National Library of Energy BETA

Sample records for hot docs news

  1. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG:

  2. Microsoft Word - NMMSS News OCT 15 08 Update.doc

    National Nuclear Security Administration (NNSA)

    news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS October 15, 2008 SPECIAL EDITION The Department of Energy and Nuclear Regulatory Commission are pleased to inform the User Community that the transition of the NMMSS database to the Savannah River Site has been completed. On Monday, October 6, 2008, the NMMSS database was determined to be fully functioning. In addition, all of the following methods of transmitting data to NMMSS are operational as of October 6, 2008: Methods of Data Submittal

  3. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News News Isotopes produced at Los Alamos National Laboratory are saving lives, advancing cutting-edge research and keeping the U.S. safe. News Physicist wins early-career award for isotope work Tri-Lab Effort addresses the need for actinium-225 (pdf) 1663 article highlights the role of Ac-225 for "nuclear war on cancer" "Groundbreaking" Los Alamos Research Uses Nuclear Technology To Fight Cancer The Isotope Production Facility on Jeopardy Hot cells for medical isotopes

  4. NEWS | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  5. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Sandia National Laboratories Experts Co-Author DOE Reports on Grid Integration and Concentrating Solar Power Concentrating Solar Power, Energy, News, Photovoltaic, Publications, ...

  6. News

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    utility bills due to increased lighting use. The good news is-even with that extra light-your energy bill can still be reasonable, thanks to efficiency standards the Energy...

  7. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Secure and Sustainable Energy Future Mission/News News Tara Camacho-Lopez 2015-11-06T20:24:53+00:00 Sign up to receive our Energy & Climate e-newsletter Email Updates To sign up for updates or to access your subscriber preferences, please enter your contact information below. Subscription Type Email SMS/Text Message Required Wireless Number 1 (US) 1 Required Email Address Submit CRF_climatechange Permalink Gallery Understanding Hazardous Combustion Byproducts Reduces Factors Impacting

  8. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Secure and Sustainable Energy Future Mission/News News Tara Camacho-Lopez 2015-11-06T20:24:53+00:00 Sign up to receive our Energy & Climate e-newsletter Email Updates To sign up for updates or to access your subscriber preferences, please enter your contact information below. Subscription Type Email SMS/Text Message Required Wireless Number 1 (US) 1 Required Email Address Submit WP16logo_small Permalink Gallery Sandia highlighted at the 2016 American Wind Energy Association (AWEA)

  9. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Secure and Sustainable Energy Future Mission/News News Tara Camacho-Lopez 2015-11-06T20:24:53+00:00 Sign up to receive our Energy & Climate e-newsletter Email Updates To sign up for updates or to access your subscriber preferences, please enter your contact information below. Subscription Type Email SMS/Text Message Required Wireless Number 1 (US) 1 Required Email Address Submit Jackie Chen talking Permalink Gallery Jackie Chen to give keynote address at ISC High performance conference in

  10. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Uses Nuclear Technology To Fight Cancer The Isotope Production Facility on Jeopardy Hot cells for medical isotopes Jonathan Engle Wins Postdoc Award Matthew Gott to ...

  11. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nanofabrication and Nanomaterials Facility in News 2nd Else Kröner-Fresenius Symposium LSU Engineering Leads Effort to Find Clean Energy Energy Frontier center arrives at LSU DOE to Establish $12.5 Million Energy Frontier Research Center at LSU 1st National Academies Keck Futures Initiative Complex Systems Conference 1st Unither Conference on Future Biomedical Techologies LSU Professors Work to Improve Efficiency of Ethanol Fuel Nano 50TM Awards: The Nano 50TM Awards, presented by Nanotech

  12. News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CAMD News LSU Researcher discovers a key step in photosynthesis at CAMD, earns cover on Journal of Biological Chemistry nanowerk article features CAMD's EFRC research Impact of Deepwater Horizon Oil Spill Evaluated at CAMD Dr. Challa Kumar builds "Millifluidic Catalyst Test Kit" MBP Cancer Center Receives Contract for Radiation Therapy (pdf) CAMD articles in the Baton Rouge Advocate EFRC and CAMD featured in Chemistry World (pdf) Mezzo Receives Indy Award (pdf) LSU Daily Reveille CAMD

  13. News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases News Releases We are your source for reliable, up-to-date news and information; our scientists and engineers can provide technical insights on our innovations for a secure nation. News Releases - 2016» News Releases - 2015» News Releases - 2014» News Releases - 2013» News Releases - 2012» News Releases - 2011» News Releases - 2010» News Releases - 2009» News Releases - 2008» The thermal traits of a leaf, critical for photosynthesis, may be under strong evolutionary selection

  14. EERE News

    Broader source: [DOE]

    The EERE News section includes current news releases, EERE Network News, EERE’s bi-monthly magazine Amped Up!, resources for media, and subscription information.

  15. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  16. NREL: Geothermal Technologies - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geothermal News Below are news stories involving geothermal research. May 16, 2016 NREL Helping the Bureau of Land Management Dive Further into Hot Water Geothermal program boosted by greater access to data. March 10, 2016 NREL's Geothermal Experts Present at the 41st Annual Stanford Geothermal Workshop NREL geothermal experts attend the 41st Annual Stanford Geothermal Workshop--one of the world's longest-running technical meetings on the topic of geothermal energy. March 2, 2016 U.S. Bureau of

  17. WINDExchange: News

    Wind Powering America (EERE)

    News This page lists all of the news referenced on the WINDExchange website. Also follow WINDExchange news by subscribing to the newsletter or through an RSS Feed WINDExchange initiative News RSS Feed . Learn about RSS Feeds. Search the WINDExchange Database Choose a Subject Category All Agricultural Public Power Schools Small Wind Economic Development Policy Start Search Clear Search Filtered by: News Date State Program Area Title 9/2/2016 RI Suzanne Tegen Discusses U.S. Offshore Wind on

  18. Microsoft Word - NMMSS News JULY 2015.doc

    National Nuclear Security Administration (NNSA)

    Annual Users Training Meeting, which is scheduled to be held May 23-26, 2016, in Philadelphia, Pennsylvania. Registration and preliminary agenda information about the 2016...

  19. ARM - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Related Links CARES Home AAF Home ARM Data Discovery Browse Data Post-Campaign Data Sets Field Updates CARES Wiki Campaign Images Experiment Planning Proposal Abstract and Related Campaigns Science Plan Operations Plan Measurements Forecasts News News & Press Backgrounder (PDF, 1.45MB) G-1 Aircraft Fact Sheet (PDF, 1.3MB) Contacts Rahul Zaveri, Lead Scientist News This is a Flickr badge showing items in a set called CARES (Carbonaceous Aerosol and Radiative Effects

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 2011 [Facility News] Data from Field Campaign in Black Forest, Germany, are Red Hot Bookmark and Share During COPS, the ARM Mobile Facility operated in Heselbach, Germany, obtaining measurements encompassing the entire life cycle of precipitation. The AMF site also hosted a number of guest instruments for supplemental field campaigns throughout the deployment. During COPS, the ARM Mobile Facility operated in Heselbach, Germany, obtaining measurements encompassing the entire life cycle of

  1. News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases News Releases Accessible by Topic, Keywords (See "Search Releases") or Chronologically (See "ALL") News Releases Science Briefs Photos Picture of the Week Publications Social Media Videos Fact Sheets The thermal traits of a leaf, critical for photosynthesis, may be under strong evolutionary selection that occurs in response to environmental temperatures. Here a thermal leaf image details temperature variation, which greatly affects plant functions since

  2. News Room

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proud Legacy, Bold Future, Since 1943 News Room Your source for the latest news releases, fast facts, images and access to scores of scientists, engineers and other experts from Los Alamos National Laboratory. News Releases Science Briefs Photos Picture of the Week Publications Social Media Videos Fact Sheets James TenCate James TenCate elected Acoustical Society of America fellow TenCate's research focuses on nonlinear acoustics and elasticity, seismology and nonlinear imaging. 8/30/16 The

  3. News and Updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News and Updates Next Cleanroom Training to be announced NEWS: Article published in Louisiana Technology Guide

  4. Geothermal Energy News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Geothermal Energy News Geothermal Energy News RSS August 3, 2016 Photo Courtesy: Trabits Group EERE Success Story-Geothermal Wells: Advancing the Technology Geothermal resources are reservoirs of hot water that exist at varying temperatures and depths below the Earth's surface. Wells 1 mile deep or more can be drilled into underground reservoirs to tap steam and very hot water that can be brought to the surface for use in a variety of applications, including renewable power generation. The

  5. News Item

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hot carriers are electrical charge carriers - electrons and holes - with significantly higher energy than charge carriers at thermal equilibrium. Since hot carrier thermalization ...

  6. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  7. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  8. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  9. News Archives

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CAMD Home | Beamlines | Beam Schedule | Events | Forms | Microfabrication | Nanofabrication | Safety News Archives "Shut-down" Energizes CAMD What is a "Shut-down" in the Synchrotron Industry?

  10. News Archive

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    news archive Office of National Environmental Policy Act (NEPA) Policy and Compliance 1000 Independence Avenue, S.W. Washington, DC 20585 202-586-4600 en CORRECTED: DOE Issues 85th...

  11. News Archive

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7751+430939News Archive Office of Economic Impact & Diversity US Department of Energy 1000 Independence Ave., SW Washington, DC, 20585 202-586-8383 en Energy Department creates...

  12. News Stories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Stories News Stories Featured articles about DOE Office of Science programs and people at Los Alamos. Advanced Scientific Computing Greenland Ice Sheet "Sliding" a Small Contributor to Future Sea-Level Rise Awards Ten Los Alamos scientists, including four sponsored by the DOE Office of Science, honored by American Physical Society Los Alamos scientist Christopher Lee to receive DOE Office of Science Early Career Award Laboratory Chemist selected as the 2015 recipient of the F.

  13. LANSCE | News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos Neutron Science Center mesa header Beam Status Accelerator Ops (Internal) Operating Schedule Long Range Operating Schedule User Resources User Agreements Proposals Visit Registration Schedules Experiment Reports User Satisfaction Survey Reviews Users User Office User Program LANSCE User Group Rosen Scholar Rosen Prize News & Multimedia News Multimedia Events Profiles Highlights Seminars Activity Reports The Pulse User Program Headlines

  14. Wind Program News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Wind Program News Wind Program News RSS July 15, 2016 Penn State University Puts Collegiate Wind Competition-Winning Turbine on Display The Pennsylvania State University took top honors at the Collegiate Wind Competition back in May, and this past week the winning team came to Washington, D.C., to display its prize-winning wind turbine at the Energy Department's headquarters. July 5, 2016 Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Go behind the scenes at the U.S.

  15. Gasification News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Modular Oxygen Production in Fossil Energy Gasification Systems August 24, 2016 Two projects were selected to develop stand-alone oxygen-production technologies for use in coal gasification processes. The new technologies will produce oxygen of at least 95 percent purity for use in small-scale (500 kilowatt to 5 megawatt) modular power plants at significantly lower cost than commercial state-of-the-art oxygen-production technologies. Archive

  16. News Item

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Molecular Foundry and ALS Users, aBeam Technologies, Make Metrology History Through a collaboration with two Berkeley Lab user facilities - the Molecular Foundry and ALS - as well as two other national labs, a small Bay Area company has made big news in the semiconductor world. Modern electronics are getting smaller and smaller, which means the demands on semiconductor manufacturers are increasing. To ensure the quality and consistency of substrates, wafer manufacturers employ metrology tools to


    Energy Savers [EERE]

    SUSTAINABILITY NEWS Earth Day Celebration at the Nationals Stadium was a Success Thank you to everyone who came out! The celebration was a success for both DOE and for the Washington Nationals, who scored eight runs in a win over the Minnesota Twins. Deputy Secretary of Energy Elizabeth Sherwood-Randall, SPO Director John Shonder and other DOE leaders were on hand to welcome the crowds, and DOE's Sustainability video was shown on the jumbotrons throughout the stadium. To view photos from the

  18. News Releases - 2010

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... More Like This DOE National Labs NNSA Sites NNSA News Room DOE News Room Get updates on LANL - Click to subscribe Sign up for emails about latest videos, publications, and news ...

  19. News Releases - 2008

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... More Like This DOE National Labs NNSA Sites NNSA News Room DOE News Room Get updates on LANL - Click to subscribe Sign up for emails about latest videos, publications, and news ...

  20. News Releases - 2009

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... More Like This DOE National Labs NNSA Sites NNSA News Room DOE News Room Get updates on LANL - Click to subscribe Sign up for emails about latest videos, publications, and news ...

  1. News Releases - 2014

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... More Like This DOE National Labs NNSA Sites NNSA News Room DOE News Room Get updates on LANL - Click to subscribe Sign up for emails about latest videos, publications, and news ...

  2. News Releases - 2011

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... More Like This DOE National Labs NNSA Sites NNSA News Room DOE News Room Get updates on LANL - Click to subscribe Sign up for emails about latest videos, publications, and news ...

  3. NREL: Transportation Research - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News NREL provides a number of transportation and hydrogen news sources. Transportation News Find news stories that highlight NREL's transportation research, development, and deployment (RD&D) activities, including work on vehicles and fuels. Hydrogen and Fuel Cells News Find news stories that highlight NREL's hydrogen RD&D activities, including work on fuel cell electric vehicle technologies. Transportation and Hydrogen Newsletter Stay up to date on NREL's RD&D of transportation and

  4. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  5. WIPP News Release Archives Index

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WIPP News Release Archives 2006 News Releases 2005 News Releases 2004 News Releases 2003 News Releases 2002 News Releases 2001 News Releases 2000 News Releases 1999 News Releases 1998 News Releases 1997 News Releases 1996 News Releases 1995 News Releases Back to 2007 News Releases If you have any questions regarding the above, contact: Dennis Hurtt, Team Leader Office of Public Affairs DOE, Carlsbad Field Office P.O. Box 3090 Carlsbad, NM 88221-3090 Phone: 505/234-7327 Fax: 505/234-7025 E-mail:

  6. NREL: Sustainable NREL - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Below are news stories related to NREL's sustainability efforts. February 22, 2016 NREL analysis finds tax credit extensions can impact renewable energy deployment and ...

  7. Small Business News, Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Small Business News, Publications Small Business News, Publications Setting new standards and small business initiatives within NNSA that will contribute to developing and...

  8. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues submit In ...

  9. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  10. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  11. Advanced Manufacturing Office News

    SciTech Connect (OSTI)


    News stories about advanced manufacturing, events, and office accomplishments. Subscribe to receive updates.

  12. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  13. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Press Releases Feature Stories Science Highlights In the News Fact Sheets and Other Publications Photos Videos Events About Us Intranet About Us Intranet Argonne National Laboratory Computing, Environment and Life Sciences Organizations Facilities and Institutes News Events News Press Releases Feature Stories Science Highlights In the News Fact Sheets and Other Publications Photos Videos News Argonne Distinguished Fellow Paul Messina has been tapped to lead the DOE and NNSA's Exascale Computing

  14. News from SRNL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8/2016 SEARCH SRNL GO News Releases Video Releases Media Contacts SRNL Home News from SRNL News releases are in PDF format (requires Acrobat Reader - click here to download). News release archives are in a compressed format. * 2015 Releases * 2014 Archive * 2013 Archive * 2012 Archive * 2011 Archive * 2010 Archive 2016 SRNL News Releases SRS Begins Cleanup of Building Used to Produce Fuel for Space Program SRNL Facility Gets Makeover with Powerful New Neutron-Generation Capability 07.28.16 - A

  15. EERE News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EERE News EERE News The Office of Energy Efficiency and Renewable Energy (EERE) News section includes current news releases, EERE Network News, EERE's bi-monthly magazine Amped Up!, resources for media, and subscription information. Connect with EERE through Facebook, Twitter, LinkedIn, and YouTube to share clean energy news around the globe. News Releases An image of digital news screens. Read breaking news announcing EERE's accomplishments, research initiatives, funding opportunities, progress

  16. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Princeton Journal Watch Blog Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton...

  17. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases...

  18. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  19. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  20. JCAP News - JCAP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PAZ0080_v2.jpg JCAP News News & Events JCAP News JCAP Events Media Coverage News & Events JCAP News JCAP Events Talks Meetings & Workshops Media Coverage JCAP News + 2016 JULY, 2016 JCAP scientists at LBNL have discovered ways to better predict a semiconductor's stability and degradation qualities. MORE JUNE 10, 2016 JCAP PI Francesca Toma receives the Alfredo di Braccio Award. MORE MAY 3, 2016 JCAP PI and Thrust 3 Coordinator Ian Sharp is the recipient of the Dept. of Energy's Early

  1. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  2. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  3. Neutron and Nuclear Science News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Recent news and events related to neutron and nuclear science at LANSCE. Neutron and Nuclear Science News Links Neutron and Nuclear Science News Media Links Profiles Events at LANSCE

  4. Sandia National Laboratories: News: Videos

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Videos Sandia Digital Media View our Streaming Media Library

  5. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  6. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  7. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  8. NREL: Biomass Research - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Below are news stories related to NREL biomass research. Subscribe to the RSS feed RSS . Learn about RSS. June 3, 2015 NREL Cyanobacteria Ramps Up Photosynthesis-and New...

  9. NREL: Wind Research - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wind Technology Center at NREL provides a number of wind news sources to help you stay up-to-date with its activities, research, and new developments. NREL Wind News See...

  10. DVU Training News Form

    Broader source: (indexed) [DOE]

    Training News Form Please complete this form in its entirety and email to ... For Web Team Only NODE DOE F 360.9 (092014) Guidance for Posting to "Training News" ...

  11. News | Department of Energy

    Energy Savers [EERE]

    the Fuel Cell Technologies Office are presented below. To see past news items, refer to the news archives for 2013, 2012, 2011, 2010, 2009, and 2008. Subscribe to Fuel Cell ...

  12. 2016 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2016 News Below are news stories related to Bioenergy. RSS Learn about RSS. May 24, 2016 NREL Bioenergy Staff Honored for Top Innovations in 2015 NREL's state-of-the-art bioenergy ...

  13. Microsoft Word - NMMSS News OCT 21 08 Update.doc

    National Nuclear Security Administration (NNSA)

    October 21, 2008 SPECIAL EDITION Additional Protocol As part of the pre-Users meeting to the 2008 NMMSS Users Annual Training Meeting, Tom Grice of the Nuclear Regulatory Commission made a presentation on the "Additional Protocol" treaty and its likely impact on industry. The Department of Commerce and Nuclear Regulatory Commission are very close to publishing final regulations to implement the "Additional Protocol" treaty. To help industry understand the "Additional

  14. Microsoft Word - Deep-Burn awards news release _2_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RELEASE Tim Jackson, DOE-Idaho Operations Office Wednesday, July 23, 2008 (208) 526-8484 U.S. Department of Energy Awards $7.3 million for "Deep-Burn" Gas-Reactor Technology Research & Development WASHINGTON, DC -Today the U.S. Department of Energy announced it has selected teams led by Idaho National Laboratory and Argonne National Laboratory to advance the technology of nuclear fuel "Deep-Burn," in which plutonium and higher transuranics recycled from spent nuclear fuel

  15. Microsoft Word - FINAL News Release - Security Walls VPP.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Security Contractor Receives DOE Voluntary Protection Program Award CARLSBAD, N.M., October 24, 2012- Security Walls, LLC, the security contractor for the U.S. Department of Energy's (DOE) Waste Isolation Pilot Plant (WIPP), recently received the DOE Voluntary Protection Program (VPP) Legacy Star award. The DOE-VPP legacy star award is the highest level of recognition possible in the VPP. To be eligible for this award, the recipient must achieve and maintain the DOE-VPP star of excellence award

  16. Microsoft Word - 0906 NMMSS News DOE NRC Approved.doc

    National Nuclear Security Administration (NNSA)

    ... The course will include the following topics, among others: Completion of data input forms: transaction, material balance, inventory, and concise notes Demonstration of the use of ...

