORM affects the management of government facilities as well as a broad range of industrial processes. Recognizing that NORM regulation at the federal level is extremely limited, Argonne National Laboratory (ANL) conducted a 50-state survey to determine the extent to which states have assumed the responsibility for regulating NORM as well as the NORM standards that are currently being applied at the state level. Though the survey indicates that NORM regulation comprises a broad spectrum of controls from full licensing requirements to virtually no regulation at afl, a trend is emerging toward recognition of the need for increased regulation of potential NORM hazards, particularly in the absence of federal standards.

  15. U.S. Pellet Industry Analysis

    SciTech Connect (OSTI)

    Corrie I. Nichol; Jacob J. Jacobsen; Richard D. Boardman

    2011-06-01

    This report is a survey of the U.S. Pellet Industry, its current capacity, economic drivers, and projected demand for biomass pellets to meet future energy consumption needs. Energy consumption in the US is projected to require an ever increasing portion of renewable energy sources including biofuels, among which are wood, and agrictulrual biomass. Goals set by federal agencies will drive an ever increasing demand for biomass. The EIA projections estimate that renewable energy produced by 2035 will be roughly 10% of all US energy consumption. Further analysis of the biofuels consumption in the US shows that of the renewable energy sources excluding biofuels, nearly 30% are wood or biomass waste. This equates to roughly 2% of the total energy consumption in the US coming from biomass in 2009, and the projections for 2035 show a strong increase in this amount. As of 2009, biomass energy production equates to roughly 2-2.5 quadrillion Btu. The EIA projections also show coal as providing 21% of energy consumed. If biomass is blended at 20% to co-fire coal plants, this will result in an additional 4 quadrillion Btu of biomass consumption. The EISA goals aim to produce 16 billion gal/year of cellulosic biofuels, and the US military has set goals for biofuels production. The Air Force has proposed to replace 50% of its domestic fuel requirements with alternative fuels from renewable sources by 2016. The Navy has likewise set a goal to provide 50% of its energy requirements from alternative sources. The Department of Energy has set similarly ambitious goals. The DOE goal is to replace 40% of 2004 gasoline use with biofuels. This equates to roughly 60 billion gal/year, of which, 45 billion gal/year would be produced from lignocellulosic resources. This would require 530 million dry tons of herbaceous and woody lignocellulosic biomass per year.

  16. Partnering with Industry to Develop Advanced Biofuels

    Broader source: Energy.gov [DOE]

    Breakout Session IA—Conversion Technologies I: Industrial Perspectives on Pathways to Advanced Biofuels Partnering with Industry to Develop Advanced Biofuels David C. Carroll, President and Chief Executive Officer, Gas Technology Institute

  17. ,"New Mexico Natural Gas Industrial Consumption (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    6:58:31 AM" "Back to Contents","Data 1: New Mexico Natural Gas Industrial Consumption (MMcf)" "Sourcekey","N3035NM2" "Date","New Mexico Natural Gas Industrial Consumption (MMcf)" ...

  18. 2008 Industrial Technologies Market Report, May 2009

    SciTech Connect (OSTI)

    Energetics; DOE

    2009-07-01

    The industrial sector is a critical component of the U.S. economy, providing an array of consumer, transportation, and national defense-related goods we rely on every day. Unlike many other economic sectors, however, the industrial sector must compete globally for raw materials, production, and sales. Though our homes, stores, hospitals, and vehicles are located within our borders, elements of our goods-producing industries could potentially be moved offshore. Keeping U.S. industry competitive is essential to maintaining and growing the U.S. economy. This report begins with an overview of trends in industrial sector energy use. The next section of the report focuses on some of the largest and most energy-intensive industrial subsectors. The report also highlights several emerging technologies that could transform key segments of industry. Finally, the report presents policies, incentives, and drivers that can influence the competitiveness of U.S. industrial firms.

  19. QTR Webinar: Chapter 8- Industry and Manufacturing

    Broader source: Energy.gov [DOE]

    The DOE EERE Advanced Manufacturing Office hosted a QTR webinar to obtain input from Leaders in Academia, Industry, and Government on Chapter 8, Industry and Manufacturing, and the associated Technology Assessments.

  20. ET Industries: Order (2012-SE-2902)

    Broader source: Energy.gov [DOE]

    DOE ordered ET Industries, Inc. to pay a $39,000 civil penalty after finding ET Industries had manufactured and distributed in commerce in the U.S. 974 units of basic model TH-1, a noncompliant showerhead.

  1. Report on Wind Turbine Subsystem Reliability - A Survey of Various Databases (Presentation)

    SciTech Connect (OSTI)

    Sheng, S.

    2013-07-01

    Wind industry has been challenged by premature subsystem/component failures. Various reliability data collection efforts have demonstrated their values in supporting wind turbine reliability and availability research & development and industrial activities. However, most information on these data collection efforts are scattered and not in a centralized place. With the objective of getting updated reliability statistics of wind turbines and/or subsystems so as to benefit future wind reliability and availability activities, this report is put together based on a survey of various reliability databases that are accessible directly or indirectly by NREL. For each database, whenever feasible, a brief description summarizing database population, life span, and data collected is given along with its features & status. Then selective results deemed beneficial to the industry and generated based on the database are highlighted. This report concludes with several observations obtained throughout the survey and several reliability data collection opportunities in the future.

  2. RFQ'S in research and industry

    SciTech Connect (OSTI)

    Staples, J.

    1986-06-01

    The Radio Frequency Quadrupole accelerator (RFQ) has now matured to the point where it has found wide application. Many machines are in use as part of a synchrotron injector chain with others in unique and unusual applications. Several new RFQ's are now under construction or operating since the last survey. They are of various configurations, making use of various techniques of fabrication and field stabilization. Duty factors are being pushed up, new beam dynamics design techniques are to be used and emittance blow up mechanisms are better understood. Finally, RFQ's are moving from the laboratory to the commercial marketplace.

