National Library of Energy BETA

Sample records for helps building owners

  1. Aligning Building Owners and Service Providers

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    require two-way interactions and communication with key retrofit market stakeholders ... regional retrofit market building owner, auditor, and contractor businesses Integrated ...

  2. EERE Success Story-Database Aids Building Owners and Operators...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making EERE Success Story-Database Aids Building Owners and Operators in Energy-Efficiency Project ...

  3. Database Aids Building Owners and Operators in Energy-Efficiency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making ...

  4. Building Energy Asset Score: Building Owners | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Owners Building Energy Asset Score: Building Owners The U.S. Department of Energy's Building Energy Asset Score is a national standardized tool for evaluating the physical and structural energy efficiency of commercial and multifamily residential buildings. The Asset Score generates a simple energy efficiency rating that enables comparison among buildings, and identifies opportunities for users to invest in energy efficiency upgrades. It is web-based and free to use. View information

  5. MAINE MULTIFAMILY BUILDING OWNERS TRUST IN EFFICIENCY | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy MAINE MULTIFAMILY BUILDING OWNERS TRUST IN EFFICIENCY MAINE MULTIFAMILY BUILDING OWNERS TRUST IN EFFICIENCY MAINE MULTIFAMILY BUILDING OWNERS TRUST IN EFFICIENCY Nearly 70% of households in Maine rely on fuel oil as their primary energy source for home heating, more than any other state. Coupled with the state's long, cold winters, homeowners' dependence on oil renders them particularly vulnerable to fluctuating fuel costs. Especially for the state's aging multifamily housing

  6. Energy Efficiency: Helping Home Owners and Businesses Understand Energy Usage

    Broader source: Energy.gov [DOE]

    Learn how a team at Berkeley Lab is helping consumers and businesses understand their energy use and save money.

  7. Energy Efficiency Upgrades Help Build Better Neighborhoods |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency Upgrades Help Build Better Neighborhoods Energy Efficiency Upgrades Help Build Better Neighborhoods May 6, 2013 - 4:55pm Addthis In neighborhoods all across the...

  8. EERE Success Story-Database Aids Building Owners and Operators in

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Efficiency Project Decision Making | Department of Energy Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making EERE Success Story-Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making September 23, 2013 - 12:00am Addthis In June 2013, the Building Technologies Office launched the Buildings Performance Database (BPD). Currently, residential and commercial buildings account for approximately 70% of electricity

  9. MAINE MULTIFAMILY BUILDING OWNERS TRUST IN EFFICIENCY | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    MEP focused on financial incentives to help Maine landlords ... MEP expanded these services to small- and medium-sized ... Marketing and Outreach: MEP recruited participants by ...

  10. DOE Resources Help Measure Building Energy Benchmarking Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Resources Help Measure Building Energy Benchmarking Policy & Program Effectiveness DOE Resources Help Measure Building Energy Benchmarking Policy & Program Effectiveness May 21,...

  11. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... including free energy assessments, support, and troubleshooting through a business upgrade coordinator, as well as translation services for non-English speaking business owners. ...

  12. Energy Efficiency Upgrades Help Build Better Neighborhoods |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    comfort of our buildings. | Photo by Ed Hancock, NREL. Rebecca Matulka Rebecca Matulka Former Digital Communications Specialist, Office of Public Affairs What are the key facts? ...

  13. Better Buildings Expanding to Help Increase Efficiency in Homes

    Broader source: Energy.gov [DOE]

    To further advance energy efficiency in buildings across the country, the Department of Energy is launching two new Better Buildings Accelerators that will help American families improve the efficiency of their homes.

  14. New Design Tool Can Help Cut building Energy Use

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Design Tool Can Help Cut Building Energy Use By Up to 50 Percent Energy Efficient Buildings Can Substantially Reduce Global Warming For information contact: e:mail: Public Affairs Golden, CO, January 22, 1998 — Designing state-of-the-art, energy efficient buildings just got easier. A new, upgraded software package can help almost any architect or engineer evaluate passive solar and efficiency design strategies in a matter of minutes on an office personal computer. The new software - Energy-10

  15. Berkeley Lab to Help Build Straw Bale Building

    SciTech Connect (OSTI)

    Worsham, S.A.; Van Mechelen, G.