  17. Microsoft Word - NMMSS News NOV 20 08 FINAL.doc

    National Nuclear Security Administration (NNSA)

    November 20, 2008 2008 HOLDIAY SCHEDULE Please be advised of the NMMSS Operations schedule for the remainder of 2008. NMMSS Operations will be closed on the following days to...

  18. ARM - News & Press

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Press Related Links SPARTICUS Home AAF Home Deployment Operations Measurements SGP Data Plots NASA Data Plots ARM Data Discovery Browse Data Experiment Planning SPARTICUS Proposal Abstract Science Questions Science and Operations (PDF, 1.01M) SPARTICUS Wiki News News & Press Backgrounder (PDF, 269K) Contacts Gerald Mace, Lead Scientist News & Press Features Cirrus Clouds Hold Clues to Climate January 6, 2010 Happy New (fiscal) Year! Cloud Droplet Probe Arrives in Time for

  19. ARM - Niamey News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    West AfricaNiamey News Niamey Deployment AMF Home Niamey Home Data Plots and Baseline Instruments Rainfall Record (PDF) Publications List, (PDF) Experiment Planning RADAGAST Proposal Outreach Fact Sheets RADAGAST (PDF) Annual Climate Cycle in Niger, Africa (PDF) Posters AMF Poster, French Version We're Going to Sample the Sky in Africa! News Campaign Images AMMA International News Niamey News Radar Wind Profiler Joins ARM Mobile Facility Instrument Suite May 15, 2006 W-Band Cloud Radar Added to

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 22, 2007 [Facility News] GEWEX News Features Dust Data from ARM Mobile Facility Deployment Bookmark and Share Data from the recent deployment of the ARM Mobile Facility are featured in the February issue of GEWEX News. The February 2007 issue (Vol. 17, No. 1) of GEWEX News features early results from special observing periods of the African Monsoon Mutidisciplinary Analysis, including data obtained by the ARM Mobile Facility (AMF). The AMF was stationed in the central Sahel from January

  1. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Los Alamos cancer research highlighted on NBC News; top YouTube videos featuring Los Alamos science; new tribal governors; "New Mexico Women in Science" calendar; Future City winners share visions of the future; Podcast introduces new internship opportunities February 1, 2016 The Pueblo of Pojoaque

  2. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Request for proposals for Venture Acceleration Fund opening soon, news updates on recent STEM activities, a scholarship opportunity for northern New Mexico students, and notice to businesses to register on the System for Award Management March 1, 2016 UbiQD received VAF funding in 2015 UbiQD received VAF funding

  3. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News News News June 29, 2016 Notice of Availability for Explanation of Significant Differences for the Rocky Flats Corrective Action Decision/Record of Decision Central Operable Unit June 13, 2016 Notice of Rocky Flats CERCLA Five-Year Review More news Featured Articles LM 2016-2025 Strategic Plan Released LM Director Retires/New Acting LM Director Appointed Monument Valley Open House Little Wind River Floods at Riverton, Wyoming: Study to Determine Impacts on Soil Contaminants Moab UMTRA

  4. News > > The Energy Materials Center at Cornell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News + Events In This Section EMC2 News Archived News Stories News EMC2 News Center news updates 30 entries Archived News Stories Previous news stories from emc2 97 entries Home » News

  5. 2014 News | Community | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2014 News Below are news stories related to Community. RSS Learn about RSS. September 19, 2014 NREL Interns Look Toward the Future Forty-four interns spend summer at NREL researching topics from genetic engineering to technologies for hydrokinetic turbines. Archives Current News | 2014

  6. December News Blast | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    December News Blast December News Blast December News Blast december_2013_newsblast.pdf (337.86 KB) More Documents & Publications November 2013 News Blast January 2014 News Blast April 2014 Monthly News Blast

  7. February 2014 News Blast | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 News Blast February 2014 News Blast February 2014 News Blast february_2014_newsblast.pdf (251.82 KB) More Documents & Publications March 2014 Monthly News Blast April 2014 Monthly News Blast January 2014 News Blast

  8. ARM - Program News Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NewsProgram News Archive Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 16, 2008 [Facility News] 21st Century "Paper Boy" Begins Delivering ARM News Bookmark and Share A reorganized ARM News Center now offers RSS feeds-subscription services using free downloadable software. A reorganized ARM News Center now offers RSS feeds-subscription services using free downloadable software. Like a modern day paper boy, RSS (short for Really Simple Syndication) is a web-based subscription service that delivers Internet news right to your doorstep-or web browser,

  10. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) 10 Facts You Should Know About Fusion Energy Click on an image below to view the high resolution image. Then right click on

  11. News > > The Energy Materials Center at Cornell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News + Events In This Section Why Partnerships? Current Partners Project Updates News & Events Resources Join News EMC2 News Center news updates 30 entries Archived News Stories Previous news stories from emc2 97 entries Home » News

  12. ARM - ERASUMS - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govCampaignsEvaluation of Routine Atmospheric Sounding Measurements using Unmanned Systems (ERASMUS)News & Press Campaign Links Science Plan ERASMUS Backgrounder News & Press Images Comments? We would love to hear from you! Send us a note below or call us at 1-888-ARM-DATA. Send News for ERASMUS Media Coverage Features ARM Climate Research Facility Getting an Inside View of Arctic Clouds November 16, 2015 Cooperative Institute for Research in Environmental Sciences ERASMUS: Unmanned

  13. ARM - News & Press

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Press Related Links RACORO Home AAF Home ARM Data Discovery Browse Data Post-Campaign Data Sets Data Guide (PDF, 1.4MB) Campaign Journal Flight Details Images ARM flickr site Deployment Operations Measurements Science & Operations Plan (PDF, 640K) SGP Data Plots RACORO wiki Login Required Experiment Planning Steering Committee Science Questions RACORO Proposal Abstract Full Proposal (PDF, 886K) Collaborations Meetings CLOWD Working Group News Discovery Channel Earth Live Blog News

  14. ARM - Point Reyes News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CaliforniaPoint Reyes News Point Reyes Deployment AMF Home Point Reyes Home Data Plots and Baseline Instruments Experiment Planning MASRAD Proposal Abstract and Related Campaigns Outreach Posters Climate Research at Point Reyes National Seashore (horizontal) Climate Research at Point Reyes National Seashore (vertical) News Campaign Images Point Reyes News From Coastal Clouds to Desert Dust: ARM Mobile Facility Headed to Africa September 30, 2005 New Data Streams Available for ARM Mobile Facility

  15. Sandia National Laboratories: News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News - 100 Resilient Cities Golden Gate Related News Releases City resilience: Sandia analyzes effects of rising sea levels in Norfolk March 28, 2016 Resilient cities focus of new Sandia, Rockefeller Foundation pact to help 100 communities April 1, 2014 Motivating business to design a more resilient nation, one building at a time July 23, 2013 Improving the reliability and resiliency of Hoboken's electric grid in aftermath of Hurricane Sandy July 3, 2013 In the News Calculating costs of a

  16. WIPP News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Current News Releases March 20, 2015 - Event News Release #2 WIPP Emergency Operations Center Deactivated March 20, 2015 - Event News Release #1 Emergency Operation Center Activated as Precautionary Measure for Offsite Event November 25, 2014 CBFO and WIPP Volunteerism Helps Little Ones This Winter Karing for Kids Koat Drive November 10, 2014 CBFO and WIPP Commemorations for Veterans Day 2014 Photo 1: Veterans Commeration at Skeen-Whitlock, Nov. 6, 2014 Photo 2: Veterans Commeration at

  17. 2003 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 22, 2003 Renewable Energy a Smart Choice for Farmers and Ranchers December 10, 2003 Georgia Tech's Rohatgi Wins Second Annual Rappaport Award December 9, 2003 Acclaim for Three Leaders at Annual NREL Stakeholders Reception November 14, 2003 World Renewable Energy Congress Provides International Forum November 12, 2003 NREL and Company Researchers Team Up

  18. 2004 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 21, 2004 NREL Recognizes Solar Pioneer with National Honor November 23, 2004 NREL Recognizes Solar Pioneer with National Honor November 17, 2004 Basalt Middle School Teacher Recognized for Renewable Energy Efforts October 5, 2004 NREL Theorist Recognized for Highest Citation Impact September 24, 2004 NREL Selects Contractor for New Science & Technology

  19. 2005 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search November 17, 2005 Lakewood High School Teacher Recognized for Introduction of Renewable Energy Curriculum Students taking technology classes at Lakewood High School this semester are learning about more than construction, technical theater and computer aided drafting (CAD); they are learning about energy issues within their community. October 31, 2005 Agreement

  20. 2006 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 14, 2006 Experimental "Wind to Hydrogen" System Up and Running Xcel Energy and the National Renewable Energy Laboratory unveiled a unique facility that uses electricity from wind turbines to produce and store pure hydrogen. November 28, 2006 University of Denver High School Teacher Recognized for Commitment to Renewable Energy Don Cameron,

  1. 2007 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 4, 2007 Energy Lab Sets Aggressive Greenhouse Gas Reduction Goal The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) has pledged to reduce its greenhouse gas emissions by 75 percent from 2005 to 2009. The new goal is part of NREL's participation in the Environmental Protection Agency's (EPA) Climate Leaders program. November 8, 2007

  2. 2010 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 17, 2010 NREL Employees Significantly Increase Their Community Support For the second year in a row, employees of the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) pledged significantly more to community organizations during its annual charitable giving campaign this holiday season. December 2, 2010 Scientists Generate Two

  3. 2011 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 20, 2011 NREL Licenses Technology to Increase Solar Cell Efficiency The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) announced today that Natcore Technology Inc. has been granted a patent license agreement to develop a line of black silicon products. December 15, 2011 NREL Scientists Report First Solar Cell Producing More

  4. 2012 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 21, 2012 NREL Names New Executive The U.S. Department of Energy's National Renewable Energy Laboratory today named Barbara Goodman as Associate Laboratory Director for Renewable Fuels and Vehicle Systems to replace Dale Gardner who is retiring at the end of the year. December 20, 2012 Concentrated Solar Power with Thermal Energy Storage Can Help Utilities'

  5. 2013 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 12, 2013 NREL Seeks Leaders for National Executive Energy Academy The Energy Department's National Renewable Energy Laboratory (NREL) is accepting applications for its 2014 Executive Energy Leadership Academy. NREL's Executive Energy Leadership Academy, also known as Energy Execs, is a program for non-technical decision-makers throughout the country to

  6. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Community Leaders survey results; NNSA orders security enhancements; Scientists awarded Fellowships from APS July 2, 2012 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email The American Physical Society recognized 10 Laboratory scientists for

  7. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Los Alamos expertise integral to nuclear energy innovation hub; LANL now on Facebook. August 1, 2012 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Los Alamos Expertise Integral to Nuclear Energy Innovation Hub In June 2010, scientists from the

  8. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News LANL employee chosen for "Frontiers of Engineering" Symposium; 16th Annual Hazmat Challenge strengthens response skills. September 1, 2012 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email LANL Employee Chosen for "Frontiers of

  9. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Help us make Connections better! October 1, 2012 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Help us make Connections better! Periodically, we like to get feedback on this publication so we can make it even better and more useful to you. Well,

  10. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Richard Marquez Leadership and Service Award established at NNMC; Lab employees recognized for Mars Rover contribution; Connections survey feedback results. November 1, 2012 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Richard Marquez

  11. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News New Lab program reinforces safety behavior; Laboratory Fellows announced. January 1, 2013 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Chuck, Steven, and Mikhail have made exceptional contributions in their fields and to national security. New

  12. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Community Leaders survey results; NNSA orders security enhancements; Scientists awarded Fellowships from APS. February 1, 2013 dummy image Read our archives. Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email The American Physical Society recognized 10 Laboratory scientists for

  13. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In Other News Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In Other News Lecture on Sandia Lab history; LANL Foundation personnel changes. March 1, 2013 Rebbecca Ullrich is Sandia National Laboratories' historian Rebbecca Ullrich is Sandia National Laboratories' historian. Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email The Bradbury Science

  14. In Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Student housing needed and more science stories May 1, 2013 Student housing needed this summer Student housing needed this summer Contact Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Summer student housing needed Each year students arrive in the region from all over the country and

  15. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Environmental sustainability, Science Bowl winners and new Pinterest site. April 1, 2013 The Lab's Pinterest site The Lab's Pinterest site. Contact Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email 2013 Site Sustainability Plan released The Lab looked 50 years into the future to write a

  16. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Summer activities, new Energy Secretary, contractor awards scholarships and a STEM summit June 1, 2013 Bradbury Science Museum Bradbury Science Museum in Los Alamos Contact Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email Bradbury Science Museum can help stem summer "brain

  17. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Connections has a new title, winners of the Robot Rodeo, local firm gets large grant and new kits available for regional teachers July 1, 2013 A new STEM teacher kit is being distributed throughout the region A new STEM teacher kit is being distributed throughout the region Contact Editor Linda Anderman Email

  18. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news New Mexico small businesses can submit leveraged proposals beginning August 20 August 1, 2013 Previous leveraged-project winner Nanotitanium Dental Implants (Walt Shuman, Dan Blacklock and Terry Lowe) Previous leveraged-project winner Nanotitanium Dental Implants (Walt Shuman, Dan Blacklock and Terry Lowe)

  19. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Local nonprofits can apply for development grants, the Regional Development Corporation is recognized for its efforts and Northern New Mexico College receives grant September 1, 2013 The Regional Development Corporation was recently recognized for its economic development efforts The Regional Development

  20. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Community Commitment Plan renewed, plus stories on giving, economic development and education November 1, 2013 The Regional Development Corporation was recently recognized for its economic development efforts New Mexico-based Ideum is just one of the organizations that has benefited from investments made through

  1. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Readers' survey, protecting Lab bird residents and major media mentions December 1, 2013 Community Connections readers' survey Please participate in our readers' survey Contacts Community Programs Office Director Kurt Steinhaus Email Editor Linda Anderman Email Community Connections readers survey - please let

  2. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Science Cinema, crowdfunding and giving programs wrap up February 1, 2014 Crowdsourcing class at UNM-LA The Bradbury Science Museum in Los Alamos Contact Community Programs Office Director Kurt Steinhaus Email Editor Linda Anderman Email Lab supports local business through crowdfunding class A recent

  3. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Regional science event winners, environmental protection and state STEM week March 1, 2014 Los Alamos Middle School wins regional Science Bowl (From left to right: David Gao, Phillip Martin, Sonyia Williams, Presley Gao and coach Naomi Unger) Los Alamos Middle School wins regional Science Bowl (From left to

  4. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Expanding Your Horizons, MathCounts winner goes to nationals, info on Lab trails and more April 1, 2014 Carlos Vigil Middle School students have fun at the Expanding Your Horizons conference. Carlos Vigil Middle School students have fun at the Expanding Your Horizons conference. Contact Community Programs Office

  5. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news New podcast, Supercomputing winners May 5, 2014 Elmer Torres (r) recently participated in a podcast on Native American entrepreneurs. Here, Torres receives a Native American Venture Acceleration Fund award from Kurt Steinhaus (l), director of the Laboratory's Community Programs Office, and Kathy Keith (m),

  6. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Regional Coalition, VAF recipient acquired by Google, Veteran-owned business June 1, 2014 Some of the Regional Coalition of LANL Communities members and alternates attending the coalition's April 25 meeting, (l to r) Tom Blankenhorn, Taos County Commissioner; Fran Berting, Los Alamos County Councilor; Danny

  7. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news School drive results; New Mexico Middle School Electric Car Challenge; Española Valley Teen Biz Challenge September 1, 2014 A San Ildefonso Day School student selects from a mountain of backpacks collected during this year's backpack and school supply drive. A San Ildefonso Day School student selects from a

  8. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Employee Giving Campaign, Entrepreneurial Teen Grand Challenge, 2015 MidSchoolMath conference, new podcasts October 1, 2014 Winners of the 2014 Entrepreneurial Teen Grand Challenge; left to right Xena Martinez, Alejandro Atencio and Joshua Lopez. Winners of the 2014 Entrepreneurial Teen Grand Challenge; left to

  9. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Call for Native American VAF applications, new video marks 10 years of collective community giving, entrepreneurship award, new LANL Foundation CEO, national economic development conference November 1, 2014 Elmer Torres (middle), shown here during the grand opening of his Than Povi Fine Art Gallery in

  10. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Holiday Gift Drive; Electric Car Challenge success; national Wreaths Across America December 1, 2014 The holiday season is a good time to make a difference. The holiday season is a good time to make a difference. Contact Community Programs Director Kurt Steinhaus Email Editor Ute Haker Email Please click on the

  11. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Accelerate Technical Training; Earl Salazar reelected as tribal governor; Future City regional finals; winners of the Earth and Environmental Science Scholarship; Los Alamos County Science and Engineering Fair February 1, 2015 James H. Rodriguez Elementary School students Danny Serrano (second from left), José

  12. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Call for Venture Acceleration Fund applications, including information sessions March 5 and 11; opportunity to own a Habitat for Humanity home; Luján and Fleischmann to lead House Nuclear Cleanup Caucus March 1, 2015 FLUTe, a flexible liner manufacturer located in Alcalde, New Mexico, was one of the Venture

  13. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Laboratory dramatically reduces water use; Legislative measures recognize private STEM support; New grant will help expand Venture Acceleration Fund; Discover E; Embudo Valley Library; Santa Fe Radio Café replay April 1, 2015 State Representative Stephanie Garcia-Richard (far right) greets Kurt Steinhaus, Los

  14. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Science Showdown in Española draws close to 400 visitors; Monte del Sol Charter School students win top Supercomputing award; Future entrepreneurs develop business savvy; New Community Programs Office podcasts; My small act: Simple actions have a big impact May 1, 2015 An Española student explains a circuit

  15. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Maestas-Swazo named Lab's tribal liaison; new head for DOE's Los Alamos cleanup office; 2015 recipients of Northern New Mexico Tribal Business Scholarship; LANL Laces and school supplies drive invest in students; seven Mexican spotted owl chicks hatch on Lab property; new podcast September 1, 2015 Baxter the

  16. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news White House honors LANL Foundation; Lab Director meets with Santa Clara Pueblo leaders; Lab partners with colleges to help students make a good first impression; San Ildefonso Pueblo summer school emphasizes math and science learning; book fair raises funds for Food Depot October 1, 2015 Laboratory Director

  17. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Laboratory helps Ohkay Owingeh find math, science tutors; giving students a chance to work, learn and earn; Los Alamos, Van Andel Research Institute to study lung cancer; Lab to team with Procter & Gamble in clean energy manufacturing initiative November 2, 2015 Even the most carefully crafted science