  3. Residential Energy Consumption Survey (RECS) - U.S. Energy Information

    Gasoline and Diesel Fuel Update (EIA)

    Administration (EIA) ‹ Consumption & Efficiency Residential Energy Consumption Survey (RECS) Glossary › FAQS › Overview Data 2009 2005 2001 1997 1993 Previous Analysis & Projections RECS Terminology A B C D E F G H I J K L M N O P Q R S T U V W XYZ A Account Classification: The method in which suppliers of electricity, natural gas, or fuel oil classify and bill their customers. Commonly used account classifications are "Commercial," "Industrial,"

  4. ITP Industrial Materials: Development and Commercialization of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development and Commercialization of Alternative Carbon Fiber Precursors and Conversion Technologies ITP Industrial Materials: Development and Commercialization of Alternative ...

  5. Tuesday Webcasts for Industry | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tuesday Webcasts for Industry Tuesday Webcasts for Industry Learn about AMO's software tools, technologies, partnership opportunities, and other resources by watching the Tuesday Webcasts for Industry. They are held on the first Tuesday of every month from 2:00 to 3:00 p.m. Eastern time and are presented by manufacturers, AMO staff, and industry experts. Register to participate in upcoming Tuesday webcasts by visiting the AMO Events Calendar or Training Calendar. Each entry includes the

  6. Industrial Assessment Centers (IACs) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Assistance » Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Industrial Assessment Centers (IACs) Small- and medium-sized manufacturers may be eligible to receive a no-cost assessment provided by DOE Industrial Assessment Centers (IACs). Teams located at 24 universities around the country conduct the energy audits to identify opportunities to improve productivity, reduce waste, and save energy. IACs typically identify more than $130,000 in potential annual

  7. Industrial Energy Efficiency Basics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Energy Efficiency Basics Industrial Energy Efficiency Basics The industrial sector is vital to the U.S. economy, but at the same time consumes the most energy in the country to manufacture products we use every day. Among the most energy-intensive industries are aluminum, chemicals, forest product, glass, metal casting, mining, petroleum refining, and steel. The energy supply chain begins with electricity, steam, natural gas, coal, and other fuels supplied to a manufacturing plant

  8. Assessment of replicable innovative industrial cogeneration applications

    SciTech Connect (OSTI)

    None, None

    2001-06-01

    This report provides a market assessment of innovative industrial DG cogeneration systems that are less than 1 MWe.

  9. Southeastern Center for Industrial Energy Intensity Reduction...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    equipment manufacturing, and food manufacturing, the industrial ... Existing continuing education resources at the universities target graduating engineering ...

  10. Oregon Industrial Stormwater Discharge Monitoring Report (DEQ...

    Open Energy Info (EERE)

    discharge. Form Type ApplicationNotice Form Topic Industrial Stormwater Discharge Monitoring Report Organization Oregon Department of Environmental Quality Published...

  11. Ashkelon Technological Industries ATI | Open Energy Information

    Open Energy Info (EERE)

    Ashkelon Technological Industries (ATI) Place: Israel Sector: Services Product: General Financial & Legal Services ( Government Public sector ) References: Ashkelon...

  12. University of Delaware | CCEI Industrial Consortium

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CCEI Industrial Consortium & Research Opportunities: CCEI aims to develop long-term relationships with members of industry through its Industrial Members & Sponsors Program. As a multi-institutional research center, it offers a collaborative environment of faculty and expertise that creates opportunities for technology transfer, innovation and information flow. By creating cutting-edge research projects based on the shared interests and needs of our industrial members program, we

  13. Industrial Distributed Energy: Combined Heat & Power

    Broader source: Energy.gov [DOE]

    Information about the Department of Energy’s Industrial Technologies Program and its Combined Heat and Power program.

  14. Salem Electric - Residential, Commercial, and Industrial Efficiency...

    Broader source: Energy.gov (indexed) [DOE]

    Industrial Local Government Nonprofit Residential State Government Federal Government Multifamily Residential Savings Category Clothes Washers RefrigeratorsFreezers Equipment...

  15. Mining Industry Roadmap for Crosscutting Technologies

    SciTech Connect (OSTI)

    none,

    1999-05-01

    Technology roadmaps are envisioned in several areas, and begin with a Mining Industry Roadmap for Crosscutting Technologies.

  16. Borla Performance Industries, Inc. | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Borla Performance Industries, Inc. America's Next Top Energy Innovator Challenge 1830 likes Borla Performance Industries, Inc. Oak Ridge National Laboratory Borla Performance Industries is a 35-year technology leader, manufacturer and marketer of exhaust for the automotive industry, delivering innovative, patented exhaust systems that enhance the performance of internal combustion engines. Borla has an option to license a novel, nano-pore membrane technology from OakRidge National Laboratory.

  17. Academic-Industry Collaboration (AIC) - Synchrophasor Engineering...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Engineering Education Program: Information Exchange Webinar (March 6, 2014) Academic-Industry Collaboration (AIC) - Synchrophasor Engineering Education Program: Information ...

  18. Results of the 2008/2009 Knowledge and Opinions Surveys Conducted for the U.S. Department of Energy Hydrogen Program

    SciTech Connect (OSTI)

    Schmoyer, R. L.; Truett, Tykey; Cooper, Christy; Chew, Andrea

    2010-04-01

    This report presents results of a 2008/2009 survey of hydrogen and fuel cell awareness conducted for the U.S. Department of Energy (DOE). The 2008/2009 survey follows up on a similar DOE survey conducted in 2004, measuring levels of awareness and understanding of hydrogen and fuel cell technologies in four populations: (1) the general public, (2) students, (3) personnel in state and local governments, and (4) potential end users of hydrogen and fuel cell technologies in business and industry. The 2008/2009 survey includes these four groups and adds a fifth group, safety and code officials. The same survey methods were used for both surveys; the 2008/2009 survey report includes a comparison of 2004 and 2008/2009 findings. Information from these surveys will be used to enhance hydrogen and fuel cell education strategies.

  19. China develops natural gas industry

    SciTech Connect (OSTI)

    An, Z.

    1982-09-06

    As of 1981, China was producing some 474.4 billion CF (12.74 billion m/sup 3/)/yr of natural gas from over 60 gas fields, 40 of them in Sichuan Province. The Sichuan gas lies in fractures and solution cavities in limestone and dolomite formations that generally require stimulation. After desulfurization, the gas is used by the steel and chemical industries and for residential heating. Recent discoveries in other areas of China include the Guxinzhuang field in the Bohai-North China basin, where geological conditions favor large gas pools, and the Sebei fields in Qaidam basin, northwest China.