    1998-12-01

    The Shorebird Environmental Learning Center (SELC) is a new straw bale building that will showcase current and future technologies and techniques that will reduce the environmental impacts of building construction and operations. The building will also serve as a living laboratory to test systems and monitor their performance. The project will be the model for a building process that stops using our precious resources and reduces waste pollution. The rice straw that will be used for the bale construction is generally waste material that is typically burned--millions of tons of it a year--especially in California's San Joaquin Valley. Buildings have significant impacts on the overall environment. Building operations, including lighting, heating, and cooling, consume about 30% of the energy used in the United States. Building construction and the processes into making building materials consume an additional 8% of total energy. Construction also accounts for 39% of wood consumed in the U S, while 25% of solid waste volume is construction and demolition (C &D) debris. The SELC will incorporate a variety of materials and techniques that will address these and other issues, while providing a model of environmentally considered design for Bay Area residents and builders. Environmental considerations include energy use in construction and operations, selection of materials, waste minimization, and indoor air quality. We have developed five major environmental goals for this project: (1) Minimize energy use in construction and operations; (2) Employ material sources that are renewable, salvaged, recycled, and/or recyclable; (3) Increase building lifespan with durable materials and designs that permit flexibility and modification with minimal demolition; (4) Reduce and strive to eliminate construction debris; and (5) Avoid products that create toxic pollutants and make a healthy indoor environment.

  16. MEMORANDUM OWNER(S)

    Office of Legacy Management (LM)

    OWNER(S) -------- past : Lb-J ' 0-c @+a+~-~% current: -- ________________________ ------7--- -- Owner cantacted 0 yes 4t no; if yes, date contacted TYPE OF OPERATION ----------------- q Research & Development 0 Facility Type 0 Production scale testing 0 Manufacturing 0 Pilat Scale 0 Bench Scale Process i Theoretical Studies Sample & Analysis 0 Production 0 Di5posal/Storage TYPE OF CONTRACT ----_----------- 0 Prime q Subcontractor Cl Purchase Order 0 University 0 Research Organization 0

  17. Better Buildings Case Competition Helps Develop Future Clean Energy Leaders

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Case Competition Helps Develop Future Clean Energy Leaders Better Buildings Case Competition Helps Develop Future Clean Energy Leaders March 7, 2013 - 10:30am Addthis Pictured here are eight of the 10 members of MIT's team who competed in last year's Better Buildings Case Competition. From left to right: Neheet Trivedi, Michael Zallow, Patrick Flynn, Elena Alschuler, Kate Goldstein, Brendan McEwen, Nikhil Nadkarni and Nan Zhao. Not pictured: Christopher Jones and

  18. Energy Department Helps Cities, Counties Evaluate and Improve Building Energy Performance

    Broader source: Energy.gov [DOE]

    Many states, counties, and cities are implementing their own building energy benchmarking and transparency policies to improve ways owners, tenants and others can access a building’s energy use. The main goal is to increase the awareness of energy usage to encourage businesses and communities to save energy and reduce pollution through efficiency upgrades while increasing the real estate valuation for high performing buildings. To help jurisdictions measure the impact of their benchmarking and transparency policy efforts, the Energy Department recently released the Benchmarking & Transparency Policy and Program Impact Evaluation Handbook. It walks jurisdictions through the evaluation steps, providing both a strategic planning framework and standard methodologies to measure the impacts of benchmarking programs and policies.

  19. Text-Alternative Version: The L Prize-Winning LED A19 Replacement—What Commercial Building Owners/Operators Can Expect in 2012

    Broader source: Energy.gov [DOE]

    Below is the text-alternative version of the "The L Prize-Winning LED A19 Replacement—What Commercial Building Owners/Operators Can Expect in 2012" webcast, held January 18, 2012.

  20. Database Aids Building Owners and Operators in Energy-Efficiency Project Decision Making

    Broader source: Energy.gov [DOE]

    EERE's Buildings Performance Database, launched in June 2013, provides access to empirical data on the actual energy performance, as well as physical and operational characteristics of commercial and residential buildings.