  18. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Novel therapy for stomach cancer; grand opening of Manhattan Project National Historical Park; 2015 Northern New Mexico 20/20 Campaign Award reception; Los Alamos scientist part of NASA's select few; regional teams do well at Electric Car Challenge December 1, 2015 Even the most carefully crafted science

  19. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Safety, supercomputing, science museums, scholarships-read all about 'em. May 2, 2016 May is Motorcycle Safety Awareness Month Richard Sturgeon, head of the Lab's Motorcycle Safety Committee, wrote to the Governor suggesting that the state raise the safety awareness of New Mexican drivers and motorcyclists as

  20. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news A senator, secret city, and climate change. June 2, 2016 U.S. Senator Martin Heinrich and LANL historian Alan Carr U.S. Senator Martin Heinrich meets with Los Alamos National Laboratory Historian Alan Carr to discuss the laboratory's contribution to nuclear testing from the Manhattan Project until the Limited

  1. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Northern New Mexico Tribal Business Scholarship deadline extended. July 6, 2016 Aynjil Baca, of San Felipe Pueblo, was a recipient of the 2014 Northern New Mexico Tribal Business Scholarship. Aynjil Baca, of San Felipe Pueblo, was a recipient of the 2014 Northern New Mexico Tribal Business Scholarship. The

  2. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Makerspaces foster creative collaborations. August 2, 2016 Los Alamos Makers is "a scientific playground for all ages." Los Alamos Makers is "a scientific playground for all ages." Contacts Director, Community Partnerships Office Kathy Keith Email Editor Whitney Spivey Email "Students,

  3. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Northern New Mexico College awarded nearly $1 million-and more area updates. September 1, 2016 The Community Builders Youth STEAM and Cultural Conference was a collaboration between the New Mexico Indian Affairs Department, Los Alamos National Laboratory, Sandia National Laboratories, the Explora Museum, and

  4. Physics Division News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PADSTE » ADEPS » Physics » Physics Division News Physics Division News Discover more about the wide-ranging scope of Physics Division science and technology. Contact Us ADEPS Communications Email Physics Flash An electronic newsletter featuring interviews with Physics Division staff and news of awards and the latest research published in peer-reviewed journals. Physics Flash archive Focus on Physics Focus on Proton Radiography (pdf) High Energy Physics: LBNE, HAWC (pdf) Nuclear Physics:

  5. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News News News July 13, 2016 Department of Energy Cites BWXT Conversion Services, LLC for Worker Safety and Health Program Violations The U.S. Department of Energy (DOE) today issued a Preliminary Notice of Violation (PNOV) to BWXT Conversion Services, LLC (BWCS) for violations of DOE worker safety and health requirements. DOE's enforcement program holds contractors accountable for meeting regulatory requirements and maintaining a safe and healthy workplace. September 2, 2015 Nuclear Executive

  6. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    About Us » News News News August 3, 2016 CEQ Releases Final Guidance on Consideration of Greenhouse Gas Emissions and Effects of Climate Change in NEPA CEQ released its Final Guidance for Federal Departments and Agencies on Consideration of Greenhouse Gas Emissions and the Effects of Climate Change in National Environmental Policy Act Reviews. The guidance provides a framework for agencies to consider both the effects of a proposed action on climate change, as indicated by its estimated

  7. News | Department of Energy

    Energy Savers [EERE]

    News Blog Clean Energy Investment Center and Private Sector Talk Innovation and Investment ... Technologies from DOE's Labs to the Private Sector and Investor Community Raising Our ...

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2011 Facility News Snazzy New Spectroradiometers Sport Same Body, Different Mind Bookmark and Share Connor Flynn, a scientist at Pacific Northwest National Laboratory and the...

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2009 Facility News ARM Aerial Facility Leads International Discussions on Aircraft Research Bookmark and Share Five research aircraft participated in the VAMOS...

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 15, 2005 Facility News Japanese Collaborators Take A Long Look at Lightning Bookmark and Share Mounted on tripods, numerous interferometer antennas are secured to the roof...

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 11, 2007 Facility News ARM Mobile Facility Moves to China in 2008 for Study of ... China generates exceptionally high amounts of aerosol particles whose influence on the ...

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    25, 2011 Education, Facility News Remote Schools Welcome Much-Needed Resources Bookmark and Share Students at the Children's Academy Centre in Lorengau gather as Jacklyn Soko,...

  13. ARM - News & Press

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Press Related Links MC3E Home News News & Press MC3E Backgrounder (PDF, 1.61MB) SGP Images ARM flickr site Field Blog ARM Data Discovery Browse Data Deployment Operations Measurements Science Plan (PDF, 3.85 MB) Featured Data Plots SGP Data Plots (all) Experiment Planning Steering Committee Science Questions MC3E Proposal Abstract and Related Campaigns Meetings Cloud Life Cycle Working Group Contacts Michael Jensen, Lead Scientist News & Press Releases NASA Media Invited to

  14. ARM - News Center Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CenterNews Center Archive Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and

  15. ARM - News Search Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and Releases Facility News

  16. ARM - Program News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and Releases Facility

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 13, 2014 Education, Facility News ARM Educational Outreach Celebrates Earth Science Week 2014 Bookmark and Share This week, Professor Polar Bear and the Climate Kids are...

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0, 2014 Education, Facility News ARM's Educational Outreach Recognized Bookmark and Share Resources selected by the Climate Literacy and Energy Awareness Network (CLEAN) must...

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    14, 2012 Education, Facility News ARM Education Receives Seal of Approval Bookmark and Share Resources selected by the Climate Literacy and Energy Awareness Network (CLEAN) must...

  20. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Researchers at Argonne, Scripps Research Institute, and Rice University provide greater insight into the process of manipulating nature's biosynthetic machinery to produce...

  1. News | Department of Energy

    Office of Legacy Management (LM)

    managing the Uranium Leasing Program for another 10 years. More news Featured Articles Pinellas Site Uses Horizontal Wells for Enhanced Bioremediation Fernald Preserve: A...

  2. ARM - Facility News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and Releases Facility

  3. Monthly News Blast

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    YouTube Facebook Twitter Blog Past Newsletters Bioenergy Social Media & Multimedia Corner Monthly News Blast July 2013 Secretaries Moniz and Vilsack Speaking at Biomass ...

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 16, 2007 Facility News ARM Education and Outreach Program Awarded Funding by National Science Foundation Bookmark and Share Andrea Maestas, ARM Education and Outreach...

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    discuss the campaign and accomplishments to date. See the Scripps Institution of Oceanography UC San Diego news for the full announcement. See the complete presentation page for...

  6. Geothermal Energy News

    Broader source: (indexed) [DOE]

    geothermal900546 Geothermal Energy News en EERE Announces Up to 4 Million for Critical Materials Recovery from Geothermal Fluids http:energy.goveerearticles...

  7. Latest News Release

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Release Release Date: Contact: Shelley Martin, DOE National Energy Technology Laboratory, 304-285-0228, 2016 2015 2014 2013

  8. Sustainability Performance Office News

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    management-spo1461771 Sustainability Performance Office News en Executive Order 13693 Training Now Available On Demand http:energy.govmanagementspoarticles...

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2007 Facility News High-Speed Internet Deflects Information Overload Bookmark and Share Covering approximately 143,000 square kilometers in Oklahoma and Kansas, instruments...

  10. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    All Issues submit In other news New Mexico helps Fukushima; 2014 VAF winners; new ... Editor Ute Haker Email New Mexico helps the Fukushima nuclear reactors A new technology ...

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20, 2008 Facility News ARM Scientists Lead International Radiation Symposium in Brazil Bookmark and Share The ARM Science Team showed up in force at the 2008 International...

  12. In The News Feed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


    Microwave heat improves nanostructured molybdenum disulfide catalyst's ability to produce hydrogen.

    October 26, 2015 In The News Feed...

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    13, 2014 Facility News Characterizing Ice Nuclei Over Southern Great Plains Bookmark and Share Placed on the upper platform of the SGP Guest Instrument Facility, this filter...

  14. Wind Program News

    SciTech Connect (OSTI)


    Stay current on the news about the wind side of the Wind and Water Power Program and important wind energy events around the U.S.

  15. Chemical & Engineering News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARPA-E Basic Energy Sciences Materials Sciences and Engineering Chemical Sciences ... SunShot Grand Challenge: Regional Test Centers Chemical & Engineering News Home...

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 31, 2008 Facility News Breakthrough User Interface Delivers Statistical Views of Data Bookmark and Share With its "drill-down" preview feature, the Statistical Browser is...

  17. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News News Stay current on the news about the wind side of the Wind and Water Power Program and important wind energy events around the U.S. The Wind Program Newsletter highlights the key activities, events, funding opportunities, and resources each quarter that the program supports. Below are more news stories related to both wind and water power from the U.S. Department of Energy, Office of Energy Efficiency and Renewable Energy, Wind and Water Power Program, and other federal agencies. Recent

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 15, 2004 Facility News Data Quality Application Gives Data Browsers a New View Bookmark and Share Plot Browser, now available through the Data Quality Health and Status...

  19. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    About Us » News News EM News News Advance Agenda Now Available for 2016 National Cleanup Workshop July 29, 2016 12:00 PM WASHINGTON, D.C. - An advance agenda is now available for the 2016 National Cleanup Workshop, scheduled to be held on Sept. 14-15, 2016, at the Hilton Alexandria Mark Center in Alexandria, Va. Read The Full Story EM Headquarters Completes Reorganization July 28, 2016 1:25 PM WASHINGTON, D.C. - EM headquarters is moving forward with a new organizational structure intended to

  20. Nevada Office News News Media Contact: For Immediate Release...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Office News News Media Contact: For Immediate Release: Darwin J. Morgan, ... to Meet A public meeting hosted by the Nevada Site Specific Advisory Board (NSSAB) will ...

  1. Nevada Field Office News News Media Contact: For Immediate...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Field Office News News Media Contact: For Immediate Release: Darwin J. Morgan, ... to Meet A public meeting hosted by the Nevada Site Specific Advisory Board (NSSAB) will ...

  2. Nevada Site Office News News Media Contact: For Immediate...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Site Office News News Media Contact: For Immediate Release: Darwin J. Morgan, ... and Roger Thompson, both employees of the Nevada National Security Site (NNSS), are ...

  3. April 2012 Biomass Program News Blast

    Broader source: [DOE]

    April 2012 monthly news blast from the Biomass Program, highlighting news items, funding opportunities, and events.

  4. Latest News | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News News releases CMI in the news News archive CMI social media Latest News News about CMI: Critical Materials Institute, Oddello Industries pursue recovery of rare-earth magnets from used hard drives, August 16, 2016 Solar panels power materials exhibit at Geology Museum, August 2, 2016 New alloy promises to boost rare earth production while improving energy efficiency of engines, June 3, 2016 Critical Materials Institute gains ten industrial and research affiliates, April 11, 2016 On

  5. November 2013 News Blast | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 News Blast November 2013 News Blast November 2013 News Blast november_2013_newsblast.pdf (397.02 KB) More Documents & Publications BETO Monthly News Blast, August 2013r January 2014 News Blast March 2014 Monthly

  6. BooNE News Articles

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Articles FermiNews Fermilab's biweekly magazine (several stories) Beam Line: Special Neutrino Issue A special issue of SLAC's quarterly magazine. Earth & Sky "Catching Ghost...

  7. News & Blog | Department of Energy

    Office of Environmental Management (EM)

    Transmission Synchrophasor Technology and the DOE The U.S. Department of Energy's Microgrid Initiative Bridging the Gaps on Prepaid Utility Service News & Blog Blog Archive News ...

  8. FORGE News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News FORGE News November 18, 2015 Road Tripping through the Geothermal Frontier April 27, 2015 Energy Department Announces Project Selections in First Phase of Cutting-Edge ...

  9. sr0801.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office, P.O. Box A, Aiken, S.C. 29802 NEWS MEDIA CONTACTS: For Immediate Release June 19, 2008 Julie Petersen (803) 952-7690 Jim Giusti (803) 952-7684 DOE Marks Key Cleanup and Closure Milestones at its Savannah River Site AIKEN, S.C. - U.S. Department of Energy (DOE) Assistant Secretary for Environmental Management (EM) James A. Rispoli today marked the start of normal operations of interim salt waste processing facilities - the Actinide Removal

  10. Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    June 2003 1 Short-Term Energy Outlook June 2003 Overview World Oil Markets. Average crude oil prices rose in May as continued reports of low oil inventories trumped expectations that Iraqi oil production would quickly return to pre-war levels. Those hopes faded on the news that post-war looting would postpone for some months the return of the Iraqi oil sector to normal operations. In addition, a terrorist attack in Saudi Arabia and estimates of lower production in Saudi Arabia by some analysts

  11. New060203NNSAEIS.doc

    National Nuclear Security Administration (NNSA)

    NEWS MEDIA CONTACTS: FOR IMMEDIATE RELEASE Joe Davis, 202586-4940 Monday, June 2, 2003 Brian Wilkes, 202586-7371 Modern Pit Facility Draft Environmental Impact Statement Issued ...

  12. ARM News &#187; Facility News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6:30:04 +0000 en ARM&acirc;&euro;&trade;s New Radar Operating Paradigm Aims to Maximize Performance Mon, 15 Aug 2016 06:30:04 +0000 Facility News <img src="" style="float:left;margin-right:5px;margin-bottom:5px"/><p>Maintaining the pulse of the radar network is vital to research Radars have been getting a lot of attention at ARM in the last few

  13. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  14. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  15. Sandia National Laboratories: News: Publications: Lab News: Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases Publications Media Contacts & Resources Events Video Image Gallery Facebook Twitter YouTube Flickr RSS Top Archive Annual Report Environmental Reports Fact Sheets Labs Accomplishments Lab News Archive Partnerships Annual Report Research Magazine HPC Annual Reports Search Sandia Publications Strategic Plan News Archive October 2, 2015 Lab News - The Martian author Andy Weir's path to success began at Sandia; and more. September 18, 2015 Lab News - Understanding materials is

  16. Neutron and Nuclear Science News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Recent news and events related to neutron and nuclear science at LANSCE. Neutron and Nuclear Science News Nuclear and Materials Science Research at LANSCE Nuclear science observations and opportunities at the Los Alamos Neutron Science Center Links Neutron and Nuclear Science News Media Links Profiles Events at LANSCE LAPIS (LANSCE Proposal Intake System

  17. News Releases - 2016

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases » News Releases - 2016 News Releases - 2016 We are your source for reliable, up-to-date news and information; our scientists and engineers can provide technical insights on our innovations for a secure nation. August» July» June» May» April» March» February» January» James TenCate James TenCate elected Acoustical Society of America fellow TenCate's research focuses on nonlinear acoustics and elasticity, seismology and nonlinear imaging. - 8/30/16 The thermal traits of a leaf,

  18. ARM - Facility News Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Archive Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and Releases Facility

  19. News Media | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Media Jefferson Lab's policy is to be open and forthright with the news media and all members of the general public. To assist in the dissemination of news information, the lab provides a variety of resources, which are listed below. If you seek additional information or can't find the information you are seeking, the members of the lab's Public Affairs staff are available to assist. Public Affairs also can help reporters find expert sources for science and technology-based stories. Media

  20. Magellan In the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In the News Magellan In the News October 20, 2011 Articles About Magellan @ NERSC June 7, 2011, The case of the missing proton spin, symmetrybreaking June 1, 2011, The case of the missing proton spin, International Science Grid This Week (ISGTW) March 28, 2011, Why high-performance clouds are best kept in-house, Government Computing News Dec. 3, 2010, 2010 Annual HPCwire Readers' Choice Awards, HPCwire Autumn, 2010, Sensing the Future of Greener Data Centers, HPCsource Nov. 30, 2010, A List of

  1. In the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In the News In the News MaRIE will provide a capability to address the control of performance and production of weapons materials at the mesoscale. MaRIE fills a critical gap in length scale between the integral scale addressed by studies conducted at DARHT, U1a, NIF, and Z. In the News Roadmap to MaRIE Los Alamos National Laboratory's proposed MaRIE facility is slated to introduce the world's highest energy hard x-ray free electron laser (XFEL). MaRIE Brochure Recruit (pdf) Roadmap for November

  2. ARM - News Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Center Media Contact Hanna Goss hanna-dot-goss-at-pnnl-dot-gov @armnewsteam Field Notes Blog Topics Field Notes117 AGU 3 AMIE 10 ARM Aerial Facility 2 ARM Mobile Facility 1 7 ARM Mobile Facility 2 47 ARM Mobile Facility 3 1 BAECC 1 BBOP 4 CARES 1 Data Quality Office 2 ENA 2 GOAMAZON 7 HI-SCALE 4 LASIC 3 MAGIC 15 MC3E 17 PECAN 3 SGP 8 STORMVEX 29 TCAP 3 Search News Search Blog News Center All Categories What's this? Social Media Guidance News Center All Categories Features and Releases Facility

  3. 2008 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search News Search December 11, 2008 Alternative Fuels and Advanced Vehicle Data Center Creates New Tool to Calculate Ways to Cut Gas Use A business owner with a fleet of 10 heavy-duty diesel trucks wants to cut diesel use by 10 percent. Would using a biodiesel blend or investing in onboard power sources that reduce engine idling achieve the biggest drop in petroleum use? An average

  4. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Past Platinum Award winner discusses LAESF impact in new podcast; Free admission for active-duty military, family members; High-angle canyon-side legacy cleanup; Santa Fe Radio Café replay June 1, 2015 Alicia Salazar-Crockett was the 2008 Platinum Award winner of the Los Alamos Employees' Scholarship Fund. On

  5. In other news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In other news Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue: September 1, 2016 all issues All Issues » submit In other news Everything you need to know about summer student housing, the new app for Manhattan Project National Historical Park, and more. April 4, 2016 The soon-to-be-released Secret City app will let visitors to downtown Los Alamos see how the landscape looked in the 1940s when it was a key technical area for the

  6. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News News OREM News UCOR's K-27 Building demolition project, pictured here, is ahead of schedule with actual costs projected to be less than planned, according to OREM's correspondence regarding the contractor's fee determination. EM's Oak Ridge Cleanup Contractor Earns 93 Percent of Available Fee July 28, 2016 12:45 PM OAK RIDGE, Tenn. - EM's cleanup contractor at the Oak Ridge site earned nearly $3.6 million for its performance from Oct. 1, 2015 to March 31, 2016, amounting to 93 percent of

  7. Media Corner - News Archive: 2010

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 News Archive: 2010 Catching up with Ned Sauthoff, ITER, and the Prince of Monaco [Knoxville News Sentinel, November 30, 2010] Foundation Stone for ITER [Knoxville News Sentinel, November 25, 2010] Engineer Gary Johnson helping expand future of fusion [Evansville Courier & Press, October 16, 2010] Support contracts for US ITER [Knoxville News Sentinel, August 21, 2010] ITER construction -- can you dig it? [Knoxville News Sentinel, August 8, 2010] New Director Shakes Up Management of Fusion

  8. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  9. Sandia National Laboratories: News and Events

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Events SECANT Leadership Invited Talks, Publications & Patents News & Events Research News and Events Upcoming Conferences QCrypt 2016: September 12th - 16th

  10. Los Alamos Science in the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News newsroomassetsimagesnewsroom-icon.jpg Los Alamos Science in the News Read about what other news sources are saying about Los Alamos science achievements. Water ...