  20. Deregulation-restructuring: Evidence for individual industries

    SciTech Connect (OSTI)

    Costello, K.W.; Graniere, R.J.

    1997-05-01

    Several studies have measured the effects of regulation on a particular industry. These studies range widely in sophistication, from simple observation (comparison) of pre-transformation and post-transformation actual industry performance to econometric analysis that attempt to separate the effects of deregulation from other factors in explaining changes in an industry`s performance. The major problem with observation studies is that they are unable to measure the effect of one particular event, such as deregulation, on an industry`s performance. For example, at the same time that the United Kingdom privatized its electric power industry, it also radically restructured the industry to encourage competition and instituted a price-cap mechanism to regulate the prices of transmission, distribution, and bundled retail services. Subsequent to these changes in 1991, real prices for most UK electricity customers have fallen. It is not certain however, which of these factors was most important or even contributed to the decline in price. In any event, one must be cautious in interpreting the results of studies that attempt to measure the effect of deregulation per se for a specific industry. This report highlights major outcomes for five industries undergoing deregulation or major regulatory and restructuring reforms. These include the natural gas, transportation, UK electric power, financial, and telecommunications industries. Particular attention was given to the historical development of events in the telecommunications industry.

  1. Directory of Tennessee's forest industries 1980

    SciTech Connect (OSTI)

    Not Available

    1980-09-01

    A directory of primary and secondary forest industries is presented. Firm names and addresses are listed by county in alphabetical order. The following information is listed for each industry: type of plant, production and employee size class, products manufactured, and equipment. For the primary industries, the major species of trees used are listed. (MHR)

  2. HIGHLY VARIABLE OBJECTS IN THE PALOMAR-QUEST SURVEY: A BLAZAR...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne ; Baltay, Charles ; Coppi, Paolo ; Ellman, Nancy ; Glikman, Eilat ; ... Ashish ; Williams, Roy, E-mail: anne.bauer@usm.uni-muenchen.d 2 + Show Author ...

  3. Project Chariot - Final Report, Archaeological Survey and Excavations at Ogotoruk Creek, Northwestern Alaska, December 1961

    Office of Legacy Management (LM)

    Only critical information was scanned. Entire document is available upon request Please e-mail lm.records@lm.doe.gov to

  4. Electric industry restructuring in Massachusetts

    SciTech Connect (OSTI)

    Wadsworth, J.W.

    1998-07-01

    A law restructuring the electric utility industry in Massachusetts became effective on November 25, 1997. The law will break up the existing utility monopolies into separate generation, distribution and transmission entities, and it will allow non-utility generators access to the retail end user market. The law contains many compromises aimed at protecting consumers, ensuring savings, protecting employees and protecting the environment. While it appears that the legislation recognizes the sanctity of independent power producer contracts with utilities, it attempts to provide both carrots and sticks to the utilities and the IPP generators to encourage renegotiations and buy-down of the contracts. Waste-to-energy contracts are technically exempted from some of the obligations to remediate. Waste-to-energy facilities are classified as renewable energy sources which may have positive effects on the value to waste-to-energy derived power. On November 25, 1997, the law restructuring the electric utility industry in Massachusetts became effective. The law will have two primary effects: (1) break up the existing utility monopolies into separate generation, distribution and transmission entities, and (2) allow non-utility generators access to the retail end-user market.

  5. Session: Wind industry project development

    SciTech Connect (OSTI)

    Gray, Tom; Enfield, Sam

    2004-09-01

    This first session at the Wind Energy and Birds/Bats workshop consisted of two presentations followed by a question and answer period. The session was intended to provide a general overview of wind energy product development, from the industry's perspective. Tom Gray of AWEA presented a paper titled ''State of the Wind Energy Industry in 2004'', highlighting improved performance and lower cost, efforts to address avian impacts, a status of wind energy in comparison to other energy-producing sources, and ending on expectations for the near future. Sam Enfield of Atlantic Renewable Energy Corporation presented a paper titled ''Key Factors for Consideration in Wind Plant Siting'', highlighting factors that wind facility developers must consider when choosing a site to build wind turbines and associated structures. Factors covered include wind resources available, ownership and land use patterns, access to transmission lines, accessibility and environmental impacts. The question and answer sum mary included topics related to risk taking, research and development, regulatory requirements, and dealing with utilities.

  6. TO: J. R. Novak From: H. J. Moe Industrial Hygiene & Safety

    Office of Legacy Management (LM)

    R. Novak From: H. J. Moe Industrial Hygiene & Safety Industrial Hygiene & S&&y Subject:' Report on Decontamination of Great Lakes Carbon Corporation F0lloui.q Completion of Treat Fuel Fabrication Clean-up operations of Great Lakes Carbon Corporation were started by Reclzunation personnel on ~nday, September 8 end comp~&~ on Friday, September E. An initial soar survey of the bull- prior to the start of the fabrication pmject had indicated alpha activity of O-3 dpm/ft2 and beta

  7. REMS Webinar Survey | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    REMS Webinar Survey REMS Webinar Survey Survey for the inaugural DOE REMS Webinar that was held on Tuesday, March 8, 2016 at 1:00 pm EST. PDF icon REMS Webinar Survey More Documents & Publications Radiation Exposure Monitoring Systems Data Submittal Notification EERE's Usability and Analysis Techniques Guidebook

  8. Sample Employee Survey for Workplace Charging Planning

    Broader source: Energy.gov [DOE]

    Survey to determine employee interest in the benefits of employer installed charging infrastructure for their PEVs.

  9. Supporting industries energy and environmental profile

    SciTech Connect (OSTI)

    None, None

    2005-09-21

    As part of its Industries of the Future strategy, the Industrial Technologies Program within the U.S. Department of Energy’s (DOE) Office of Energy Efficiency and Renewable Energy works with energy-intensive industries to improve efficiency, reduce waste, and increase productivity. These seven Industries of the Future (IOFs) – aluminum, chemicals, forest products, glass, metal casting, mining, and steel – rely on several other so-called “supporting industries” to supply materials and processes necessary to the products that the IOFs create. The supporting industries, in many cases, also provide great opportunities for realizing energy efficiency gains in IOF processes.