  1. Energy Savers: A one-stop energy efficiency shop for multifamily building owners

    Broader source: Energy.gov [DOE]

    This is a document from Energy Impact Illinois posted on the website of U.S. Department of Energy's Better Buildings Neighborhood Program.

  2. Alternative Fuels Data Center: Camp Discovery Helps Kids Build an Electric

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Dune Buggy Camp Discovery Helps Kids Build an Electric Dune Buggy to someone by E-mail Share Alternative Fuels Data Center: Camp Discovery Helps Kids Build an Electric Dune Buggy on Facebook Tweet about Alternative Fuels Data Center: Camp Discovery Helps Kids Build an Electric Dune Buggy on Twitter Bookmark Alternative Fuels Data Center: Camp Discovery Helps Kids Build an Electric Dune Buggy on Google Bookmark Alternative Fuels Data Center: Camp Discovery Helps Kids Build an Electric Dune

  3. Working with Condominium Owners and Associations | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Working with Condominium Owners and Associations Better Buildings Neighborhood Program Multifamily and Low-Income Peer Exchange Call: Working with Condominium Owners and ...

  4. OWNER(S)

    Office of Legacy Management (LM)

    BUILDINGS EQUIPMENT ORE OR RAW HATL 0 FINAL PRODUCT B WASTE & RESIDUE @ . .,' ' -. . ?t ' AEWME; INVOLVEMENT AT SITE ---------------- Control Health Physics Protection . ...

  5. EERE Success Story-EERE 'Buildings Prioritization Tool' Helps...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... and Evaluate Fuel Cell Vehicles EERE Success Story-EERE Energy Literacy: Engaging Spanish Speakers Project Overview Positive Impact EERE Buildings Prioritization Tool supports ...

  6. EnergyPlus Boosts Building Efficiency with Help from Autodesk | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy EnergyPlus Boosts Building Efficiency with Help from Autodesk EnergyPlus Boosts Building Efficiency with Help from Autodesk November 21, 2013 - 1:55pm Addthis Amir Roth, Ph.D. Amir Roth, Ph.D. Building Energy Modeling Technology Manager KEY FACTS Building energy simulation is the calculation of energy used to heat, cool, light, and ventilate a building given a description of the building and its operation. Building energy simulation plays important roles in the design of

  7. EERE Success Story-EERE 'Buildings Prioritization Tool' Helps Shape EERE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Projects | Department of Energy 'Buildings Prioritization Tool' Helps Shape EERE Projects EERE Success Story-EERE 'Buildings Prioritization Tool' Helps Shape EERE Projects June 17, 2013 - 12:00am Addthis The EERE "Buildings Prioritization Tool" has supported evidence-based decision making, led to smarter investment in energy efficiency, and helped set national goals for efficiency. EERE must make investment decisions within resource constraints to maximize value and for the

  8. EERE 'Buildings Prioritization Tool' Helps Shape EERE Projects...

    Broader source: Energy.gov (indexed) [DOE]

    has supported evidence-based decision making, led to smarter investment in energy efficiency, and helped set national goals for efficiency. EERE must make investment decisions...

  9. Lab Helps FAA Build Energy-Efficient Control Towers

    Broader source: Energy.gov [DOE]

    With help from the Pacific Northwest National Laboratory and its subcontractor, Redhorse Corporation, the agency that keeps our country’s airports running is bolstering its energy efficiency.

  10. Energy Department Launches New Data-Driven Initiative to Help Cities, States Advance Building Efficiency

    Broader source: Energy.gov [DOE]

    The Energy Department today announced the launch of the SEED Collaborative, a strategic effort to help cities and states manage building energy performance data and identify opportunities for efficiency improvements in their jurisdictions.