  11. PPPL News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PPPL News Subscribe to RSS - PPPL News Image: PPPL News - a quarterly E-newsletter PPPL electronic newsletter (emailed directly to you) Please send an email to...

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2009 Facility News Turning a New Page with Facebook; Are You a Fan? Bookmark and Share Keep up with the ARM Climate Research Facilty via Facebook Keep up with the ARM Climate...

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2006 Facility News Precipitation Sensor on Duty at North Slope of Alaska Bookmark and Share The precipitation sensor was installed about 5 feet above the surface on the...

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Hellos and Goodbyes: IMB Organizational Changes Bookmark and Share Left to right: Doug Sisterson and Raymond McCord Left to right: Doug Sisterson and Raymond McCord...

  15. NERSC In the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    | Author(s): Timothy Stenovec | Source: Huffington Post | Supernova Burns Bright in a Galaxy Not So Far Away September 7, 2011 | Author(s): Jeffrey Brown | Source: PBS News Hour |...

  16. Water Power Program News

    SciTech Connect (OSTI)


    News stories about conventional hydropower and marine and hydrokinetic technologies from the U.S. Department of Energy, the Office of Energy Efficiency and Renewable Energy, the Wind and Water Power Program, and other federal agencies.

  17. EFRC News & Events

    Office of Science (SC) Website

    nanotechnology, EFRC researchers fashion a new kind of transparent electrode for flat-panel displays. This work, featured in the Office of Sciences news...

  18. Water Power News

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    858936+791+7+343Water Power News en Energy Department Awards 10.5 Million for Next-Generation Marine Energy Systems http:energy.goveerearticlesenergy-department-awards-105-...

  19. September2015News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Special News & Events Museum Now Offering Public WiFi This ... it will offer this service in its galleries. "We know ... biology and biophysics group, Ruy Ribeiro has been ...

  20. ARM - Black Forest News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Black Forest News ARM Mobile Facility Completes Field Campaign in Germany January 15, 2008 Microwave Radiometers Put to the Test in Germany September 15, 2007 Zeppelin NT Flies for ...

  1. News Releases Feed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 cool science and technology stories from Argonne in 2015 http:www.anl.govarticles10-cool-science-and-technology-stories-argonne-2015 December 23, 2015 News Releases Feed...

  2. In The News Feed

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    -just-won-t-die-1.18685 November 4, 2015 In The News Feed Perspective: The energy-storage revolution http:www.nature.comnaturejournalv526n7575suppfull526S92a.html November...

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 19, 2015 Facility News New ASR Program Manager Selected Bookmark and Share Dr. Shaima Nasiri, ASR Program Manager, U.S. Department of Energy Dr. Shaima Nasiri, ASR Program...

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2014 Facility News First MAGIC Workshop Discusses Future of Marine Clouds Bookmark and Share MAGIC route with June-July-August average low-level cloud cover, GPCI transect,...

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 2015 Facility News Submit Your AGU Presentation to ARM and ASR Bookmark and Share Submit your AGU presentations or posters by November 2 and we'll help get people to your...

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2009 Facility News Internet Upgrade Speeds Data Transfer from Tropics Bookmark and Share http:images.arm.govarmimagesMMCR0MMCR.mpgView this video to see how the...

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 28, 2010 Facility News First Data from Darwin Raman Lidar Bookmark and Share Since 1996, the ARM Southern Great Plains site has maintained one of the few operational...

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2006 Facility News New NSA Site Manager Named; Science Liaison Joins the Team Bookmark and Share Dr. Mark Ivey to be NSA Site Manager beginning October 1. As of October 1, Dr. ...

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News New Shortwave Spectroradiometer Deployed at SGP Bookmark and Share A ceiling port in the SGP Optical Trailer houses the optic element of the SWS, which connects to the...

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 8, 2008 Facility News See ARM Data in a New Light Bookmark and Share Two new visualization tools are now available from the ARM Data Archive to help you plot and package...

  11. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EnergyPlus and OpenStudio. September 29, 2015 News The World's Largest 3D Printed House at EERE Industry Day Complexity, customization and cost are three of the most...

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 6, 2010 Facility News New Raman Lidar En Route to Australia Bookmark and Share Since 1996, the ARM Southern Great Plains site has maintained one of the few operational...

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2009 Facility News Smart Filter Clears the Way for Speedy Data Transfer Bookmark and Share These data plots illustrate the results of the smart filter in reducing the volume...

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 31, 2008 Facility News Interagency Land Use Agreement Signed for North Slope of Alaska Bookmark and Share As scientific neighbors on Alaska's North Slope, the ARM site at...

  15. 2009 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Search News Search December 23, 2009 New NREL Web Site Helps Campuses Go Green The U.S. Department of Energy's National Renewable Energy Laboratory and Cornell University have ...

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 15, 2007 Facility News Kelle Smith Replaces Jan Gunter as ExtraView Administrator Bookmark and Share Kelle Smith assumed the duties of ExtraView administrator after Jan ...

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2010 Facility News TWP Site Scientist Selected for Journal's Editorial Board Bookmark and Share Dr. Long was recently selected as a member of the editorial board of The Open...

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    13, 2006 Facility News Dr. Steve Ghan Appointed to Journal of Geophysical Research Editorial Board Bookmark and Share Dr. Steve Ghan was recently appointed as an editor for the...

  19. ARM - LASIC - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govCampaignsLASIC: Layered Atlantic Smoke Interactions with CloudsNews & Press Campaign Links Science Plan Backgrounder Baseline Instruments and Data Plots Total Carbon Column Observing Network (TCCON) Ascension Island Site TCCON Ascension Data News & Press Related Campaigns LASIC: Layered Atlantic Smoke Interactions with Clouds - Cloud Radar at St. Helena 2017.08.01, Zuidema, AMF LASIC: Layered Atlantic Smoke Interactions with Clouds - Supplemental Measurements 2016.06.01, Zuidema, AMF

  20. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Media » News News July 16, 2015 DOE Announces Webinars on the SunShot Catalyst Prize Program, Regional Impacts of Climate Change, and More EERE offers webinars to the public on a range of subjects, from adopting the latest energy efficiency and renewable energy technologies, to training for the clean energy workforce. Webinars are free; however, advanced registration is typically required. You can also watch archived webinars and browse previously aired videos, slides, and transcripts. May 22,

  1. Materials in the news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Materials in the news Discover more about the wide-ranging scope of materials research at Los Alamos National Laboratory. Contact Us ADEPS Communications Email Scientists Aditya Mohite, left, and Wanyi Nie are perfecting a crystal production technique to improve perovskite crystal production for solar cells Scientists Aditya Mohite, left, and Wanyi Nie are perfecting a crystal production technique to improve perovskite crystal production for solar cells Read more... Materials science at Los

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 31, 2010 [Facility News] STORMVEX Science Team Confirms Site Plans; Outreach Begins at Weather Summit Bookmark and Share Dr. Ashley Williamson introduces the STORMVEX campaign to Weather Summit attendees. Dr. Ashley Williamson introduces the STORMVEX campaign to Weather Summit attendees. In late January, meteorologists from a dozen major news markets across the country gathered in Steamboat Springs, Colorado, for an annual event called the "Weather Summit" where they received a

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20, 2010 [Facility News] ARM Mobile Facility Blogs from Steamboat Springs Bookmark and Share This month, team members for the second ARM Mobile Facility (AMF2) are in Steamboat Springs, Colorado, preparing for the Storm Peak Lab Validation Experiment, or STORMVEX. Follow their progress on the AMF2 blog, as they install instrumentation at three sites on Mount Werner. This is the first topic for the ARM News Center blog, which was developed to share a variety of ARM stories and experiences. Be

  4. WIPP News Releases - 2006

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Back to current year news releases 2006 News Releases December 12 Idaho National Laboratory Waste Stream Cleared for Shipment to WIPP November 15 WIPP Reaches 4-Million-Hour Safety Milestone October 16 State of New Mexico Issues Permit for Remote-Handled Waste at WIPP September 11 WIPP receives 5,000th shipment March 29 DOE Waste Isolation Pilot Plant Receives EPA Recertification

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 15, 2009 [Facility News] Outreach Display Awarded for Communications Excellence Bookmark and Share The ARM display received the Gold Hermes Creative Award in 2009 for exemplifying communications excellence. The ARM display received the Gold Hermes Creative Award in 2009 for exemplifying communications excellence. As the ARM Climate Research Facility prepares to participate in the coming round of winter meetings, now is a good time to share news of the two industry awards its display

  6. In the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the news In the News January 26, 2015 Lawrence Livermore research finds early Mesoamericans affected by climate change February 21, 2014 Current ice melt rate in Pine Island Glacier may go on for decades February 4, 2014 Liquid sample AMS patent awarded to CAMS staff December 15, 2013 Change in Pacific nitrogen content tied to climate change July 23, 2013 Lawrence Livermore celebrates 25 years of carbon dating July, 2013 Carbon dating impacts non-proliferation, drug research and climate

  7. 1995 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search NREL Funding Reductions to Further Impact Lab's Work Force (12/22/95) World Renewable Energy Congress To Be Held In Denver In 1996 (12/18/95) NREL Researchers Use Sunlight to Power Laser (12/14/95) National Renewable Energy Laboratory To Reduce Staff (11/3/95)

  8. 1998 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search Popular Science Recognizes Innovative Solar Technologies - (12/16/98) Kazmerski Leads National Center for Solar Research - (12/1/98) MRI, Battelle and Bechtel to Manage National Renewable Energy Lab - (11/19/98) Prestigious Council to Advise National Renewable Energy Lab - (11/19/98) Tour Opens Doors, Minds to Solar Energy - (10/5/98) MRI, Battelle, Bechtel Team Wins National

  9. 2002 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search Director of National Bioenergy Center Named - (12/12/02) Scientific American' Recognizes Solar Cell Research - (11/11/02) UPS Fleet Study Quantifies the Reliability, Low Emissions of CNG Trucks - (10/29/02) Energy Department Honors Solar Decathlon Winners - (10/05/02) Winner of Solar Decathlon to be Announced - (10/04/02) Solar Decathlon Engineering Design Results Announced -

  10. News and Highlights

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News and Blog News and Blog August 25, 2016 OE Announces Investment in New Research to Address Risk and Uncertainty in the Grid Today, as part of the Energy Department's commitment to a reliable and resilient power grid, the Office of Electricity Delivery and Energy Reliability (OE) is investing nearly $1.8 million in fundamental research to address the risk and uncertainty of the power system. This support will allow academic institutions in California, Iowa, New York, and Texas to perform

  11. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News News RSS August 4, 2016 Image: NREL. Excitement around the Data Surge App Showcase The Data Surge App Showcase during this year's Better Buildings Summit was filled with excitement as attendees were given the opportunity to vote in real-time for their favorite apps. Several innovative SEED Platform Collaborative Technical Allies presented software instances developed to harness data collected through the SEED Platform(tm). August 4, 2016 Berkeley Lab's Reshma Singh presents JUMP calls for

  12. 2009 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    09 News Below are news stories related to Bioenergy. RSS Learn about RSS. November 5, 2009 NREL's Clean Energy Forum Attracts National Investment Community The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) 22nd Clean Energy Industry Growth Forum this week attracted nearly 600 investors, entrepreneurs, scientists and policymakers to Denver. October 13, 2009 Web Portal Makes Finding Ways to Drive Green Even Easier The U.S. Department of Energy's (DOE) National Renewable

  13. 2010 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 News Below are news stories related to Buildings. RSS Learn about RSS. November 29, 2010 IEEE Honors DeBlasio with Steinmetz Award Richard DeBlasio, chief engineer for renewable electricity and end use systems with the U.S. Department of the Energy's National Renewable Energy Laboratory (NREL), will be honored by IEEE (Institute of Electrical and Electronics Engineers), the world's largest technical professional association, with the 2010 Charles Proteus Steinmetz Award. The award will be

  14. 2011 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 News Below are news stories related to Bioenergy. RSS Learn about RSS. October 3, 2011 NREL Issues RFI on Integrated Biorefinery Research Facility Services and Capabilities NREL seeks feedback from industry, academia, and other stakeholders on methods of working with the Integrated Biorefinery Research Facility (IBRF). June 2, 2011 Science & Industry Peers Turn to NREL for Biomass Solutions The biomass industry looks to the U.S. Department of Energy's National Renewable Energy Laboratory

  15. 2012 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Below are news stories related to Bioenergy. RSS Learn about RSS. December 14, 2012 NREL and Johnson Matthey Announce Five-Year Collaboration on Biofuels The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) will partner with Johnson Matthey, a global specialty chemicals company, in a five-year, $7 million effort to economically produce drop-in gasoline, diesel and jet fuel from non-food biomass feedstocks, the federal laboratory announced today. November 26, 2012

  16. 2012 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Below are news stories related to Buildings. RSS Learn about RSS. November 20, 2012 NREL's Research Support Facility Garners Second LEED® Platinum The Research Support Facility (RSF) on the campus of the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) in Golden, Colo. has earned its second LEED® Platinum designation for new construction from the U.S. Green Building Council (USGBC), a non-profit organization dedicated to sustainable building design and

  17. 2013 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Below are news stories related to Bioenergy. RSS Learn about RSS. November 7, 2013 NREL Developed Mobile App for Alternative Fueling Station Locations Released iPhone users now have access to a free application that locates fueling stations offering alternative fuels, including electricity, natural gas, biodiesel, e85 Ethanol, propane and hydrogen. The Energy Department's (DOE) National Renewable Energy Laboratory (NREL) developed the new mobile application for DOE's Clean Cities program.

  18. 2013 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Below are news stories related to Buildings. RSS Learn about RSS. November 6, 2013 NREL's Energy Systems Integration Facility Garners LEED® Platinum The Energy Systems Integration Facility (ESIF) on the campus of the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) in Golden, Colo., has earned a LEED® Platinum designation for new construction from the U.S. Green Building Council (USGBC), a non-profit organization dedicated to sustainable building design and

  19. 2014 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 News Below are news stories related to Bioenergy. RSS Learn about RSS. October 31, 2014 Reviving Algae from the (Almost) Dead NREL's cryogenic tank holds 500 dormant algae samples, and each must ease back into life. October 30, 2014 Industry Growth Forum Cultivates Clean Energy Entrepreneurship NREL's Industry Growth Forum brings together clean energy entrepreneurs and investors to facilitate the movement of innovation into the marketplace. September 19, 2014 NREL Industry Growth Forum

  20. 2014 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 News Below are news stories related to Buildings. RSS Learn about RSS. December 23, 2014 NREL Receives Editors' Choice Awards for Supercomputer Research Two prestigious scientific magazines have awarded the Energy Department's National Renewable Energy Laboratory (NREL) with Editors' Choice awards for the Peregrine high-performance computer and the groundbreaking research it made possible. December 18, 2014 Three New Fellows to Help Guide NREL Research The Energy Department's National

  1. 2015 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 News Below are news stories related to Buildings. RSS Learn about RSS. April 29, 2015 NREL Announces Participants for Executive Energy Leadership Program The Energy Department's National Renewable Energy Laboratory (NREL) has selected 21 leaders to participate in its 2015 Executive Energy Leadership program (Energy Execs), which empowers executives to integrate clean energy solutions in their communities. April 27, 2015 NREL Report Estimates Market Potential of Shared Solar and Discusses

  2. News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    About Us » News News Press Releases June 28, 2016 Corps of Engineers, SEPA, TVA, and TVPPA sign memorandum of agreement Corps of Engineers, SEPA, TVA, and TVPPA sign memorandum of agreement October 1, 2013 ENERGY EFFICIENCY AND RENEWABLE ENERGY REPORT - FY 2013 In 2013 the program operated above the 6 year average and 6 year high, and participation increased by adding 13 new program locations. Southeastern Power Administration and its partners conducted 32 training events which directly

  3. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  4. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  5. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  6. Nevada Field Office News News Media Contact: For Immediate...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Field Office News News Media Contact: For Immediate Release: Darwin J. Morgan, ... 702-295-2836 NEVADA SCIENCE BOWL TO CROWN CHAMPION THIS ...

  7. Nevada Field Office News News Media Contact: For Immediate...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Field Office News News Media Contact: For Immediate Release: Darwin J. Morgan, ... 702-295-3521 Nevada Middle School Students Ready for Nevada ...

  8. Nevada Field Office News News Media Contact: For Immediate...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nevada Field Office News News Media Contact: For Immediate Release: Darwin J. Morgan, DAVIDSON ACADEMY OF NEVADA WINS 2016 NEVADA SCIENCE BOWL Dozens of ...

  9. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  10. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  11. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  12. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  13. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  14. October 2013 News Blast | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    October 2013 News Blast October 2013 News Blast October 2013 News Blast october_2013_newsblast.pdf (326.2 KB) More Documents & Publications September 2013 News Blast BETO Monthly News Blast, August 2013r BETO Monthly News Blast, June 2013

  15. News & Blog | Department of Energy

    Energy Savers [EERE]

    About News & Blog News & Blog Blog Plants capture CO2 and convert it into ... found a way to recycle CO2 back into fuel, much the same way plants absorb and convert it. ...

  16. NREL: Energy Systems Integration - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Stay up-to-date with the latest energy systems integration news from NREL with the following resources. Energy Systems Integration Newsletter Read a monthly recap of NREL's...

  17. Sandia National Labs: PCNSC: News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Awards Featured Projects News Releases Partnering Research News The Solid State Lighting Science Energy Frontier Research Center (SSLS EFRC) entered a video competition for the DOE EFRC Summit and Forum. The 3-minute video explores the science behind enabling greater energy efficiency, and features George Wang and Tania Henry." Awards Featured Projects News Releases Archives News Releases 2011 (Coming Soon)

  18. Princeton Plasma Physics Laboratory News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    archive Princeton Plasma Physics Laboratory news feed en PPPL physicists simulate innovative method for starting up tokamaks without...

  19. April 2013 Monthly News Blast

    Broader source: [DOE]

    The monthly news blast for April 2013 highlights the Project Peer Review, upcoming events, BETO blog posts, and more.