  10. Glass needs for a growing photovoltaics industry

    SciTech Connect (OSTI)

    Burrows, Keith; Fthenakis, Vasilis

    2014-10-18

    With the projected growth in photovoltaics, the demand for glass for the solar industry will far exceed the current supply, and thousands of new float-glass plants will have to be built to meet its needs over the next 20 years. Such expansion will provide an opportunity for the solar industry to obtain products better suited to their needs, such as low-iron glass and borosilicate glass at the lowest possible price. While there are no significant technological hurdles that would prevent the flat glass industry from meeting the solar industrys projected needs, to do so will require advance planning and substantial investments.

  11. Technology transfer in the petrochemical industry

    SciTech Connect (OSTI)

    Tanaka, M.

    1994-01-01

    The paper deals with the development of the Japanese petrochemical industry from the 1950s through the 1960s solely from the standpoint of the process of technology transplantation. The Japanese petrochemical industry in this period is interesting as it relates to technology transfer to Japan because: (1) It was an industry at the core of the heavy and chemical industries, which were an important pillar of Japan's industrial policy; (2) It was a new technical field with no past history; and (3) Unraveling of technology was successfully pursued, with the result that Japan became a petrochemical technology-exporting country in the 1960s.

  12. Glass needs for a growing photovoltaics industry

    SciTech Connect (OSTI)

    Burrows, Keith; Fthenakis, Vasilis

    2015-01-01

    With the projected growth in photovoltaics, the demand for glass for the solar industry will far exceed the current supply, and thousands of new float-glass plants will have to be built to meet its needs over the next 20 years. Such expansion will provide an opportunity for the solar industry to obtain products better suited to their needs, such as low-iron glass and borosilicate glass at the lowest possible price. While there are no significant technological hurdles that would prevent the flat glass industry from meeting the solar industrys projected needs, to do so will require advance planning and substantial investments.

  13. HTGR Industrial Application Functional and Operational Requirements

    SciTech Connect (OSTI)

    L. E. Demick

    2010-08-01

    This document specifies the functional and performance requirements to be used in the development of the conceptual design of a high temperature gas-cooled reactor (HTGR) based plant supplying energy to a typical industrial facility. These requirements were developed from collaboration with industry and HTGR suppliers over the preceding three years to identify the energy needs of industrial processes for which the HTGR technology is technically and economically viable. The functional and performance requirements specified herein are an effective representation of the industrial sector energy needs and an effective basis for developing a conceptual design of the plant that will serve the broadest range of industrial applications.

  14. Residential Energy Consumption Survey: Quality Profile

    SciTech Connect (OSTI)

    1996-03-01

    The Residential Energy Consumption Survey (RECS) is a periodic national survey that provides timely information about energy consumption and expenditures of U.S. households and about energy-related characteristics of housing units. The survey was first conducted in 1978 as the National Interim Energy Consumption Survey (NIECS), and the 1979 survey was called the Household Screener Survey. From 1980 through 1982 RECS was conducted annually. The next RECS was fielded in 1984, and since then, the survey has been undertaken at 3-year intervals. The most recent RECS was conducted in 1993.

  15. Determination of Thermoelectric Module Efficiency A Survey

    SciTech Connect (OSTI)

    Wang, Hsin; McCarty, Robin; Salvador, James R.; Yamamoto, Atsushi; Konig, Jan

    2014-01-01

    The development of thermoelectrics (TE) for energy conversion is in the transition phase from laboratory research to device development. There is an increasing demand to accurately determine the module efficiency, especially for the power generation mode. For many thermoelectrics, the figure of merit, ZT, of the material sometimes cannot be fully realized at the device level. Reliable efficiency testing of thermoelectric modules is important to assess the device ZT and provide the end-users with realistic values on how much power can be generated under specific conditions. We conducted a general survey of efficiency testing devices and their performance. The results indicated the lack of industry standards and test procedures. This study included a commercial test system and several laboratory systems. Most systems are based on the heat flow meter method and some are based on the Harman method. They are usually reproducible in evaluating thermoelectric modules. However, cross-checking among different systems often showed large errors that are likely caused by unaccounted heat loss and thermal resistance. Efficiency testing is an important area for the thermoelectric community to focus on. A follow-up international standardization effort is planned.

  16. Office of Industrial Technologies research in progress

    SciTech Connect (OSTI)

    Not Available

    1993-05-01

    The US Department of Energy (DOE) Office of Industrial Technologies (OIT) conducts research and development activities which focus on improving energy efficiency and providing for fuel flexibility within US industry in the area of industrial conservation. The mission of OIT is to increase the utilization of existing energy-efficient equipment and to find and promote new, cost-effective ways for industrial facilities to improve their energy efficiency and minimize waste products. To ensure advancement of the technological leadership of the United States and to improve the competitiveness of American industrial products in world markets, OIT works closely with industrial partners, the staffs of the national laboratories, and universities to identify research and development needs and to solve technological challenges. This report contains summaries of the currently active projects supported by the Office of Industrial Technologies.

  17. Facility Approvals, Security Surveys, and Nuclear Materials Surveys

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1992-09-15

    To establish Department of Energy (DOE) requirements for granting facility approvals prior to permitting safeguards and security interests on the premises and the conduct of insite security and/or nuclear material surveys of facilities with safeguards and security interests. Cancels DOE 5634.1A. Canceled by DOE O 470.1 dated 9-28-95.

  18. Facility Approvals, Security Surveys, and Nuclear Materials Surveys

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1988-02-03

    To establish the Department of Energy (DOE) requirements for granting facility approvals prior to permitting safeguards and security interests on the premises and the conduct of on-site security and/or nuclear material surveys of facilities with safeguards and security interests. Cancels DOE O 5630.7 and DOE O 5634.1. Canceled by DOE 5634.1B.