  11. Hunting Hurricanes...and Data to Help Build Better Offshore Wind Turbines |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Hunting Hurricanes...and Data to Help Build Better Offshore Wind Turbines Hunting Hurricanes...and Data to Help Build Better Offshore Wind Turbines June 2, 2014 - 12:21pm Addthis Flying high 1 of 4 Flying high P-3 aircraft are used by the National Oceanic and Atmospheric Administration (NOAA) to track the strength, temperature, pressure, and wind speed and direction of hurricanes. This information could be used to develop stronger offshore wind turbines and components,

  12. How Construction Workers are Helping to Build the Clean Energy Economy |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Construction Workers are Helping to Build the Clean Energy Economy How Construction Workers are Helping to Build the Clean Energy Economy July 24, 2014 - 5:40pm Addthis U.S. Secretary of Energy Ernest Moniz speaks with tower construction workers Ed Zona, Al Williams and Jeff Reick (left to right) in Pittsburgh on Monday, July 21, 2014. | Photo courtesy of PNC. U.S. Secretary of Energy Ernest Moniz speaks with tower construction workers Ed Zona, Al Williams and Jeff Reick

  13. Better Buildings Challenge Accelerator Support - 2014 BTO Peer Review |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Accelerator Support - 2014 BTO Peer Review Better Buildings Challenge Accelerator Support - 2014 BTO Peer Review Presenter: Monisha Shah, National Renewable Energy Laboratory Through the Better Buildings Energy Data Accelerator, local governments are joining forces with their utilities so that commercial and multifamily building owners can more easily access whole-building energy usage data. This effort helps building owners-especially those with multiple tenants-break

  14. Nanoscale Building Blocks and DNA "Glue" Help Shape 3D Architectures |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    U.S. DOE Office of Science (SC) Nanoscale Building Blocks and DNA "Glue" Help Shape 3D Architectures Basic Energy Sciences (BES) BES Home About Research Facilities Science Highlights Benefits of BES Funding Opportunities Basic Energy Sciences Advisory Committee (BESAC) Community Resources Contact Information Basic Energy Sciences U.S. Department of Energy SC-22/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3081 F: (301) 903-6594 E: Email Us More

  15. NREL Helps Habitat for Humanity of Metro Denver Build Earth-Smart House

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Habitat for Humanity of Metro Denver Build Earth-Smart House For more information contact: e:mail: Public Affairs Golden, Colo., April 14, 1997 -- The U.S. Department of Energy's National Renewable Energy Laboratory's (NREL) Exemplary Buildings team helped Habitat for Humanity of Metro Denver design a low energy passive solar Earth-Smart house that debuts next week in downtown Denver. Media are invited to attend the dedication ceremony on Earth Day, April 22 at 11:30 a.m. - 12:15 p.m. The house

  16. NREL's OpenStudio Helps Design More Efficient Buildings (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2014-07-01

    The National Renewable Energy Laboratory (NREL) has created the OpenStudio software platform that makes it easier for architects and engineers to evaluate building energy efficiency measures throughout the design process. OpenStudio makes energy modeling more accessible and affordable, helping professionals to design structures with lower utility bills and less carbon emissions, resulting in a healthier environment. OpenStudio includes a user-friendly application suite that makes the U.S. Department of Energy's EnergyPlus and Radiance simulation engines easier to use for whole building energy and daylighting performance analysis. OpenStudio is freely available and runs on Windows, Mac, and Linux operating systems.

  17. ALSO: BUILDING A BETTER MICROSYSTEM SPRAY IT AGAIN, SAM VR Tool Helps Prepare for Terrorist Attacks

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1999 - 2000 ALSO: BUILDING A BETTER MICROSYSTEM SPRAY IT AGAIN, SAM VR Tool Helps Prepare for Terrorist Attacks A QUARTERLY RESEARCH & DEVELOPMENT JOURNAL VOLUME 1, NO. 4 Z MACHINE Providing Clues to Astronomical Mysteries S A N D I A T E C H N O L O G Y [ From atop a 25-foot ladder, Sandian Larry Shipers examines a pair of cameras that provide feedback to a computer system that controls Sandia's automated painting system for the F-117 Nighthawk, also known as Stealth. The system sprays a

  18. Energy Department Announces $10 Million for Innovative Commercial Building Technologies and Unveils New Commercial Buildings 101 Video

    Broader source: Energy.gov [DOE]

    The Energy Department today announced a $10 million funding opportunity to help demonstrate and deploy energy efficiency technologies for commercial buildings, including projects that will bring next generation building systems and components to a broader market faster – helping to save building owners and businesses money by saving energy.