  20. DOE - NNSA/NFO -- News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News News Releases News releases on events occurring at the NNSA Nevada Field Office or the Nevada National Security Site are produced by the Office of Public Affairs. All releases include contact information for the public affairs officer who produced the release. The current calendar year News Releases are listed below. NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office NNSA Awards Nevada National Security Site Management & Operating Contract to NVS3T Contract Award Provides

  1. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) PPPL launches expanded new laboratory for research on the use of plasma to synthesize nanoparticles Click on an image below to view the high resolution image. Then right click on the image and

  2. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) Terry Brog, new deputy director for operations, has focus on excellence Click on an image below to view the high resolution image. Then right click on the image and select "Save Image" or

  3. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) PPPL researchers combine quantum mechanics and Einstein's theory of special relativity to clear up puzzles in plasma physics Click on an image below to view the high resolution image. Then right

  4. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) Students do cool summer research projects in one of the hottest spots Click on an image below to view the high resolution image. Then right click on the image and select "Save Image" or

  5. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) New books by PPPL physicists Hutch Neilson and Amitava Bhattacharjee highlight magnetic fusion energy and plasma physics Click on an image below to view the high resolution image. Then right click

  6. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Press Releases Archive Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Press Releases Archive Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) New books by PPPL physicists Hutch Neilson and Amitava Bhattacharjee highlight magnetic fusion energy and plasma physics Click on an image

  7. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton Events Research Education Organization Contact Us News Room News Archive American Fusion News Press Releases Publications Princeton Journal Watch Blog PPPL Experts Research at Princeton News Primary tabs View High Resolution(active tab) PPPL wins contract for plasma-materials interaction studies on EAST tokamak Click on an image below to view the high resolution image. Then right click on the image and select

  8. NREL: Solar Research - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News The following news stories highlight solar research, technologies, and resources. Subscribe to the RSS feed RSS . Learn about RSS. May 31, 2016 NREL Names a Director's Fellowship in Honor of Art Nozik The Nozik Fellowship is available to early-career researchers who earned their Ph.D. in the last two years. May 25, 2016 Keith Emery Repeats on List of Highly Cited Researchers This award reflects the growth and success of the PV industry as well as NREL's important role providing efficiency

  9. News & Events

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Events News & Events at the Bradbury Science Museum Read about all the latest news and events thumbnail of (505) 667-4444 Email Linda's talk stressed that both past and present are important to the Lab's future. In our latest newsletter Linda Deck Linda Deck (the Museum's director) was the leading speaker at this year's TEDxLANL event. Museum director featured during TEDxLANL event On May 19, Linda Deck, director of the Bradbury Science Museum, delivered a talk during the Lab's third

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YouTube© Channel and Flickr® Added to Outreach Tools Bookmark and Share Look for ARM's new social media bar on the front page and in the ARM News Center. Look for ARM's new social media bar on the front page and in the ARM News Center. Starting this summer, the ARM Communications Team began moving archived ARM photo and video content into both Flickr and YouTube, respectively. These popular and cost-effective social media outlets join ARM's existing Facebook and Twitter accounts, providing

  11. In the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the news In the News 2016 July 6, 2016 How heavier elements are formed in star interiors Cosmologist Carl Sagan called it "starstuff"-the basic elements of the universe created in the nuclear furnaces in the core of the sun and the stars. Nucleosynthesis, the process by which those elements are assembled, is the subject of a new series of NIF Discovery Science experiments which began on May 30. ( June 24, 2016 Scientists Are Trying to Make Nuclear Fusion with Frickin'

  12. WIPP News & Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Information WIPP Overview Click on the Play button for an overview of the Waste Isolation Pilot Plant. (2.5 minutes, FLASH required) If you are not able to view the WIPP Overview, try clicking the graphic above to download the free Flash Player. News Releases Current and archived news releases TRU TeamWorks Read WIPP's online newsletter Fact Sheets Learn about WIPP basics with these educational summaries of popular topics Photo Gallery See photos of the work done at WIPP

  13. 1996 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search Companies Selected for Small Wind Turbine Project - (11/27/96) DOE Forms National Center for Photovoltaics - (11/19/96) The Brightest in Solar Homes to Shine in Public Tour - (10/4/96) New NREL Research Facility Slashes Energy Use by 66 Percent - (10/3/96) Agreement Moves Nevada Solar Plant Step Closer to Reality - (10/3/96) Would-Be Solar Electric Homeowners Sought For

  14. 1997 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search Local Middle School Receives School-to-Career Grant - (12/24/97) Free Consumer Workshops On Solar & Wind Power For Farm & Ranch At National Western Stock Show - (12/9/97) NREL Funds Research into Low-Cost Solar Electricity - (12/8/97) NREL Provides PV Holiday Lights for Christmas Tree - (12/2/97) Energy Saving Buildings Win National and Local Honors - (11/21/97)

  15. 1999 News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 News Releases Access news stories about the laboratory and renewable energy and energy efficiency technologies. Search Sunlight Helps Laboratory Get Ready for Y2K - (12/27/99) NREL Hosts Free Workshops on Solar and Wind Energy - (12/15/99) Seminar Explores Benefits of Using Solar Power for Disaster Management - (11/17/99) Choices for a Brighter Future - (11/12/99) Better "Bugs" Lead to Cheaper Ethanol from Biomass - New Agreements Could Boost U.S. Biofuels Industry - (11/10/99)

  16. 2010 News | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 News Below are news stories related to Bioenergy. RSS Learn about RSS. October 14, 2010 Three NREL Biofuels Experts Make "Top 100 People in Bioenergy" List Three scientists from the U.S. Department of Energy's National Renewable Energy Laboratory have been named among Biofuels Digest's "Top 100 People in Bioenergy" for 2010. Tom Foust, Al Darzins, and Phil Pienkos were selected as bioenergy leaders through a two-week Biofuels Digest reader poll that garnered more than

  17. 2011 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 News Below are news stories related to Buildings. RSS Learn about RSS. December 30, 2011 St. Thomas Airport Installs Largest Solar Project in U.S. Virgin Islands Solar energy is making its mark in the U.S. Virgin Islands (USVI), as evidenced by the large-scale solar photovoltaic (PV) system installed at the Cyril E. King Airport on St. Thomas. December 13, 2011 NREL Employees Recognized by Industry Peers Trade media and industry groups recently have honored several employees at the U.S.

  18. WIPP News Releases - 2002

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Releases September 30 Westinghouse Earns Mine Safety Award for 16th Consecutive Year July 9 Westinghouse TRU Solutions LLC Earns Corporate Award For Air Monitoring Initiative April 12 WIPP Receives Waste Characterized With Mobile System February 12 Ava Holland Joins DOE Carlsbad Field Office As Quality Assurance Manager January 7 WIPP Receives 500th Waste Shipment

  19. Subscribe to Wind Program News Updates | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News Subscribe to Wind Program News Updates Subscribe to Wind Program News Updates The Office of Energy Efficiency and Renewable Energy (EERE) offers multiple news services that ...

  20. BETO Monthly News Blast, August 2013r | Department of Energy

    Broader source: (indexed) [DOE]

    BETO Monthly News Blast from August 2013 august2013newsblast.pdf More Documents & Publications Monthly News Blast: March 2013 BETO Monthly News Blast, June 2013 Monthly News...

  1. Alternative Fuels Data Center: News and Features

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    News and Features to someone by E-mail Share Alternative Fuels Data Center: News and Features on Facebook Tweet about Alternative Fuels Data Center: News and Features on Twitter Bookmark Alternative Fuels Data Center: News and Features on Google Bookmark Alternative Fuels Data Center: News and Features on Delicious Rank Alternative Fuels Data Center: News and Features on Digg Find More places to share Alternative Fuels Data Center: News and Features on More in this section...

  2. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  3. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  4. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  5. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  6. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  7. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  8. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  9. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  10. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  11. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  12. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  13. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  14. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  16. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  17. Ammendment 2.doc | Department of Energy

    Broader source: (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  18. Sandia National Laboratories: News: Publications: Lab News: Archive

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    details safety, security methods for biosciences sites; Workhorse gamma ray generator HERMES III reaches significant milestone; and more. August 21, 2015 Lab News -...

  19. Sandia National Laboratories: News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News 2016 PPM work featured in book chapter PPM Team Member Highlighted in 2016 Sandia Recruiting Video 2015 PPM Member receives national recognition PPM Member serves on national roadmapping study for modeling across length scales Members of PPM speak at the National Academies Workshop on Additive Manufacturing 2014 Studying materials at the breaking point. May 2014 Computer model used in softening steel. April 2014 2013 Density Functional Theory (DFT) provides ab-initio, electronica structure

  20. NERSC in the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Top500 List Released July 7, 2009 | Source: HPCWire | The TOP500 Supercomputer Sites is compiled by Hans Meuer of the University of Mannheim, Germany; Erich Strohmaier and Horst Simon of NERSC/Lawrence Berkeley National Laboratory; and Jack Dongarra of the University of Tennessee, Knoxville. New Way to Determine Protein Structures Revealed July 23, 2009 | Source: SciCasts: SciTech Trade News Network | Department of Energy's (DOE) Lawrence Berkeley National Laboratory have developed a fast and

  1. NREL: Energy Analysis - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bookmark and Share News The Decision Insight and Market Impacts newsletter highlights the lab's analysts and analysis activities in renewable energy and energy efficiency technologies are having an impact on U.S. energy goals. The newsletter features recent publications and websites, updates to our models and tools, and staff activities. You can subscribe to receive the newsletter monthly by email. March 2016 NREL is the nation's leader in clean energy technologies, practices, and strategies.

  2. NREL: Wind Research - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Below are some select news stories from the National Wind Technology Center. Subscribe to the RSS feed RSS . Learn about RSS. August 29, 2016 NREL Research Puts the Wind at an Industry's Back NREL collaboration with industry partners brings wind energy that is more reliable, more affordable, and better for the environment. July 22, 2016 NREL's Kurtz, Tegen Honored for Clean Energy Leadership The U.S. Clean Energy Education & Empowerment (C3E) program has honored Sarah Kurtz and Suzanne Tegen

  3. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BROCHURES & NEWSLETTERS CNM Overview Brochure CNM Fact Sheet News Research Highlights A magnetic charge ice with nanoscale magnets arranged in a two-dimensional lattice. Each nanomagnet produces a pair of magnetic charges, one positive (red ball on the north pole) and one negative (blue ball on the south pole). The magnetic flux lines (white) point from positive charges to negative charges. (Image credit: Yonglei Wang and Zhili Xiao) Rewritable Artificial Magnetic Charge Ice Full Story » An

  4. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Several different remediation processes are available to clean up soil, varying in efficiency, cost and sustainability for specific site conditions. When officials suspect a site is contaminated, they conduct an assessment to determine the pollutant, the extent of contamination and the appropriate method to remediate the soil. (Click image to enlarge.) Five ways scientists can make soil less dirty Full Story » Argonne's Applied Geosciences and Environment Management Program evaluates

  5. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Argonne National Laboratory to Lead U.S. Consortium for Medium- and Heavy-Duty Truck Technical Track Full Story » The U.S. Several different remediation processes are available to clean up soil, varying in efficiency, cost and sustainability for specific site conditions. When officials suspect a site is contaminated, they conduct an assessment to determine the pollutant, the extent of contamination and the appropriate method to remediate the soil. (Click image to enlarge.) Five ways

  6. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News "I was interested in mathematics and problem solving from a very early age," said Katrin Heitmann, a computational physicist and computational scientist in Argonne's high energy physics department. Women in STEM careers: Breaking down barriers Full Story » Three Argonne researchers share their experiences, why they pursued STEM careers, and how they're continuing to help the next generation of scientists and engineers to flourish. What might precipitation over the United States

  7. News | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Researchers with the Argonne Center for Collaborative Energy Storage Science (ACCESS) will partner with industry to improve lead-acid battery performance. (Photo: Shutterstock) Lead-acid battery companies join forces with Argonne National Laboratory to enhance battery performance Full Story » Exploring the unrealized potential of lead batteries is the goal of a new collaboration between Argonne National Laboratory and two leading lead recycling and lead battery manufacturing companies, RSR

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 21, 2014 [Facility News] ARM Facility Embarks on Expansion in the United States Bookmark and Share A reconfiguration plan is being set in motion for the ARM Facility that will result in even better observations of atmospheric processes at the SGP site. A reconfiguration plan is being set in motion for the ARM Facility that will result in even better observations of atmospheric processes at the SGP site. Through 20 years of measurements at its observations sites around the world, the ARM

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 18, 2016 [Facility News] Next Round of Deadlines for Small Campaigns Coming Up Bookmark and Share The next deadline to propose for smaller field campaigns will be August 22. Small campaigns do not require a full deployment of ARM Facility equipment, like an ARM mobile or aerial facility. They require just an instrument or two, or are in conjunction with a larger facility operation. Costing less than $25,000, these campaigns give researchers access to ARM's equipment to perform focused,

  10. Sandia National Laboratories: News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Detecting biothreat agents Likely applications in emergency rooms. Detecting biothreat agents Taking tech to the private sector Bringing lab experience to world of business. Bringing lab experience to world of business World's largest fiber optic network New network saves energy, money. World's largest fiber optic network Improving high-temperature electronics An alloy suitable for extreme environments. Improving high-temperature electronics Featured Images Featured Video Featured

  11. ARM - News & Press

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Campaign (ISDAC)News & Press Related Links ISDAC Home AAF Home AVP Aircraft Instrumentation, October 14-16, 2008 ARM Data Discovery Browse Data Post-Campaign Data Sets Flight Summary Table (PDF, 440K) ISDAC Wiki Mission Summary Journal Deployment Resources NSA Site ARM Data Plots Quick Links Experiment Planning ISDAC Proposal Abstract Full Proposal (pdf, 1,735K) Science Questions Science Overview Document for ISDAC (pdf, 525K) ISDAC Flight Planning Document (PDF, 216K) Collaborations

  12. ALS in the News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the News Print Recent Articles Featuring ALS Staff and Science 2015 February New Video: Berkeley Lab's "Who We Are" Grants Give Particle Accelerator Technologies a Boost Details on Presidential Budget Request for DOE R&D DOE Scientists Team up to Demonstrate Scientific Potential of Big Data Infrastructure January Timeline Chronicles Lab's Science Highlights in 2014 (...and the ALS is well represented!) New Lithium-Ion Battery Discovery Contradicts Everything You Thought You Knew

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2007 [Facility News] Science Teams Gather to Plan Arctic Field Campaigns in Fiscal Year 2008 Bookmark and Share The primary measurement platform for both campaigns is a Convair-580, a large twin-engine turboprop. (NRC photo) With less than a year to prepare, scientists representing the ARM Program met in May in Ottawa, Canada, with colleagues from Environment Canada and the National Research Council of Canada to begin planning in earnest for two concurrent field campaigns taking place in

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    18, 2006 [Facility News] ARM External Data Center Celebrates Ten Years of Service Bookmark and Share External Data Center was recognized for 10 years of service In celebration of its tenth year of operation, the ARM External Data Center (XDC), which is managed by Brookhaven National Laboratory, was recently recognized for its outstanding contribution to the scientific user community. The XDC collects and processes data from other climate monitoring and research programs to supplement the data

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    GEWEX Touts ARM Data Sets for Climate Assessment Activities Bookmark and Share ARM data sets are featured in the latest issue of GEWEX News. In the latest newsletter of the Global Energy and Water Cycle Experiment (GEWEX), the opening commentary features the use of data acquired from the ARM Climate Research Facility's Southern Great Plains site. The detailed data sets are described as a "benchmark against which [global climate model] GCM developers can compare their model codes for

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 15, 2008 [Facility News] Global Earth Observations Portal Provides Gateway to ARM Data Bookmark and Share The GEOSS is simultaneously addressing nine areas of critical importance to society, ranging from managing energy resources and promoting sustainable agriculture to improving weather forecasts and responding to climate change and its impacts. The GEOSS is simultaneously addressing nine areas of critical importance to society, ranging from managing energy resources and promoting

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2009 [Facility News] Fast Physics Project to Join ARM User Community Bookmark and Share In November, ARM representatives participated in a kickoff meeting for the FASTER (FAst-physics System TEstbed and Research) project at Brookhaven National Laboratory. This project is funded by the DOE Earth System Modeling program and involves ten institutions led by BNL. Researchers involved in the FASTER project will assess and improve fast processes in climate models using a combination of single

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2009 [Facility News] Town Hall Meeting at AGU 2009 Fall Meeting Bookmark and Share ARM Climate Research Facility - New Measurement Capabilities for Climate Research Thursday, December 17, 6:15-7:15 pm, Moscone West Room 2002 American Recovery and Reinvestment Act American Recovery and Reinvestment Act Scientists from around the world use data from the ARM Climate Research Facility to study the interactions between clouds, aerosol and radiation. Through the American Recovery and Reinvestment

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31, 2006 [Facility News] New Operations Status System Improves Tracking, Reporting Bookmark and Share Environmental conditions at the ARM sites, like this one in Alaska, contribute to the challenge of managing an extensive array of sophisticated instruments. With heavily instrumented research sites around the globe, the ARM faces a daunting operations and reporting challenge. To better track and report the status of the capabilities at these widely disbursed sites, ARM operations staff recently

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 28, 2010 [Facility News] Footprint Adjustments Underway at Southern Great Plains Site Bookmark and Share Upon completion of the SGP footprint reduction, extended facilities 9, 11, 12, 15 and 21 will remain intact, along with the Central Facility (C1) near Lamont. Instrumentation at the remaining sites will be consolidated into the new, smaller footprint. Facilities closed thus far are colored black. Upon completion of the SGP footprint reduction, extended facilities 9, 11, 12, 15 and 21

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 10, 2010 [Facility News] Atmospheric System Research Funding Opportunity Announced Bookmark and Share The U.S. Department of Energy's Office of Science is now accepting applications for Office of Biological and Environmental Research (BER) research grants for the development of innovative laboratory and observational data analyses. The resulting knowledge from such analyses will be used to improve cloud and aerosol formulations in global climate models. If the application is successful,

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 15, 2006 [Facility News] New Micropulse Lidars to Replace Old Ones; Deployments Begin at SGP Bookmark and Share A representative from Sigma Space Corporation demonstrates the operation of the new micropulse lidar to ARM instrument mentors and site operations technicians. On May 3, the first of seven new and upgraded micropulse lidars (MPLs) was deployed at the ARM Southern Great Plains (SGP) site's Central Facility. These seven identical systems (including one spare) will replace the

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 15, 2010 [Facility News] Closing in on Aircraft Campaign in California Bookmark and Share This preliminary flight plan illustrates an afternoon flight to sample aged air from the Bay Area and Sacramento. This preliminary flight plan illustrates an afternoon flight to sample aged air from the Bay Area and Sacramento. In preparation for the upcoming Carbonaceous Aerosol and Radiative Effects Study (CARES) in California, the ARM Aerial Facility is putting the finishing touches on research

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    26, 2010 [Facility News] ARM Science Board Welcomes New Members Bookmark and Share Several new members have joined the ARM Science Board. This eleven-member board is an independent body that reviews proposals for use of the ARM Climate Research Facility. The board is preparing to review the recently received proposals for the FY2012 campaigns and will be meeting in August. Thanks to the following outgoing Science Board members for their service. Dr. Dave Bader, Lawrence Livermore National

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 28, 2006 [Facility News] Network of Infrared Thermometers Nearly Complete at SGP Bookmark and Share Red dots indicate extended facilities at SGP with the new IRTs installed; green dots indicate future installations. As reported in April 2005, a network of infrared thermometers (IRT) is being installed throughout the ARM Southern Great Plains (SGP) site for the purpose of measuring cloud base temperature and inferring cloud base height across the domain. These measurements will enhance

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 30, 2010 [Data Announcements, Facility News] Tandem Differential Mobility Analyzer (TDMA) Data Available at the ARM Data Archive Bookmark and Share Dry samples are collected by the aerosol stack and transferred inside the Aerosol Observation System structure to the TDMA where they are exposed to humidity for growth rate sampling. For more details on how the TDMA works, see this schematic. Dry samples are collected by the aerosol stack and transferred inside the Aerosol Observation System

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31, 2010 [Facility News] Instruments on Mt. Pico to Supplement Measurements from Graciosa Island Bookmark and Share At an elevation of about 2225 meters-usually above the marine boundary layer-the Pico Observatory is able to measure properties in the atmosphere transported from North America and Europe. Located high on Mount Pico in the Azores, the University of the Azores, the University of Colorado, and Michigan Technological University operate an instrumented observation station, the Pico