  19. 2001 FEMP Customer Survey Appendices

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appendices A Report Prepared for the US Department of Energy February 2002 By TecMRKT Works and Sandia National Laboratories TecMRKT Works Nicholas P. Hall John H. Reed Ph.D Thomas P. Talerico Jeff Riggert Andrew Oh And Sandia National Laboratories Gretchen Jordan FEMP Customer Survey Appendices Table of Contents Table of Contents TABLE OF CONTENTS I LIST OF FIGURES II LIST OF TABLES III APPENDIX A: SURVEY INSTRUMENT 1 APPENDIX B: DETAILED REPONSES 42 1. Participant and Nonparticipant Profiles

  20. NERSC-8 Vendor Market Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NERSC-8 Project Lead NERSC-8 Market Survey --- 1 --- November 15, 2012 * Seek v endor i nput t o o p6mize 6 ming, r equirements and business prac6ces * Opportunity f or v endors t o p rovide i nput p rior t o formal p rocurement p rocess We are starting our next procurement, NERSC-8, with a round of market surveys Vendor B riefing --- 2 --- NERSC's mission is to enable science NERSC Mission: To accelerate the pace of scientific discovery by providing high-performance computing, data systems and

  1. Federal Employee Viewpoint Survey | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Policy and Guidance » Human Capital Management » Federal Employee Viewpoint Survey Federal Employee Viewpoint Survey The Federal Employee Viewpoint Survey (FedView survey) is a tool that measures employees' perceptions of whether, and to what extent, conditions characterizing successful organizations are present in their agencies. Survey results provide valuable insight into the challenges agency leaders face in ensuring the Federal Government has an effective civilian workforce and how well

  2. Humboldt Industrial Park Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    Industrial Park Wind Farm Jump to: navigation, search Name Humboldt Industrial Park Wind Farm Facility Humboldt Industrial Park Sector Wind energy Facility Type Community Wind...

  3. Implementing an Industrial Energy Efficiency Program in Minnesota...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Implementing an Industrial Energy Efficiency Program in Minnesota Implementing an Industrial Energy Efficiency Program in Minnesota Map highlighting Minnesota In 2008, industry in ...

  4. Guidelines for Estimating Unmetered Industrial Water Use | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Water Use Guidelines for Estimating Unmetered Industrial Water Use Document describes a systematic approach to estimate industrial water use in evaporative cooling ...

  5. Industrial Ratepayer-Funded SEP Toolkit | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Superior Energy Performance Industrial Ratepayer-Funded SEP Toolkit Industrial Ratepayer-Funded SEP Toolkit The Industrial Superior Energy Performance (SEP(tm)) Accelerator is ...

  6. Oregon Department of Geology and Mineral Industries | Open Energy...

    Open Energy Info (EERE)

    Geology and Mineral Industries Jump to: navigation, search Logo: Oregon Department of Geology and Mineral Industries Name: Oregon Department of Geology and Mineral Industries...

  7. ITP Chemicals: Chemical Industry of the Future: New Biocatalysts...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Chemical Industry of the Future: New Biocatalysts: Essential Tools for a Sustainable 21st Century Chemical Industry ITP Chemicals: Chemical Industry of the Future: New ...

  8. Energy Use in Industry - Energy Explained, Your Guide To Understanding...

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Energy Use by Type of Industry, 2006: Petroleum Refining 32%, Chemical 24%, Paper 11%, ... is the largest industrial consumer of energy, followed closely by the chemical industry. ...

  9. Colorado Solar Energy Industries Association | Open Energy Information

    Open Energy Info (EERE)

    Industries Association Jump to: navigation, search Logo: Colorado Solar Energy Industries Association Name: Colorado Solar Energy Industries Association Address: 841 Front St....

  10. ITP Petroleum Refining: Profile of the Petroleum Refining Industry...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Profile of the Petroleum Refining Industry in California: California Industries of the Future Program ITP Petroleum Refining: Profile of the Petroleum Refining Industry in ...

  11. China and India Industrial Efficiency NREL Partnership | Open...

    Open Energy Info (EERE)

    Industrial Efficiency NREL Partnership Jump to: navigation, search Logo: China-NREL Industrial Efficiency Partnership Name China-NREL Industrial Efficiency Partnership Agency...

  12. Industrial Assessment Centers (IAC) Update -- July 2015 | Department...

    Office of Environmental Management (EM)

    Industrial Assessment Centers (IAC) Update -- July 2015 Industrial Assessment Centers (IAC) Update -- July 2015 Read the Industrial Assessment Centers (IAC) Update -- July 2015...

  13. Industry Outreach and Coalition Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry Outreach and Coalition Resources Industry Outreach and Coalition Resources Involving the industrial sector in energy efficiency programs can assist jurisdictions in ...

  14. ITP Industrial Distributed Energy: Combustion Turbine CHP System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDUSTRIAL TECHNOLOGIES PROGRAM Combustion Turbine CHP System for Food Processing Industry Reducing Industry's Environmental Footprint and Easing Transmission Congestion Based at a...

  15. LARGE INDUSTRIAL FACILITIES BY STATE | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LARGE INDUSTRIAL FACILITIES BY STATE LARGE INDUSTRIAL FACILITIES BY STATE PDF icon Number of Large Energy User Manufacturing Facilities by Sector and State (with Industrial Energy...

  16. Texas Renewable Energy Industries Association | Open Energy Informatio...

    Open Energy Info (EERE)

    Renewable Energy Industries Association Jump to: navigation, search Logo: Texas Renewable Energy Industries Association Name: Texas Renewable Energy Industries Association Address:...

  17. 2014 Average Monthly Bill- Industrial

    U.S. Energy Information Administration (EIA) Indexed Site

    Industrial (Data from forms EIA-861- schedules 4A-D, EIA-861S and EIA-861U) State Number of Customers Average Monthly Consumption (kWh) Average Price (cents/kWh) Average Monthly Bill (Dollar and cents) New England 28,017 56,833 11.84 6,730.30 Connecticut 4,648 63,016 12.92 8,138.94 Maine 3,023 92,554 8.95 8,281.27 Massachusetts 14,896 44,536 12.74 5,674.13 New Hampshire 3,342 49,099 11.93 5,857.27 Rhode Island 1,884 39,241 12.86 5,047.36 Vermont 224 527,528 10.23 53,984.67 Middle Atlantic 44,397

  18. RADIOACTIVE-AIRBORNE-CONTAMINATION-SURVEY.pdf

    Energy Savers [EERE]

    Season? | Department of Energy Question of the Week: What Are You Doing to Save Energy this Holiday Season? Question of the Week: What Are You Doing to Save Energy this Holiday Season? December 4, 2008 - 1:31pm Addthis On Tuesday, we gave you some tips to save energy during the holidays. What are you doing to save energy this holiday season? E-mail your responses to the Energy Saver team at consumer.webmaster@nrel.gov. Addthis Related Articles Question of the Week: What Is Your Main Form of

  19. Hazards Survey and Hazards Assessments

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-08-21

    This volume is to assist DOE Operations/Field Offices and operating contractors in complying with the DOE O 151.1 requirement that Hazards Surveys and facility-specific Hazards Assessments be prepared, maintained, and used for emergency planning purposes. Canceled by DOE G 151.1-2.