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 31, 2010 [Facility News] Scientists Convene at SGP Site for Complex Convective Cloud Experiment Bookmark and Share The MC3E planning team poses for a group photo near the ARM millimeter wave cloud radar at the SGP Central Facility. Mike Jensen, principle investigator for the campaign, is second from left. Photo courtesy of Brad Orr. In early May, scientists involved in the Midlatitude Continental Convective Cloud Experiment (MC3E), a joint field program involving NASA Global Precipitation

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10, 2010 [Facility News] Supporting Science at Summit Station, Greenland Bookmark and Share This month, an ARM micropulse lidar and ceilometer began collecting data from Summit Station in Greenland as part of the ICECAPS field campaign that runs through October 2014. Scientist Matthew Shupe joined colleagues on location to install the ICECAPS mobile laboratory, documenting their progress through his field blog. Great job, Matt! Visit the campaign website for more information

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 15, 2006 [Facility News] ARM Mobile Facility Begins Year-Long Deployment in Africa Bookmark and Share Beginning on January 9, the ARM Mobile Facility began officially collecting atmospheric data from a location at the airport in Niamey, Niger, Africa. As part of the RADAGAST field campaign, the AMF will measure the effects of absorbing aerosols from desert dust in the dry season, and the effects of deep convective clouds and associated moisture loadings on the transmission of atmospheric

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    26, 2010 [Facility News] User Facilities in Spotlight at Inaugural Office of Science Graduate Fellows Conference Bookmark and Share Office of Science director Dr. William Brinkman delivers his <em>Adventures in Science</em> address during the inaugural Graduate Fellows Conference. Photo courtesy Argonne National Laboratory. Office of Science director Dr. William Brinkman delivers his Adventures in Science address during the inaugural Graduate Fellows Conference. Photo courtesy

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2005 [Facility News] Upgrades to Darwin Radar Double Data Delivery Bookmark and Share The new processor for the MMCR at Darwin collects spectral data in four different modes, resulting in approximately 3.4 gigabytes of signal output per day. Virtually all cloud studies within the ARM Program involve the Millimeter Wavelength Cloud Radar (MMCR). This instrument is the only source for obtaining detailed information about cloud location and internal structure in the atmospheric columns above

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 15, 2005 [Facility News] More Server Power Improves Performance at the ARM Data Management Facility Bookmark and Share Recently, several new Sun servers joined the production system at the ARM Data Management Facility (DMF). These servers provide much needed cpu-the Central Processing Unit is the computing part of the computer known as the processor-power to handle the ever-increasing processing load. The DMF is responsible for collecting and processing hourly data from all three ARM

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31, 2005 [Facility News] Ancillary Site to Provide Key Data from Africa Bookmark and Share In January 2006, the ARM Mobile Facility (AMF) begins a year-long field campaign in Africa as part of a multi-year international experiment called the African Monsoon Multidisciplinary Analysis (AMMA). The AMF will be placed at the airport in Niamey, Niger, well within view of the Global Earth Radiation Budget (GERB) geostationary satellite. Cloud and radiative property measurements collected by the AMF

  15. WIPP News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 News Releases December 1 State Renews WIPP Facility Permit November 18 National TRU Program Director Selected November 18 Waste Isolation Pilot Plant Receives Second EPA Recertification October 7 WIPP Receives 9,000th Shipment September 7 Carlsbad Field Office Manager Transition July 2 DOE Awards Technical Assistance Contract for Carlsbad Field Office June 14 WIPP Completes California Sites Cleanup May 3 DOE Extends Management and Operations Contract at Waste Isolation Pilot Plant May 3 DOE

  16. WIPP News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 News Releases December 21 WIPP Receives First Remote-Handled Waste Shipment From Sandia Labs December 13 Carlsbad Field Office Recognized by New Mexico and DOE for Environmental Excellence at WIPP Click on photo below for larger image. November 10 Carlsbad Field Office Manager Selected November 9 WIPP Receives Top Safety Award November 9 Photos of New WIPP Transportation Exhibit's Debut at the National Museum of Nuclear Science and History Click on photos below for larger images. November 2

  17. WIPP News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Releases October 29 WIPP Environmental Initiatives Earn DOE Recognition Click on photo below for larger image. October 24 WIPP Security Contractor Receives DOE Voluntary Protection Program Award Click on photo below for larger image. October 17 WIPP Employees Among Honorees for Nuclear Footprint Reduction October 3 DOE Exceeds 2012 TRU Waste Cleanup Goal at Los Alamos National Laboratory September 19 DOE Awards Grant to New Mexico Environment Department for Waste Isolation Pilot Plant

  18. WIPP News Releases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Releases December 18 CBFO Selects Quality Assurance Director Click on photo below for larger image. December 2 Carlsbad Field Office Deputy Manager Selected Click on photo below for larger image. September 20 WIPP Management and Operating Contractor Recognized for Continuous Safety Performance Click on photo below for larger image. September 18 WIPP Receives Top Mine Safety Award September 18 WIPP Honored for Sustainability August 2 WIPP Employee Inducted Into Mine Rescue Hall of Fame -

  19. WIPP News Releases - 2003

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Releases December 18 50,000 Containers Safety Disposed at WIPP August 14 Drum Involved in Idaho Incident Not Shippable to WIPP July 31 Marchetti New CEO of Washington TRU Solutions March 25 HUBZone, Great Opportunity for Small Businesses February 18 TRU Solutions Announces $20,500 in Scholarships For Eddy and Lea County Students January 14 Washington TRU Solutions LLC Announces New Name and New General Manager

  20. WIPP News Releases - 2005

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 News Releases December 27 Empty WIPP truck overturns December 12 Dr. Dave Moody to Lead the Carlsbad Field Office December 7 WIPP Satellite Tracking System Relocates to Carlsbad November 23 Statement of Vernon Daub, Acting Manager of DOE's Carlsbad Field Office, Regarding New Mexico Environment Department's Issuance of a Draft Hazardous Waste Facility Permit for WIPP October 7 DOE Awards WIPP Independent Oversight Contract August 11 DOE Awards Technical Assistance Contract to Support Carlsbad

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2016 [Facility News] Research Balloon Lost in Alaska Bookmark and Share A tethered balloon used for atmospheric measurements was being prepared July 27 at Oliktok Point, Alaska, when an unexpected gust of wind lifted the balloon and severed its tether cord. The balloon rose and drifted north across the Beaufort Sea, dropping to the sea roughly 60 km north of Oliktok. The balloon, which carried Atmospheric Radiation Measurement (ARM) Climate Research Facility equipment worth approximately

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2016 [Facility News] Early Career Funding Opportunity Available Bookmark and Share earlycareerprogram A funding opportunity for early career researchers in universities and U.S. Department of Energy (DOE) national laboratories is available from the Office of Biological and Environmental Research (BER). The Early Career Research Program, now in its eighth year, supports the development of individual research programs of outstanding scientists early in their careers and stimulates research

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 15, 2008 [Facility News] New Ceilometer Evaluated at Southern Great Plains Site Bookmark and Share Dan Nelson, SGP facilities manager, inspects the new ceilometer during its evaluation period on the platform of the SGP Guest Instrument Facility between June and July 2008. Dan Nelson, SGP facilities manager, inspects the new ceilometer during its evaluation period on the platform of the SGP Guest Instrument Facility between June and July 2008. To analyze cloud properties, ARM scientists

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 31, 2007 [Facility News] Radiometers Operate in Low Water Vapor Conditions in Barrow, Alaska Bookmark and Share A researcher checks the GVR antennae on a cold, crisp day at the ARM site in Barrow, Alaska. The radiometer is inside the insulated box beneath the antenna; the data is collected and displayed on the computer inside the instrument shelter. To provide more accurate ground-based measurements of water vapor in extremely arid environments, three types of 183.3-GHz radiometers

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2005 [Facility News] Aging, Overworked Computer Network at SGP Gets Overhauled Bookmark and Share This aerial map of instruments deployed at the SGP Central Facility provides an indication of the computer resources needed to manage data at the site, let alone communicate with other ARM sites. Established as the first ARM research facility in 1992, the Southern Great Plains (SGP) site in Oklahoma is the "old man on the block" when it comes to infrastructure. Though significant

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2005 [Facility News] Coastal Clouds Field Campaign Takes Off in July Bookmark and Share The 2-channel NFOV gets careful attention as it joins the suite of instruments collecting data for the ARM Mobile Facility field campaign at Point Reyes National Seashore. Since March 2005, the ARM Mobile Facility (AMF) has been at Point Reyes National Seashore in northern California for the Marine Stratus Radiation, Aerosol, and Drizzle Intensive Operational Period. The goals of this 6-month field

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 6, 2010 [Facility News] Call for Abstracts for Aquatic Sciences Meeting in 2011 Bookmark and Share The next biennial American Society for Limnology and Oceanography (ASLO) Aquatic Sciences Meeting will be held in San Juan, Puerto Rico, February 13-18, 2011. The goal of this conference is to bring together aquatic scientists from around the world to meet the challenge of global climate change and explore the wide range of aquatic systems impacted by humans. Abstracts are due October 11,

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2004 [Facility News] Education and Outreach Program Visits Schools in the Tropics Bookmark and Share A native islander is interviewed in his natural setting at Manus Island as part of the TWP kiosk development effort. In September 2004, the ARM Climate Research Facility Education and Outreach (EO) staff spent 23 days at the Tropical Western Pacific (TWP) locale to develop stronger working relationships with educators and administrators at each of the TWP sites-Manus Island, Nauru Island, and

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 4, 2010 [Facility News] Request for Proposals Now Open Bookmark and Share The ARM Climate Research Facility is now accepting applications for use of the ARM mobile facilities, aerial facility, and fixed sites. Proposals are welcome from all members of the scientific community for conducting field campaigns and scientific research using the ARM Facility. Facility availability is as follows: ARM Mobile Facility 2 (AMF2) available FY2013 ARM Mobile Facility 1 (AMF1) available March 2015

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 21, 2010 [Education, Facility News] NSF Student Travel Fellowship for DYNAMO Field Campaign Bookmark and Share As part of the DYNAMO (Dynamics of the MJO) field campaign, which includes the AMIE-Gan campaign, several student travel fellowships funded by the National Science Foundation are available for advanced graduate students and recently graduated postdoctoral associates, especially those from under-represented groups. DYNAMO is the US contribution to the international field program

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 13, 2011 [Facility News] ARM Scales Back in Atqasuk, Alaska Bookmark and Share Beginning operations in 1999, the ARM site in Aqasuk, Alaska, obtained more than a decade of data for climate research from its inland Arctic location. Beginning operations in 1999, the ARM site in Aqasuk, Alaska, obtained more than a decade of data for climate research from its inland Arctic location. Upon completing its primary science mission, the ARM North Slope of Alaska site in Atqasuk will cease

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 30, 2004 [Facility News] New Instrumentation on Proteus Aircraft Tested Bookmark and Share This fall, the ARM-Unmanned Aerospace Vehicle Program-specifically, the Proteus aircraft-is participating in the Mixed-Phase Arctic Cloud Experiment (M-PACE) in Alaska. However, several of the aircraft's onboard instruments have been modified since its last deployment in November 2002. To verify instrument operation and calibration prior deployment as part of M-PACE, in late September 2004, ARM

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 11, 2011 [Facility News] ARM Mobile Facility Completes Extended Campaign in the Azores; Next Stop-India Bookmark and Share The ARM Mobile Facility obtained data on Graciosa Island in the Azores from May 2009 through December 2010--its longest deployment to date. The ARM Mobile Facility obtained data on Graciosa Island in the Azores from May 2009 through December 2010--its longest deployment to date. December 31, 2010, marked the last official day of data collection for the Clouds,

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2004 [Facility News] New Narrow Field of View Radiometer Widens Range of Radiance Data Bookmark and Share Development of the new 2-channel NFOV (right) benefited greatly from a comparison with the original 1-channel version (left). Development of a new, two-channel narrow field of view (NFOV) radiometer for the ARM Climate Research Facility Southern Great Plains site is nearly complete. The two-channel NFOV replaces a similar single-channel instrument that was destroyed by lightning in June

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 20, 2011 [Facility News] Fond Farewell to Bernie Zak Bookmark and Share A fond farewell to Bernie Zak, Senior Scientist, Sandia National Laboratories, who retired on December 23, 2010. Bernie began his work with ARM in 1991 at the North Slope of Alaska (NSA) site in its early planning phases. As the site manager, he oversaw the development and operations of the site, was influential among climate scientists, and provided tours of the Barrow site to students as part of the

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 21, 2011 [Facility News] Call for Proposals: SERDP Bookmark and Share The Strategic Environmental Research and Development Program (SERDP) is currently accepting proposals for both Core and SERDP Exploratory Development (SEED) FY 2012 solicitations. The Core Solicitation seeks proposals for basic and applied research and advanced technology development. Core projects vary in cost and duration. SEED proposals explore innovative approaches and require high technical risk or supporting data

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 15, 2004 [Facility News] SuomiNet-type Instruments Tested and Ready for Tropics Bookmark and Share The SuomiNet software integrates a network of global positioning systems to distribute spatially and temporally dense atmospheric data in real-time from broad and diverse regions. ARM Program scientists are concentrating on developing techniques for obtaining the best possible water vapor measurements under a wide range of conditions (clear/cloudy, day/night, etc.). In 2001, 15 SuomiNet

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2011 [Facility News] Team Continues Campaign Planning on Gan Island Bookmark and Share Mike Ritsche, technical operations manager for the AMF2, discusses instrumentation specifics with Gan airport and MMS officials. Mike Ritsche, technical operations manager for the AMF2, discusses instrumentation specifics with Gan airport and MMS officials. For its first international field campaign, the second ARM Mobile Facility (AMF2) is scheduled to operate on Gan Island in the Indian Ocean for the ARM

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2011 [Facility News, Publications] Journal Special Issue Includes Mobile Facility Data from Germany Bookmark and Share The ARM Mobile Facility operated in Heselbach, Germany, as part of the COPS surface network. The ARM Mobile Facility operated in Heselbach, Germany, as part of the COPS surface network. In 2007, the ARM Mobile Facility participated in one of the most ambitious field studies ever conducted in Europe-the Convective and Orographically Induced Precipitation Study (COPS). Now, 21

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2011 [Facility News] Forecasting Exercise Begins Oklahoma Storm Study Count Down Bookmark and Share Clouds like this, called by the name "anvil" for its shape, are one type of cloud system researchers hope to encounter during MC3E. Beginning April 2011, the ARM Southern Great Plains (SGP) site in north-central Oklahoma will host the first major field campaign to take advantage of numerous new radars and other remote sensing instrumentation installed throughout the site with funding

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 30, 2008 [Facility News] Education and Outreach Activities in the Tropics Get a Tune-up Bookmark and Share Leonard Jonli (right), Assistant Administrator for Education on Manus, discusses his perspective with (left to right) Ed Lorusso, ARM Education and Outreach Director; Hymson Waffi, local Officer in Charge for the ARM site on Manus; and Larry Jones, ARM Site Manager for the TWP. Leonard Jonli (right), Assistant Administrator for Education on Manus, discusses his perspective with

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23, 2011 [Facility News, Publications] GOAmazon2014 Workshop Identifies Challenges, Opportunities Bookmark and Share In July, DOE's Office of Biological and Environmental Research (BER) held a 2-day workshop to identify key scientific challenges and opportunities associated with a major field campaign that will occur in 2014-Green Ocean Amazon 2014, or GOAmazon2014-taking place in Manaus, Brazil. During the campaign, several BER programs will deploy observational resources to obtain data for

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 27, 2011 [Facility News] North Slope Students Begin Science Field Trips Bookmark and Share Courtney Hammond, BASC outreach program, with students from Ipalook Elementary School during a field trip to the ARM site in Barrow, Alaska, in October 2011. Courtney Hammond, BASC outreach program, with students from Ipalook Elementary School during a field trip to the ARM site in Barrow, Alaska, in October 2011. In early October, operations staff at the ARM North Slope of Alaska site in Barrow

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22, 2011 [Facility News] Request for Proposals Now Open Bookmark and Share The ARM Climate Research Facility is now accepting applications for use of an ARM mobile facility (AMF), the ARM aerial facility (AAF), and fixed sites. Proposals are welcome from all members of the scientific community for conducting field campaigns and scientific research using the ARM Facility, with availability as follows: AMF2 available December 2013 AMF1 available March 2015 AAF available between June and October

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 18, 2012 [Facility News] Wind Profiler Completes Offsite Campaign Bookmark and Share The radar wind profiler operates by sending pulses of energy into the sky and measuring the strength and frequency of returned energy. The radar wind profiler operates by sending pulses of energy into the sky and measuring the strength and frequency of returned energy. Between November 2010 and November 2011, a handful of meteorological instruments-including Doppler sodar, ultrasonic anemometers, and one

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 14, 2007 [Facility News] Field Campaigns Generate Interest from Aviation Aficionados in Oklahoma Bookmark and Share Dr. Pete Lamb On November 13, Dr. Pete Lamb attended a meeting of the Norman Chamber of Commerce to talk about the field campaigns that occurred at the ARM Southern Great Plains site in June 2007. Pete was invited to address the chamber's Aviation Committee, which was particularly intrigued by the use of nine airplanes operating simultaneously during the CLASIC and CHAPS

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2008 [Facility News] Talk About Climate Change: Radiometer Moves from Arctic to South America Bookmark and Share Dockside in Charleston, South Carolina, the newly installed GVRP on the research vessel Ronald H Brown readies for its month-long deployment in the Southeast Pacific. Dockside in Charleston, South Carolina, the newly installed GVRP on the research vessel Ronald H Brown readies for its month-long deployment in the Southeast Pacific. The VAMOS Ocean-Cloud-Atmospheric-Land Study, or

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 16, 2007 [Facility News] The Southern Great Plains Site Welcomes Keith Richardson Bookmark and Share Keith Richardson was hired as a Computer Network Manager at the SGP site. On October 1, Keith Richardson joined the Southern Great Plains (SGP) site as a Computer Network Manager. He came to us from a position with the State of Oklahoma, where he was a network and telecommunications manager. His background includes experience with UNIX and Windows system management, network management,

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 19, 2012 [Facility News] Storm Chasers Take a Break at the Southern Great Plains Site Bookmark and Share Scientist Gunnar Senum (far left) from Brookhaven National Laboratory describes the aerosol observing system to a group of visiting meteorology students from Rutgers University. Scientist Gunnar Senum (far left) from Brookhaven National Laboratory describes the aerosol observing system to a group of visiting meteorology students from Rutgers University. Taking a break from storm chasing

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4, 2012 [Facility News] New Organization to Optimize ARM Radar Data Bookmark and Share Every ARM fixed and mobile site now includes both scanning (left) and zenith-pointing (right) cloud radars. The fixed sites also include scanning precipitation radars. Every ARM fixed and mobile site now includes both scanning (left) and zenith-pointing (right) cloud radars. The fixed sites also include scanning precipitation radars. In the past few years, the ARM Facility added 19 new scanning cloud and

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    13, 2012 [Facility News] Another Kind of Rush in Alaska Bookmark and Share Summer time in Alaska this year brought a rush of visitors to the ARM Climate Research Facility Barrow site. North Slope of Alaska facility manager Mark Ivey hosted two prestigious groups of visitors: a Sandia National Laboratory leadership team in June and U.S. Department of Energy management from the Office of Biological and Environmental Research (BER) in August. In August, DOE management from the Office of Biological

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2012 [Data Announcements, Facility News] New Data from Greenland for Arctic Climate Research Bookmark and Share Instruments for ICECAPS operate on top and inside of the Mobile Science Facility at Summit Station in Greenland. Instruments for ICECAPS operate on top and inside of the Mobile Science Facility at Summit Station in Greenland. In 2010, researchers installed a powerful suite of climate and weather instruments at Greenland's frozen research outpost, Summit Station, for a long-term

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17, 2013 [Facility News] Data Sharing for Climate Research with India Now Official Bookmark and Share Aerosol instruments operate at the IISc Challakere campus, located about 150 kilometers north of IISc headquarters in Bangalore, India. Aerosol instruments operate at the IISc Challakere campus, located about 150 kilometers north of IISc headquarters in Bangalore, India. A new cooperative agreement between the U.S. Department of Energy (DOE) and the Indian Institute of Science (IISc) formalizes

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 8, 2008 [Facility News] New International Journal Available Bookmark and Share New scientific journal available (ISSN 1942-2466, DOI 10.3894). New scientific journal available (ISSN 1942-2466, DOI 10.3894). A new international, open-access, scientific journal, the Journal of Advances in Modeling Earth Systems (JAMES), is now accepting submissions for its inaugural 2008 volume. Reporting on all aspects of Earth system modeling, this journal showcases leading-edge research in atmospheric

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 15, 2008 [Facility News] North Slope of Alaska Site Hosts Guest Instruments for Arctic Aerosol Study Bookmark and Share In addition to airborne measurements obtained at the North Slope of Alaska for the Indirect and Semi-direct Aerosol Campaign (ISDAC) in April, the ARM site in Barrow also hosted several guest instruments throughout the campaign. Measurements from these additional instruments will provide important supplementary data to the continuous data collected at Barrow for

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 26, 2008 [Facility News] Tomlinson to Lead National Research Aircraft Committee Bookmark and Share Jason Tomlinson Jason Tomlinson In October, Jason Tomlinson, operations lead for the ARM Aerial Vehicles Program, was appointed the new leader for the Interagency Coordinating Committee for Airborne Geosciences Research and Application (ICCAGRA). Since 1997, this group of agencies has worked to increase the effective use of the federal airborne fleet in national and international field

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2008 [Facility News] Scout Team Surveys Storm Peak Area Bookmark and Share Storm Peak Laboratory, at an elevation of 3200 meters, will supplement measurements obtained by the AMF2 during its debut in 2010 near Steamboat Springs, Colorado. Storm Peak Laboratory, at an elevation of 3200 meters, will supplement measurements obtained by the AMF2 during its debut in 2010 near Steamboat Springs, Colorado. The U.S. Department of Energy recently announced the initial deployment of the second ARM

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 10, 2007 [Facility News] Jim Mather Selected as New ARM Technical Director Bookmark and Share Congratulations to Dr. Jim Mather, who will take the position of Technical Director of the ARM Climate Research Facility effective August 1, 2007. The Technical Director is responsible and accountable for the successful overall management of the user facility and works with the other ARM managers to this end. Jim's leadership will be critical for the successful development and evolution of the

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 30, 2008 [Facility News] Site Operations Centralized Through New Tracking System Bookmark and Share Tracking over 300 instrument systems distributed around the world is a challenging task. Tracking over 300 instrument systems distributed around the world is a challenging task. With more than 300 instrument systems operating at remote sites around the globe, ARM Instrument Mentors can now use the centralized Operations Support System (OSS) to review or provide updates to instrument

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 15, 2008 [Facility News] National User Facility Organization Meets to Discuss Progress and Ideas Bookmark and Share In late April, the ARM Technical Director attended an annual meeting of the National User Facility Organization. Comprised of representatives from Department of Energy (DOE) national user facilities, the purpose of this group is to promote and encourage discussions among user facility administrators, their management, and their user organization representatives by communicating

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 10, 2007 [Facility News] Jimmy Voyles Moves to Role of Instrument Coordinator Bookmark and Share Mr. Jimmy Voyles, the current ARM Technical Director, will move to the role of Instrument Coordinator for ARM effective August 1, 2007. In this role, he will provide leadership for the technical and engineering oversight of ARM instrument systems and future deployment planning. In addition, he will contribute to the broader engineering and operations needs of ARM, including the planning and

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 2, 2013 [Facility News] 2014 Funding Opportunity Available for Early Career Scientists Bookmark and Share The U.S. Department of Energy's Office of Science is now accepting research applications through its Early Career Research Program. For the 2014 call, the DOE Climate and Environmental Sciences Division is only accepting proposals in the area of the water cycle. More details on this topic are available in the Funding Opportunity Announcement, p. 7. Applications that propose

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 31, 2008 [Facility News] Arctic Field Campaign Data and Instrument Performance Reviewed at Workshop Bookmark and Share Both wings of the Canadian National Research Council's Convair-580 aircraft were equipped with numerous cloud and aerosol probes during ISDAC. Both wings of the Canadian National Research Council's Convair-580 aircraft were equipped with numerous cloud and aerosol probes during ISDAC. In April 2008, the month-long Indirect and Semi-Direct Aerosol Campaign (ISDAC)

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 19, 2013 [Facility News] Research Colleagues Elected AGU Fellows Bookmark and Share Distinguished research colleagues, Warren Wiscombe and Graham Feingold, have been elected to the American Geophysical Union (AGU) 2013 Class of Fellows. Out of 217 nominations, 62 were elected into the new class. They will be recognized on Wednesday, December 11, during the Honors Ceremony and Banquet at the 2013 AGU Fall Meeting in San Francisco. Warren Wiscombe Warren Wiscombe Wiscombe was cited for

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 30, 2008 [Facility News] Arctic Aerosol Study Flies By Bookmark and Share Ending its mission with a final flight on April 30, 2008, the Indirect and Semi-Direct Aerosol Campaign (ISDAC) flew a total of 103 research hours, completing 27 science flights primarily in the region around the ARM North Slope of Alaska site in Barrow. These flights included several golden cases where both cloud and aerosol measurements were obtained above, within, and below mixed-phase cloud layers. In addition,

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 30, 2008 [Facility News] ARM Outreach Materials Chosen for Earth Day Display in Washington DC Bookmark and Share Posters for the ARM Mobile Facility and ARM Education and Outreach were selected for the 2008 Earth Day display at DOE Headquarters. Earth Day is officially honored each year on April 22, however, many groups sponsor activities throughout the entire month of April. At DOE Headquarters in Washington DC, two ARM posters were selected to join a poster display representing programs

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2009 [Facility News] Climate Models Need Closure Too Bookmark and Share These radiometers at the Southern Great Plains site match those on the aircraft for the RACORO field campaign. The radiometers will take measurements continuously throughout the campaign, allowing scientists to compare measurements from the aircraft against those collected routinely by radiometers at the site. These radiometers at the Southern Great Plains site match those on the aircraft for the RACORO field campaign.

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 15, 2008 [Facility News] CLASIC Discussed at Workshop in Oklahoma Bookmark and Share Participants at the CLASIC workshop in March 2008 listen intently to one of the many presenters. In June 2007, ARM led the multi-agency Cloud and Land Surface Interaction Campaign (CLASIC) conducted at the ARM Southern Great Plains site. With scientists beginning to analyze the data, the Cooperative Institute for Mesoscale Meteorological Studies at the University of Oklahoma hosted a workshop on March

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 27, 2007 [Data Announcements, Facility News] Data from the NOAA Climate Reference Network for Barrow, AK, and Stillwater, OK, are Available Through the External Data Center Bookmark and Share The ARM Climate Research Facility is providing data in netCDF format from the U.S. Climate Reference Network (USCRN), a network of climate change monitoring stations developed by the National Oceanic and Atmospheric Administration (NOAA). This network provides long-term observations of temperature and

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 20, 2014 [Facility News, Publications] 2013 ARM Annual Report Now Available Bookmark and Share The 2013 edition of the ARM Climate Research Facility Annual Report was published in February 2014. The first 25 pages include a short overview of the Facility, followed by featured field campaigns, user research results, and summaries of infrastructure achievements. The back portion of the report includes a summary of all 2013 field campaigns conducted throughout the ARM Facility and a

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2014 [Data Announcements, Facility News] ARM Data Archive Registered with Elsevier Bookmark and Share Increased visibility via Elsevier's data repository presents an opportunity to broaden the scientific audience for ARM data. Increased visibility via Elsevier's data repository presents an opportunity to broaden the scientific audience for ARM data. With an ever-increasing need to connect related pieces of information, databases rule the world. As of mid-March, the ARM Data Archive-containing

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2014 [Facility News] Workshops Begin for ARM Megasites Bookmark and Share While the mission of the ARM Climate Research Facility has not changed, it is undergoing a reconfiguration to better support the linking of ARM measurements with process-oriented models. The facility reconfiguration, presented at the recent Atmospheric System Research meeting, will involve three main components: Augmenting measurements at the ARM Southern Great Plains site and the two sites on the North Slope of Alaska,

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    25, 2007 [Data Announcements, Facility News] New, Improved Algorithm for Retrieving Liquid Water Path Now Available at the ARM Data Archive Bookmark and Share The MWRRET product uses an improved retrieval technique and a method to identify and remove biases from the data to greatly improve the retrieved LWP (blue). It also performs so-called physical retrievals at each radiosonde launch time (black dots)-physical retrievals are the best possible retrieval that can be performed. The total amount

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22, 2014 [Education, Facility News] Young Minds Blossom During Spring STEM Events Bookmark and Share The latest addition to the ARM education materials includes a cloud version of the childhood memory match game. The latest addition to the ARM education materials includes a cloud version of the childhood memory match game. Earth Day 2014 is today, Tuesday, April 22. When Earth Day began in 1970, Senator Gaylord Nelson's goal was to pay tribute to the environment in which we live. Since then,

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2009 [Facility News] Climate Change Prediction Program Funding Opportunity Announced Bookmark and Share The U.S. Department of Energy's Office of Science is now accepting applications for Office of Biological and Environmental Research (BER) research grants for the development of advanced approaches in modeling of climate at ultra-high spatial resolutions. Applications should clearly describe how these approaches will further climate modeling technology with regard to high fidelity

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23, 2007 [Facility News] BAMS Features Three ARM Research Papers in February Bookmark and Share Image of the February 2007 BAMS cover In a tropospheric trifecta, three ARM research papers were featured in the February 2007 issue of the Bulletin of the American Meteorological Society, or BAMS. Two of the articles-Turner et. al., and Comstock et. al.,-cover studies of retrieval algorithms used to characterize the microphysical properties of thin liquid water clouds and upper tropospheric ice

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21, 2014 [Facility News] DOE Early Career Research Awardee to Study Water Cycle Bookmark and Share Mike Pritchard Mike Pritchard Recently announced by the DOE Office of Science Early Career Research Program, Mike Pritchard from the University of California-Irvine is one of 35 awardees who will receive funding support for their research over the next 5 years. Pritchard, Assistant Professor of Earth System Science, was selected for his research topic, "Understanding the Roles of Cloud

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 2, 2014 [Facility News, Publications] Testbed Workshop to Improve Climate Models Bookmark and Share A primary goal of DOE's Climate and Environmental Sciences Division (CESD) is to expand the predictive ability of regional and global climate models (GCMs). As climate models are developed, testbeds are one set of tools used to understand, evaluate, and identify areas of improvement. A recently completed report summarizes the results of a DOE workshop held last summer to discuss coordination

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 23, 2007 [Data Announcements, Facility News] Arctic Surface Radiation Data Now Available at the ARM Data Archive Bookmark and Share Researchers lead by principal investigator Ellsworth Dutton used more than 30 years of surface irradiance data obtained from Barrow, Alaska, in a study of temporal and spatial variations (Dutton et al., 2006). The high temporal resolution (1 to 3 minute averages) data and the quality assured hourly averages are now available from the ARM Data Archive. See

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2009 [Facility News] Mobile Facility Begins Marine Cloud Study in the Azores Bookmark and Share Located next to the airport on Graciosa Island, the ARM Mobile Facility's comprehensive and sophisticated instrument suite will obtain atmospheric measurements from the marine boundary layer. Located next to the airport on Graciosa Island, the ARM Mobile Facility's comprehensive and sophisticated instrument suite will obtain atmospheric measurements from the marine boundary layer. Extended

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 31, 2014 [Facility News] 2015 Funding Opportunity Available for Early Career Scientists Bookmark and Share The U.S. Department of Energy's Office of Science is now accepting research applications through its Early Career Research Program. For the 2014 call, the DOE Climate and Environmental Sciences Division is only accepting proposals in the area of land-atmosphere interactions. Applications are sought that will reduce the uncertainties in projections from Earth system models through

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31, 2009 [Facility News] Scanning Radiometers Probe Inside of Clouds Bookmark and Share For one month, three of these microwave radiometers at the SGP site, along with two more from the University of Colorado, will be arranged in series to continuously scan clouds passing overhead. For one month, three of these microwave radiometers at the SGP site, along with two more from the University of Colorado, will be arranged in series to continuously scan clouds passing overhead. A key contributor

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    27, 2009 [Facility News] Arrival of Recovery Act Funds Sets Wheels In Motion Bookmark and Share So that people can easily recognize the effects of the American Recovery and Reinvestment Act, all projects will be stamped with the Recovery Act logo. Through the American Recovery and Reinvestment Act of 2009 (aka stimulus), the Department of Energy's Office of Science received $1.2 billion. In late May, DOE released approximately $54 million-90 percent-of the $60 million allocated to the ARM

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 15, 2009 [Facility News] Severe Storms the Focus of VORTEX Bookmark and Share Operations staff at the SGP site release weather balloons 4 times a day, Monday through Friday, all year round. During VORTEX2, they will supplement these with additional launches as conditions warrant. Operations staff at the SGP site release weather balloons 4 times a day, Monday through Friday, all year round. During VORTEX2, they will supplement these with additional launches as conditions warrant. Severe

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 21, 2014 [Facility News] ARM Scientists Lead Radar Courses at ERAD2014 Bookmark and Share In September, radar engineers and science colleagues gathered in Garmisch-Partenkirchen, Germany, for the 8th European Conference on Radar in Meteorology and Hydrology. Leading ARM radar experts and data users shared their advances during two short-course workshops. A third short course was coordinated by Atmospheric System Research (ASR) colleagues on "Applications of Dual-Polarization Weather

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4, 2014 [Facility News, Publications] Megasites Accept Mega Challenge: New Directions Take Formation in First Workshop Bookmark and Share With the growing interest in high-resolution model simulations, the Department of Energy Climate and Environmental Sciences Division is hosting a series of workshops to focus on key scientific needs, gaps, and priorities in process model understanding and climate model prediction through the strategic deployment and operation of routine high-resolution

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 22, 2008 [Facility News] Mark Ivey Discusses Arctic Climate Research for Earth Week Interview Bookmark and Share As part of a series of interviews to highlight Earth Day in April, KRQE in Albquerque, New Mexico interviewed Mark Ivey about climate change research in the Arctic. In this video (WMV, 14Mb) , Mark, Site Manager for the ARM North Slope of Alaska locale, chats with the reporter about climate models, sea ice, and the significance of research and climate change in the Arctic

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2014 [Education, Facility News] ARM Educational Outreach Puts Fun Twist on Science Night Bookmark and Share Community STEM Event Draws Big Crowds Laura Riihimaki intrigues students with monsoon activity during science night. Laura Riihimaki intrigues students with monsoon activity during science night. In November, ARM communications staff and scientists participated in the 6th annual Chief Joseph Middle School Science Night in Richland, Washington. Hundreds of students, parents, and educators

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2008 [Facility News] Final Preparations Underway for Arctic Aerosol Field Campaign Bookmark and Share In this flight pattern, the Convair-580 takes off from Barrow (BR) after refueling, flies several legs within clouds between 1-2 km high, then returns to base at Fairbanks. With just one month before the start of the Indirect and Semi-direct Aerosol Campaign (ISDAC), the ARM Aerial Vehicles Program (AVP) is finalizing the necessary contract arrangements, instrumentation integration

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2007 [Facility News] Radiative Heating in Unexplored Bands Campaign Begins Today Bookmark and Share This chart shows the spectral and height dependence of the infrared cooling rates for a mid-latitude summer profile. Note that the majority of the infrared cooling in the middle and upper tropsphere occurs in spectral regions that RHUBC will investigate. In conjunction with other scientific activities taking place during International Polar Year 2007-2008, today (February 26) an international

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 29, 2015 [Facility News] ASR Makes Awards to Two Teams for Science at the New ARM Sites Bookmark and Share Robert Wood, ENA science team leader Robert Wood, ENA science team leader Gijs de Boer, Oliktok Point science team leader Gijs de Boer, Oliktok Point science team leader The U.S. Department of Energy's Office of Science has awarded two Office of Biological and Environmental Research (BER) grants for under-represented research within the Atmospheric System Research (ASR) program. The

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3, 2015 [Facility News] New Advisory Group Focuses Efforts on Unmanned Aircraft Systems Bookmark and Share The Arctic is experiencing rapid climate change with nearly double the rate of surface warming observed elsewhere on the planet. Currently, the reasons for arctic amplification are not well understood, nor are the impacts to the global carbon cycle well quantified. Atmospheric researchers are using unmanned aircraft to study problems requiring frequent or long-duration observations in

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 12, 2015 [Facility News] 2015 William T. Pecora Award Nominations Bookmark and Share William T. Pecora William T. Pecora Nominations for the 2015 William T. Pecora Award are currently being accepted through June 15. This award is presented annually to individuals or groups that have made outstanding contributions toward understanding the Earth using remote sensing. Individuals from public and private sector, teams, organizations, and professional societies are eligible. Both national and

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 31, 2009 [Facility News, Publications] African Collaborators Continue Data Analyses from Niamey Bookmark and Share During a recent gathering at the University of Niamey, SGP and African collaborators pause for a quick photo. From left to right: Dr. Zewdu Segele, SGP Site Scientist Postdoc; Professor Ibrah Sanda, Professor of Physics, University of Niamey; Dr. Pete Lamb, SGP Site Scientist; Professor Ben Mohamed, project lead from the University of Niamey; Hama Hamidou, a Niamey

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 1, 2015 [Facility News] BAMS Features Results of 21-Month ARM Deployment Bookmark and Share Low clouds were observed typically at the Graciosa site during the 21-month ARM Mobile Facility deployment. Low clouds were observed typically at the Graciosa site during the 21-month ARM Mobile Facility deployment. Featured in the March 2015 Bulletin of the American Meteorological Society (BAMS), the 21-month ARM mobile facility deployment in the Azores was the longest of its type in a non-tropical

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2015 [Facility News] New Science Board Members Tackle ARM's Expanding Landscape Bookmark and Share With facilities around the world hosting field campaigns on a regular basis, the ARM Climate Research Facility continues to be an important resource to the scientific community. Thanks to the vigilance of the ARM Science Board, the ARM Facility is able to support quality science with over 70 campaigns a year. Comprised of highly-respected scientists from the external climate research community,