  20. Research and development in the textile industry

    SciTech Connect (OSTI)

    1987-06-01

    Included in the portfolio of IP's projects are the R and D activities for several advanced technologies targeted at the textile industry, one of the top ten energy intensive industries in the country. These R and D projects have primarily been aimed at improving the energy efficiency and productivity of textile production processes. Many projects in this area have been successfully completed, and some have resulted in the development and implementation of new technologies (e.g., foam processing) for various process steps. Other projects have produced technical results that have later been utilized by the industry in other capacities (e.g., hyperfiltration). Several projects at various stages of development are currently underway. This brochure describes the Office of Industrial Programs' R and D activities relevant to the textile industry. The brochure is comprised of the following: Industry Update, Energy Consumption in the Textile Industry, Energy Consumption in the Textile Industry, Potential Energy Savings in the Textile Industry, Office of Industrial Programs, R and D Efforts, and R and D Data Base.

  1. Industrial ecology Prosperity Game{trademark}

    SciTech Connect (OSTI)

    Beck, D.; Boyack, K.; Berman, M.

    1998-03-01

    Industrial ecology (IE) is an emerging scientific field that views industrial activities and the environment as an interactive whole. The IE approach simultaneously optimizes activities with respect to cost, performance, and environmental impact. Industrial Ecology provides a dynamic systems-based framework that enables management of human activity on a sustainable basis by: minimizing energy and materials usage; insuring acceptable quality of life for people; minimizing the ecological impact of human activity to levels that natural systems can sustain; and maintaining the economic viability of systems for industry, trade and commerce. Industrial ecology applies systems science to industrial systems, defining the system boundary to incorporate the natural world. Its overall goal is to optimize industrial activities within the constraints imposed by ecological viability, globally and locally. In this context, Industrial systems applies not just to private sector manufacturing and services but also to government operations, including provision of infrastructure. Sandia conducted its seventeenth Prosperity Game{trademark} on May 23--25, 1997, at the Hyatt Dulles Hotel in Herndon, Virginia. The primary sponsors of the event were Sandia National Laboratories and Los Alamos National Laboratory, who were interested in using the format of a Prosperity Game to address some of the issues surrounding Industrial Ecology. Honorary game sponsors were: The National Science Foundation; the Committee on Environmental Improvement, American Chemical Society; the Industrial and Engineering Chemistry Division, American Chemical Society; the US EPA--The Smart Growth Network, Office of Policy Development; and the US DOE-Center of Excellence for Sustainable Development.

  2. Reconnaissance survey of eight bays in Puget Sound

    SciTech Connect (OSTI)

    Strand, J.A.; Crecelius, E.A.; Pearson, W.H.; Fellingham, G.W.; Elston, R.E.

    1988-03-01

    From 1983 to 1985, Battelle/Marine Research Laboratory conducted reconnaissance-level field and laboratory studies to better characterize toxic contamination problems occurring in selected urban-industrialized bays (Bellingham Bay, Port Gardner - Everett Harbor, Fourmile Rock - Elliot Bay dump site vicinity, Sinclair Inlet) of Puget Sound. It was envisioned that this goal was best achieved by simultaneously determining levels of contamination in selected baseline or 'reference bays' (Samish Bay, Case Inlet, Dabob Bay, Sequim Bay). Two major tasks composed this effort. The first was conducted in 1983 and consisted of preliminary or screening surveys to collect and analyze sediment samples from 101 stations distributed in the four urban-industrialized bays (Figure 1), and at 80 stations distributed in the four baseline bays (Figure 2). The second task was undertaken in 1984 and involved detailed surveys and analyses of the same bays, but at a limited number of stations (32 in urban embayments, 16 in baseline bays). The stations to be resampled in 1984 were the ''cleanest'' of the clean and the ''dirtiest'' of the dirty as determined by the 1983 sediment chemical analyses, and within restrictions imposed by sediment type.

  3. Survey and analysis of materials research and development at selected federal laboratories

    SciTech Connect (OSTI)

    Reed, J.E.; Fink, C.R.

    1984-04-01

    This document presents the results of an effort to transfer existing, but relatively unknown, materials R and D from selected federal laboratories to industry. More specifically, recent materials-related work at seven federal laboratories potentially applicable to improving process energy efficiency and overall productiviy in six energy-intensive manufacturing industries was evaluated, catalogued, and distributed to industry representatives to gauge their reaction. Laboratories surveyed include: Air Force Wright Aeronautical Laboratories Material Laboratory (AFWAL). Pacific Northwest Laboratory (PNL), National Aeronautics and Space Administration Marshall Flight Center (NASA Marshall), Oak Ridge National Laboratory (ORNL), Brookhaven National Laboratory (BNL), Idaho National Engineering Laboratory (INEL), and Jet Propulsion Laboratory (JPL). Industries included in the effort are: aluminum, cement, paper and allied products, petroleum, steel and textiles.

  4. Industry, academic collaborators push for energy solutions |...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Attendees at the meeting included representatives of the six current E-ffiliates member companies: Dupont, Lockheed Martin, PSEG, Southern Company, Archewild and Power Survey ...

  5. Energy efficient industrialized housing research program

    SciTech Connect (OSTI)

    Berg, R.; Brown, G.Z.; Finrow, J.; Kellett, R.; McDonald, M.; McGinn, B.; Ryan, P.; Sekiguchi, Tomoko . Center for Housing Innovation); Chandra, S.; Elshennawy, A.K.; Fairey, P.; Harrison, J.; Mazwell, L.; Roland, J.; Swart, W. )

    1989-12-01

    This document describes the research work completed in five areas in fiscal year 1989. (1) The analysis of the US industrialized housing industry includes statistics, definitions, a case study, and a code analysis. (2) The assessment of foreign technology reviews the current status of design, manufacturing, marketing, and installation of industrialized housing primarily in Sweden and Japan. (3) Assessment of industrialization applications reviews housing production by climate zone, has a cost and energy comparison of Swedish and US housing, and discusses future manufacturing processes and emerging components. (4) The state of computer use in the industry is described and a prototype design tool is discussed. (5) Side by side testing of industrialized housing systems is discussed.

  6. United States Industrial Sector Energy End Use Analysis

    SciTech Connect (OSTI)

    Shehabi, Arman; Morrow, William R.; Masanet, Eric

    2012-05-11

    The United States Department of Energys (DOE) Energy Information Administration (EIA) conducts the Manufacturing Energy Consumption Survey (MECS) to provide detailed data on energy consumption in the manufacturing sector. The survey is a sample of approximately 15,000 manufacturing establishments selected from the Economic Census - Manufacturing Sector. MECS provides statistics on the consumption of energy by end uses (e.g., boilers, process, electric drives, etc.) disaggregated by North American Industry Classification System (NAICS) categories. The manufacturing sector (NAICS Sector 31-33) consists of all manufacturing establishments in the 50 States and the District of Columbia. According to the NAICS, the manufacturing sector comprises establishments engaged in the mechanical, physical, or chemical transformation of materials, substances, or components into new products. The establishments are physical facilities such as plants, factories, or mills. For many of the sectors in the MECS datasets, information is missing because the reported energy use is less than 0.5 units or BTUs, or is withheld to avoid disclosing data for individual establishments, or is withheld because the standard error is greater than 50%. We infer what the missing information likely are using several approximations techniques. First, much of the missing data can be easily calculated by adding or subtracting other values reported by MECS. If this is not possible (e.g. two data are missing), we look at historic MECS reports to help identify the breakdown of energy use in the past and assume it remained the same for the current MECS. Lastly, if historic data is also missing, we assume that 3 digit NAICS classifications predict energy use in their 4, 5, or 6 digit NAICS sub-classifications, or vice versa. Along with addressing data gaps, end use energy is disaggregated beyond the specified MECS allocations using additional industry specific energy consumption data. The result is a completed table of energy end use by sector with mechanical drives broken down by pumps, fans, compressed air, and drives.

  7. NERSC Seeks Industry Partners for Collaborative Research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Seeks Industry Partners for Collaborative Research NERSC Seeks Industry Partners for Collaborative Research January 28, 2015 Contact: David Skinner, NERSC Strategic Partnerships Lead, deskinner@lbl.gov, 510-486-4748 Edison7 The National Energy Research Scientific Computing Center (NERSC) at Lawrence Berkeley National Laboratory has launched a private sector partnership program (PSP) to make its computing capabilities available to industry partners working in key technology areas. Led by David

  8. Forest Products Industry Profile | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Forest Products Industry Profile Forest Products Industry Profile Wood and paper products meet the everyday needs of consumers and businesses. They provide materials essential for communication, education, packaging, construction, shelter, sanitation, and protection. The U.S. forest products industry is based on a renewable and sustainable raw material: wood. It practices recovery and recycling in its operations. Its forests help the global carbon balance by taking up carbon dioxide from the

  9. Energy efficient industrialized housing research program

    SciTech Connect (OSTI)

    Berg, R.; Brown, G.Z.; Finrow, J.; Kellett, R.; Mc Donald, M.; McGinn, B.; Ryan, P.; Sekiguchi, T. . Center for Housing Innovation); Chandra, S.; Elshennawy, A.K.; Fairey, P.; Harrison, J.; Maxwell, L.; Roland, J.; Swart, W. )

    1989-01-01

    This is the second volume of a two volume report on energy efficient industrialized housing. Volume II contains support documentation for Volume I. The following items are included: individual trip reports; software bibliography; industry contacts in the US, Denmark, and Japan; Cost comparison of industrialized housing in the US and Denmark; draft of the final report on the systems analysis for Fleetwood Mobile Home Manufacturers. (SM)

  10. INDUSTRIAL ASSESSMENT CENTERS IAC Quarterly Update

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Summer 2015 INDUSTRIAL ASSESSMENT CENTERS IAC Quarterly Update Spring 2014 INDUSTRIAL ASSESSMENT CENTERS The IAC Update, Summer 2015 About the IAC Program Beginning in 1976, the Industrial Assessment Centers (IACs) have provided small and medium-sized manufacturers with site- specific recommendations for improving energy efficiency, reducing waste, and increasing productivity through changes in processes and equipment. A typical IAC client will receive recommendations that save more than

  11. Design for energy efficiency: Energy efficient industrialized housing research program. Progress report

    SciTech Connect (OSTI)

    Kellett, R.; Berg, R.; Paz, A.; Brown, G.Z.

    1991-03-01

    Since 1989, the U.S. Department of Energy has sponsored the Energy Efficient Industrialized Housing research program (EEIH) to improve the energy efficiency of industrialized housing. Two research centers share responsibility for this program: The Center for Housing Innovation at the University of Oregon and the Florida Solar Energy Center, a research institute of the University of Central Florida. Additional funding is provided through the participation of private industry, state governments and utilities. The program is guided by a steering committee comprised of industry and government representatives. This report summarizes Fiscal Year (FY) 1990 activities and progress, and proposed activities for FY 1991 in Task 2.1 Design for Energy Efficiency. This task establishes a vision of energy conservation opportunities in critical regions, market segments, climate zones and manufacturing strategies significant to industrialized housing in the 21st Century. In early FY 1990, four problem statements were developed to define future housing demand scenarios inclusive of issues of energy efficiency, housing design and manufacturing. Literature surveys were completed to assess seven areas of influence for industrialized housing and energy conservation in the future. Fifty-five future trends were identified in computing and design process; manufacturing process; construction materials, components and systems; energy and environment; demographic context; economic context; and planning policy and regulatory context.

  12. Hydro and geothermal electricity as an alternative for industrial petroleum consumption in Costa Rica

    SciTech Connect (OSTI)

    Mendis, M.; Park, W.; Sabadell, A.; Talib, A.