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    18, 2015 [Facility News] ARM Data Developers Prepare for Next Generation of ARM Bookmark and Share Around 40 ARM staff attended the 2015 Data Developer's Meeting at the National Weather Center in Oklahoma to discuss current activities and the reconfiguration of ARM sites. Around 40 ARM staff attended the 2015 Data Developer's Meeting at the National Weather Center in Oklahoma to discuss current activities and the reconfiguration of ARM sites. About 40 ARM staff members gathered at the National

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21, 2015 [Facility News] Early Career Funding Opportunity Bookmark and Share U.S. Department of Energy (DOE) national laboratory researchers and university tenure-track professors are invited to submit applications for the Early Career Research Program, sponsored by the DOE Office of Science. Applicants must have received their doctorates no earlier than 2005. For the fiscal year 2016 call, proposals to the Office of Biological and Environmental Research (BER) should focus on climate and

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 2015 [Facility News] New Face to Join the ARM Unmanned Aerial Systems Committee Bookmark and Share Matt Fladeland, NASA Ames Research Center Matt Fladeland, NASA Ames Research Center In February 2015, five recognized experts in unmanned aerial systems (UAS) technology, management, and science applications agreed to form the ARM UAS Advisory Group to provide scientific and technical advice to Sandia National Laboratories and Pacific Northwest National Laboratory leadership, who are jointly

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2015 [Facility News, Publications] LASSO Implementation Strategy Report Available Bookmark and Share "Data cubes" that combine observations, model output, and metrics will be combined into a unified package. The ARM Climate Research Facility is entering an exciting new era where the application of ARM observations and data processing will be accelerated by routine, high-resolution modeling to enable better understanding of cloud, radiation, aerosol, and land-surface processes and

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 31, 2008 [Facility News] Southern Great Plains Gets an "Assist" for Instrument Intercomparison Bookmark and Share In July, the SGP site hosted an instrument intercomparison between the AERI and the new ASSIST instrument, shown above. One instrument scientists use to obtain measurements important for climate studies is an atmospherically emitted radiance interferometer, or AERI. This sophisticated instrument measures the absolute infrared spectral radiance of the sky directly above

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 6, 2009 [Facility News] Research Team Publishes Results from In-Depth Study of Sahel Climate System Bookmark and Share The Sahel region of West Africa has experienced long-term drought accompanied by profound socioeconomic consequences over the past 30 years. It is a favored location for the development of tropical easterly waves that may generate hurricanes. The Sahel region of West Africa has experienced long-term drought accompanied by profound socioeconomic consequences over the past

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 15, 2009 [Facility News] Instruments for Airborne Research Undergo Calibration Campaigns Bookmark and Share In a laboratory at the University of Manchester, scientists run an experiment using a micromanipulator to test the depth-of-field of the Cloud Particle Imager. Researchers (front to back) include Chris Emersic and Paul Connolly from the University of Manchester, and Junshik Um from the University of Illinois. In a laboratory at the University of Manchester, scientists run an

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2015 [Facility News] Calling All Data Archive Users Bookmark and Share DataArchive You will need to update your ARM data profile as soon as possible as part of new government reporting requirements. Researchers access data collected through the routine operations and scientific field experiments of the ARM Facility through the ARM Data Archive. An updated registration form requests information about the scientific project for which you are using ARM data. This information is a new requirement

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 9, 2015 [Facility News] Joint Call for Research to Analyze Aerosol Samples Collected at ARM's Southern Great Plains Site Bookmark and Share A pilot call for proposals is now open for research in focused topics in atmospheric aerosol science that takes advantage of both the analytical instrumentation and capabilities in the Environmental Molecular Sciences Laboratory (EMSL) User Facility and the infrastructure and observational capabilities of the Atmospheric Radiation Measurement (ARM)

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2016 [Facility News] Workshop Features ARM Data Bookmark and Share giri_blog In November 2015, the First Workshop on Data Science, held in São Paulo, Brazil, was attended by 65 scientific experts to discuss national and international initiatives for data science that contribute to solving challenges in the context of open data science in Brazil. During the 2-day conference, Giri Palanisamy, ARM Data Services and Strategy Team Manager at Oak Ridge National Laboratory, hosted a training course

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 31, 2009 [Facility News] North Slope Operations Get a Big Lift Bookmark and Share Operations capabilities at the ARM site in Barrow now include a telehandler that can perform a variety of difficult tasks, particularly in winter. Photo by Walter Brower. Operations capabilities at the ARM site in Barrow now include a telehandler that can perform a variety of difficult tasks, particularly in winter. Photo by Walter Brower. In August, operations staff at the ARM North Slope of Alaska site in

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2016 [Facility News] New Funding Opportunity Announced Bookmark and Share Simulations like this one will be used by the newly launched DOE Accelerated Climate Modeling for Energy (ACME) project to advance three climate science drivers and corresponding questions in water cycle, biogeochemistry, and cryosphere-ocean system. Simulations like this one will be used by the newly launched DOE Accelerated Climate Modeling for Energy (ACME) project to advance three climate science drivers and

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10, 2016 [Facility News] Opportunity for Cloud Properties Retrieval Algorithm Development: Request for Interest Opened Bookmark and Share The ARM Facility is seeking a scientific consultant to develop an operational cloud property algorithm, using data from ARM facilities and instruments like these scanning cloud radars. The ARM Facility is seeking a scientific consultant to develop an operational cloud property algorithm, using data from ARM facilities and instruments like these scanning cloud

  10. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2016 [Facility News] Manvendra Dubey Awarded Los Alamos Fellows Prize Bookmark and Share Dr. Manvendra Dubey, Los Alamos National Laboratory Dr. Manvendra Dubey, Los Alamos National Laboratory Manvendra Dubey recently received the Los Alamos National Laboratory 2015 Fellows Prize for Outstanding Research for his achievements in the fields of leadership and science in the global climate community. Dubey's research has created a confluence of field observations, laboratory measurements, and

  11. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2016 [Facility News] Atmospheric Modeling Advisory Group Assembled Bookmark and Share ARM recently formed the Atmospheric Modeling Advisory Group to represent research community interests and provide feedback to the LES ARM Symbiotic Simulation and Observation Workflow (LASSO) modeling project. This group consists of six scientists, spanning the range of specialties that will benefit from LASSO, plus ARM Technical Director, Jim Mather; LASSO principal investigator, William Gustafson; and

  12. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10, 2016 [Facility News, Publications] ACME/ARM/ASR, or AAA, Workshop Report Available on DOE Website Bookmark and Share CESD_Report_2016_ACME.indd While the U.S. Department of Energy's (DOE's) Atmospheric Radiation Measurement (ARM) Climate Research Facility and Atmospheric System Research (ASR) and Earth System Modeling (ESM) programs have made considerable contributions to the understanding of the atmospheric component of Earth's climate system and to development and evaluation of global

  13. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3, 2016 [Facility News] Nature Geoscience Article: Raindrops Disperse Climate-Critical Organic Particles Bookmark and Share ARM site plays a role in a novel finding on rain events and airborne carbonaceous particles Embedded in a 160-acre spread of remote farmland, the Southern Great Plains site played host to a scientific discovery that could alter the way scientists look at rain's effect on climate. Embedded in a 160-acre spread of remote farmland, the Southern Great Plains site played host to

  14. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 22, 2016 [Facility News] Young ASR Researcher Receives White House Award Bookmark and Share Gijs de Boer commands an Arctic air force of unmanned miniature planes Making an appearance at the White House in early May was 36-year-old Gijs de Boer, who is both an Atmospheric System Research scientist and ARM Climate Research Facility user. He is a prolific researcher with the NOAA Cooperative Institute for Research in Environmental Science (CIRES) at the University of Colorado, Boulder, and was

  15. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 20, 2016 [Facility News] Small ARM Campaigns Do Big Science, and You Could Too Bookmark and Share Next round of deadlines for small campaigns coming up; five recently approved campaigns span from Ascension Island to Mount Bachelor Not every science campaign requires a full deployment of ARM Climate Research Facility equipment; important work can be done with just an instrument or two, or in conjunction with a larger operation. These projects fall under the category of ARM's small campaigns.

  16. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 31, 2008 [Facility News] ARM Exhibit Showcases Continuous Data at American Meteorological Society Annual Meeting Bookmark and Share During the 88th annual AMS meeting, interested participants stop by the ARM exhibit where ARM researchers answered their questions. In January, ARM joined nearly 100 other exhibitors at the 88th American Meteorological Society annual meeting in New Orleans. This year's meeting was organized around the broad theme of "Enhancing the Connectivity between

  17. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    24, 2009 [Facility News] Merger of Science Programs Results in Atmospheric System Research Bookmark and Share Effective October 1, the Department of Energy's Atmospheric Radiation Measurement Program and Atmospheric Science Program will be merged and managed under a new name, Atmospheric System Research. A major benefit of the merger is expected to be a strengthening of the programs by bringing together ARM expertise in continuous remote sensing measurements of cloud properties and aerosol

  18. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 15, 2008 [Facility News] ARM Mobile Facility Completes Field Campaign in Germany Bookmark and Share Researchers will study severe precipitation events that occurred in August and October 2007, stalling Rhine River traffic and causing flooding in portions of Germany. (Image source: DW-WORLD.DE) Operations at the ARM Mobile Facility (AMF) site in Heselbach, Germany, officially came to a close on January 1, 2008. As one of several measurement "supersites" situated throughout the

  19. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 30, 2009 [Facility News] Help Us Build a New Computing Environment for You! Bookmark and Share Your answers to our survey will help guide the development of a computing environment for working with complex data sets like the Cloud Modeling Best Estimate example shown here. Your answers to our survey will help guide the development of a computing environment for working with complex data sets like the Cloud Modeling Best Estimate example shown here. Do you download large volumes of data

  20. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 23, 2008 [Facility News] FY 2009 ARM Science Solicitation Announced Bookmark and Share DOE's Office of Biological and Environmental Research (BER) is now accepting applications to develop innovative methods for observational data analysis and utilize the resulting knowledge from such analyses to improve cloud parameterizations. The intent is to improve the modeling of cloud properties and processes and their impact on the atmospheric radiation balance. Selected research would be part of

  1. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 30, 2009 [Facility News] Climate Change Lesson Plan Selected for Bookmark and Share A lesson plan about climate change in the Arctic was selected by to join their collection of online educational resources. Developed through the ARM Education and Outreach Program for junior high school students, the lesson plan called "Bringing Climate Change into the Classroom" covers the greenhouse effect, sea ice, adaptation, and climate change in

  2. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 21, 2008 [Facility News] Request for Small Aircraft Preproposals Bookmark and Share Requests are now being accepted for routine use of small aircraft, like this Cessna 206, in FY 2008-2010 at the Southern Great Plains site. Note: The request for proposals is now closed. The call for proposals for FY 2011 will open in the late fall. Preproposals are now being accepted for scientific research at the U.S. Department of Energy's Atmospheric Radiation Measurement (ARM) Climate Research

  3. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2007 [Facility News] Commercial Infrared Sky Imagers Compared Bookmark and Share Three of the four instruments used in the sky imager intercomparison are visible in this photo taken on the Guest Instrument Facility platform at the SGP site. They are the Solmirus All Sky Infrared Visible Analyzer (foreground); Heitronics Nubiscope (top right); and Atmos Cloud Infrared Radiometer-4 (far left). Four infrared imaging instruments were installed and operated at the ARM Southern Great Plains (SGP)

  4. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31, 2007 [Facility News] Long-term Radiosonde Validation Campaign Concludes Bookmark and Share In 2007, sonde launches at ARM sites supported validation of the IASI instrument onboard the Metop-A satellite. As the satellite scans a "swath" of the Earth below it, the IASI scanning mirror directs emitted infrared radiation into the uncovered interferometer to derive atmospheric temperature and humidity profiles. (Image source: European Space Agency) Since 2002, ARM operations staff have

  5. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15, 2007 [Facility News] Microwave Radiometers Put to the Test in Germany Bookmark and Share A 2-channel microwave radiometer (left) and a 12-channel microwave radiometer profiler (right) are part of a larger collection of instruments deployed at the ARM Mobile Facility site in Heselbach, Germany, in 2007. Microwave radiometers (MWRs) are instruments used to measure emissions of water vapor and liquid water molecules in the atmosphere at specific microwave frequencies. Different MWRs are used to

  6. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 15, 2008 [Facility News] Extract This! Enhanced Visualization Tool Available at the Data Archive Bookmark and Share Custom 2-day plot of downwelling shortwave and longwave radiation made using the enhanced NCVweb feature. Like many scientific organizations, the ARM Data Archive stores and distributes atmospheric data from the ARM sites in Network common data form, or NetCDF. This file format applies names or attributes to the various layers of data for efficient identification and

  7. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 31, 2008 [Facility News] Phase 2 of Orbiting Carbon Observatory Field Campaign Begins Bookmark and Share A camera, weather station, and sun tracker with a protective dome are located on the roof of the fully automated FTS mobile laboratory. Inside the shelter, the spectrometer receives the reflected solar beam from the sun tracker, while the main computer system operates all the instruments and acquires the data. A camera, weather station, and sun tracker with a protective dome are

  8. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 30, 2007 [Facility News] New Radar Wind Profiler Joins AMF Instrument Suite in Germany Bookmark and Share The 1290 MHz wind profiler (foreground) joins the eddy correlation system (background) for the 9-month deployment in Germany. A new 1290 MHz radar wind profiler has joined the ARM Mobile Facility instrument suite for the Convective and Orographic Precipitation Study (COPS) in Germany. This system operates similarly to a Doppler radar and provides measurements of backscattered

  9. ARM - Facility News Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 15, 2009 [Facility News] Spectroradiometer Completes Field Campaign at North Slope Bookmark and Share Dan Lubin, lead scientist for the ASD campaign, pauses for a photo with the instrument on the skydeck at the ARM Barrow site. Dan Lubin, lead scientist for the ASD campaign, pauses for a photo with the instrument on the skydeck at the ARM Barrow site. In October, researchers funded by the National Science Foundation completed a six-month redeployment of the Analytical Spectral Devices

  10. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  11. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  12. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  13. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  14. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  15. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  16. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers [EERE]

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  17. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers [EERE]

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  18. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  19. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  20. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  1. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  2. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  3. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  4. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  5. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  6. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  7. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  8. International News | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    International News International News April 14, 2016 International News EM Shares Waste Isolation Pilot Plant Lessons Learned with Nuclear Energy Agency PARIS - EM officials shared lessons learned from the 2014 Waste Isolation Pilot Plant underground fire and radiological release with the Nuclear Energy Agency (NEA) Division of Radiological Protection and Radioactive Waste Management in a seminar in Paris recently. December 29, 2015 The UK delegation gathers at the front of the H Reactor core.

  9. NIF & Photon Science News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    nifps_news NIF & Photon Science News × Subscribe to our News Alerts * Your Email Address: * Preferred Format: HTML Text Subscribe August 24, 2016 Tweet Spotlight on: Discovery Science A Big Week for NIF Discovery Science During the week of July 31 to Aug. 4, five groups of NIF users worked with LLNL researchers to carry out a successful NIF Discovery Science shot week. The teams conducted 13 experiments in five separate basic high energy density (HED) science experimental campaigns in five

  10. Top Science News of 2014

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Top Science News of 2014 Top Science News of 2014 Biosurveillance, secure computing, alternative energy, unique capabilities highlight the year December 22, 2014 Top Science News of 2014 Biosurveillance, secure computing, alternative energy, unique capabilities highlight the year. Contact Communications Office "The breadth of scientific expertise and range of disciplines necessary for supporting Los Alamos's national security mission can be seen when reflecting on some of the year's more

  11. Media Corner - News Archive: 2012

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 News Archive: 2012 US ITER News A landmark decree authorizes ITER construction [ITER Newsline, November 12, 2012] Nuclear fusion, JET and ITER: Your questions answered [The Engineer, November 5, 2012] Thom Mason talks about US ITER: 'When you're running a project, you've got to go full steam ahead' [Knoxville News Sentinel, July 16, 2012] New Jersey firm creates jobs and vital components for world-leading experiment[Princeton Plasma Physics Laboratory, July 10, 2012] New procurement

  12. Media Corner - News Archive: 2013

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 News Archive: 2013 US ITER News Final design review for central solenoid [ITER Newsline, December 4, 2013] Another step towards powering the ITER facility [ITER Newsline, October 15, 2013] Powering the future: What will fuel the next thousand years? [CBS News, August 26, 2013] Armed and ready to identify leaks [ITER Newsline, May 6, 2013] A symphony of particles [ITER Newsline, February 4, 2013] Robustness of ITER's solenoid conductor confirmed [ITER Newsline, February 4, 2013

  13. Media Corner - News Archive: 2014

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 News Archive: 2014 US ITER News First highly exceptional load sails to ITER [ITER Newsline, November 17, 2014] Second delivery of components to ITER [ITER Newsline, September 18, 2014] Disruption mitigation team reviews progress [ITER Newsline, September 19, 2014] ITER receives first plant components [World Nuclear News, September 5, 2014] High voltage surge arrestors are the first components delivered to ITER [ITER Newsline, September 4, 2014] Foundation in place for ITER tokamak [World

  14. News | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News News News July 13, 2016 Department of Energy Cites BWXT Conversion Services, LLC for Worker Safety and Health Program Violations The U.S. Department of Energy (DOE) today issued a Preliminary Notice of Violation (PNOV) to BWXT Conversion Services, LLC (BWCS) for violations of DOE worker safety and health requirements. DOE's enforcement program holds contractors accountable for meeting regulatory requirements and maintaining a safe and healthy workplace. September 2, 2015 Nuclear Executive

  15. Bisfuel links - Solar energy news

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar energy news" target"blank">ASU Lightworks http:www.sciencedaily.comnewsmatterenergysolarenergy" target"blank">ScienceDaily: Solar Energy ...

  16. DOE - NNSA/NFO -- News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office News Releases News releases on events occurring at the NNSA Nevada Field Office or the Nevada National Security Site are produced by the Office of Public Affairs. All releases include contact information for the public affairs officer who produced the release. The current calendar year News Releases are listed below. THIS IS AN EXERCISE INCIDENT AT NEVADA NATIONAL SECURITY SITE THIS IS AN EXERCISE North Las Vegas - A Joint

  17. Monthly News Blast: February 2013

    Broader source: [DOE]

    In the February 2013 Monthly News Blast, read about recent blog posts, the monthly staff spotlight video, upcoming events, and more.

  18. ARM - ACAPEX News and Press

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CaliforniaACAPEX News and Press HI to CA Deployment AMF Home Hawaii to California Home ... To Study 'Atmospheric River' Effects On California Drought" February 3, 2015 Capital ...

  19. April 2013 Monthly News Blast

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    KDF Social Media YouTube Facebook Twitter Blog Past Newsletters Bioenergy Social Media & Multimedia Corner Monthly News Blast April 2013 Register Now for the 2013 ...

  20. PNNL: News Center - Science Highlights

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Multimedia Photos PNNL B-Roll PNNL Videos PNNL's YouTube Channel Additional Resources Newsletters Science Highlights Publications DOE Pulse EurekAlert National Lab News Battelle ...