    1982-04-01

    This report assesses the potential for substitution of electricity for petroleum in the industrial/agro-industrial sector of Costa Rica. The study includes a preliminary estimate of the process energy needs in this sector, a survey of the principal petroleum consuming industries in Costa Rica, an assessment of the electrical technologies appropriate for substitution, and an analysis of the cost trade offs of alternative fuels and technologies. The report summarizes the total substitution potential both by technical feasibility and by cost effectiveness under varying fuel price scenarios and identifies major institutional constraints to the introduction of electric based technologies. Recommendations to the Government of Costa Rica are presented. The key to the success of a Costa Rican program for substitution of electricity for petroleum in industry rests in energy pricing policy. The report shows that if Costa Rica Bunker C prices are increased to compare equitably with Caribbean Bunker C prices, and increase at 3 percent per annum relative to a special industrial electricity rate structure, the entire substitution program, including both industrial and national electric investment, would be cost effective. The definition of these pricing structures and their potential impacts need to be assessed in depth.

  13. Review of U.S. ESCO industry market trends: An empirical analysis of project data

    SciTech Connect (OSTI)

    Goldman, Charles A.; Hopper, Nicole C.; Osborn, Julie G.; Singer, Terry E.

    2003-03-01

    This article summarizes a comprehensive empirical analysis of U.S. Energy Service Company (ESCO) industry trends and performance. We employ two parallel analytical approaches: a comprehensive survey of firms to estimate total industry size and a database of {approx}1500 ESCO projects, from which we report target markets and typical project characteristics, energy savings and customer economics. We estimate that industry investment for energy-efficiency related services reached US $2 billion in 2000 following a decade of strong growth. ESCO activity is concentrated in states with high economic activity and strong policy support. Typical projects save 150-200 MJ/m2/year and are cost-effective with median benefit/cost ratios of 1.6 and 2.1 for institutional and private sector projects. The median simple payback time is 7 years among institutional customers; 3 years is typical in the private sector. Reliance on DSM incentives has decreased since 1995. Preliminary evidence suggests that state enabling policies have boosted the industry in medium-sized states. ESCOs have proven resilient in the face of restructuring and will probably shift toward selling ''energy solutions,'' with energy efficiency part of a package. We conclude that a private sector energy-efficiency services industry that targets large commercial and industrial customers is viable and self-sustaining with appropriate policy support both financial and non-financial.

  14. Opportunity Analysis for Recovering Energy from Industrial Waste Heat and Emissions

    SciTech Connect (OSTI)

    Viswanathan, Vish V.; Davies, Richard W.; Holbery, Jim D.

    2006-04-01

    United States industry consumed 32.5 Quads (34,300 PJ) of energy during 2003, which was 33.1% of total U.S. energy consumption (EIA 2003 Annual Energy Review). The U.S. industrial complex yields valuable goods and products. Through its manufacturing processes as well as its abundant energy consumption, it supports a multi-trillion dollar contribution to the gross domestic product and provides millions of jobs in the U.S. each year. Industry also yields waste products directly through its manufacturing processes and indirectly through its energy consumption. These waste products come in two forms, chemical and thermal. Both forms of waste have residual energy values that are not routinely recovered. Recovering and reusing these waste products may represent a significant opportunity to improve the energy efficiency of the U.S. industrial complex. This report was prepared for the U.S. Department of Energy Industrial Technologies Program (DOE-ITP). It analyzes the opportunity to recover chemical emissions and thermal emissions from U.S. industry. It also analyzes the barriers and pathways to more effectively capitalize on these opportunities. A primary part of this analysis was to characterize the quantity and energy value of the emissions. For example, in 2001, the industrial sector emitted 19% of the U.S. greenhouse gases (GHG) through its industrial processes and emitted 11% of GHG through electricity purchased from off-site utilities. Therefore, industry (not including agriculture) was directly and indirectly responsible for emitting 30% of the U.S. GHG. These emissions were mainly comprised of carbon dioxide (CO2), but also contained a wide-variety of CH4 (methane), CO (carbon monoxide), H2 (hydrogen), NMVOC (non-methane volatile organic compound), and other chemicals. As part of this study, we conducted a survey of publicly available literature to determine the amount of energy embedded in the emissions and to identify technology opportunities to capture and reuse this energy. As shown in Table E-1, non-CO2 GHG emissions from U.S. industry were identified as having 2180 peta joules (PJ) or 2 Quads (quadrillion Btu) of residual chemical fuel value. Since landfills are not traditionally considered industrial organizations, the industry component of these emissions had a value of 1480 PJ or 1.4 Quads. This represents approximately 4.3% of the total energy used in the United States Industry.

  15. PRAJ Industries Ltd | Open Energy Information

    Open Energy Info (EERE)

    molasses based distillery technology, plant and equipment for alcohol, fuel ethanol and beer production. References: PRAJ Industries Ltd1 This article is a stub. You can help...

  16. About Industrial Technical Assistance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Goals and Accomplishments Industrial Technical Assistance Goals: iv Reduce manufacturing energy intensity by 25% over 10 years. Support the deployment of 40 GW of new, ...

  17. Industrial Customer Perspectives on Utility Energy Efficiency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Customer Perspectives on Utility Energy Efficiency Programs Industrial Customer Perspectives on Utility Energy Efficiency Programs These presentations from ATK Aerospace Systems, ...

  18. Grand Challenge Portfolio: Driving Innovations in Industrial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9 Grand Challenge Portfolio: Driving Innovations in Industrial Energy Efficiency, January 2011 - pg 9 PDF icon grandchallengesportfoliopg9.pdf More Documents & Publications ...

  19. Grand Challenge Portfolio: Driving Innovations in Industrial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 Grand Challenge Portfolio: Driving Innovations in Industrial Energy Efficiency, January 2011 - pg 8 PDF icon grandchallengesportfoliopg8.pdf More Documents & Publications ...

  20. Industrial Energy Efficiency Projects Improve Competitiveness...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency Projects Improve Competitiveness and Protect Jobs Industrial Energy Efficiency Projects Improve Competitiveness and Protect Jobs U.S. Department of Energy (DOE) ...