  19. CBEI: Aligning Owners and Service Providers - 2015 Peer Review | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Aligning Owners and Service Providers - 2015 Peer Review CBEI: Aligning Owners and Service Providers - 2015 Peer Review Presenter: Leslie Billhymer, University of Pennsylvania View the Presentation PDF icon CBEI: Aligning Owners and Service Providers - 2015 Peer Review More Documents & Publications CBEI: Lessons Learned from Integrated Retrofits in Small and Medium Sized Commercial Buildings - 2015 Peer Review CBEI: HVAC Packages for Small and Medium Sized Commercial Buildings

  20. Working with Condominium Owners and Associations | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with Condominium Owners and Associations Working with Condominium Owners and Associations Better Buildings Neighborhood Program Multifamily and Low-Income Peer Exchange Call: Working with Condominium Owners and Associations, call slides and discussion summary, November 8, 2012. PDF icon Call Slides and Discussion Summary More Documents & Publications Engaging and Growing Small Contractor Businesses Shared Space vs. In-Unit Upgrades in Multifamily Buildings Stewards of Affordable Housing for

  1. Business Owners: Prepare a Business Recovery Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a Business Recovery Plan Business Owners: Prepare a Business Recovery Plan Business Owners: Prepare a Business Recovery Plan Smart business owners develop and test a written business recovery plan to support them through disasters and help them stay in operation. Planning ahead will help your company get back to business more quickly. Consider your risks-How might a disaster affect your business operations? What natural disasters are most likely where you operate? Identify your critical business

  2. Recovery Act Helps Y-12 Exceed Cleanup Goal at Manhattan Project-Era Building

    Broader source: Energy.gov [DOE]

    Beta 4, one of the oldest and largest buildings at the Y-12 National Security Complex, recently reached a significant cleanup milestone. The second floor of the building, more than 82,000 square feet, has been cleared of large equipment and waste from Cold War operations.

  3. Employee-Focused Structure Helps Produce Upgrades for Contractor |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Employee-Focused Structure Helps Produce Upgrades for Contractor Employee-Focused Structure Helps Produce Upgrades for Contractor Photo of a young man sitting on a couch, looking at the camera, dressed in jeans and polo shirt. Progressive Building Solutions, an energy efficiency contractor participating in Seattle, Washington's Community Power Works program, has an intriguing model to help its employees feel connected to the company's success-employees are part owners.

  4. Small Commercial Building Re-tuning: A Primer

    SciTech Connect (OSTI)

    Cort, Katherine A.; Hostick, Donna J.; Underhill, Ronald M.; Fernandez, Nicholas; Katipamula, Srinivas

    2013-09-30

    To help building owners and managers address issues related to energy-efficient operation of small buildings, DOE has developed a Small Building Re-tuning training curriculum. This "primer" provides additional background information to understand some of the concepts presented in the Small Building Re-tuning training. The intent is that those who are less familiar with the buidling energy concepts will review this material before taking the building re-tuning training class.

  5. Recovery Act Funds are Helping Oak Ridge's Building K-33 Disappear Fast |

    Office of Environmental Management (EM)

    Recovery Act Funding Opportunities Webcast Recovery Act Funding Opportunities Webcast On this page you will find a Webcast that was presented by the U.S. Department of Energy's Geothermal Technologies Office (GTO) (formerly Geothermal Technologies Program) to help the U.S. geothermal community effectively respond to Funding Opportunity Announcements issued in 2009. As a result of the 2009 American Reinvestment and Recovery Act (ARRA), GTO issued four Funding Opportunity Announcements (FOAs)

  6. Commercial Building Energy Asset Score

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Building Energy Asset Score 2014 Building Technologies Office Peer Review Nora ... (MA DOER) and Northeast Energy Efficiency Partnership (NEEP) Building Owners...

  7. Business Owners: Respond to an Energy Emergency | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Respond to an Energy Emergency Business Owners: Respond to an Energy Emergency Business Owners: Respond to an Energy Emergency Ensure your building is safe to occupy-Initially allow only essential, critical-operations staff into restricted areas. Ask your local or State health department for guidance on determining the safety of your building. Decide whether to activate backup power-If your backup generator doesn't automatically turn on during a power outage, you'll have to determine when to

  8. Building Energy Modeling Library

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    eere.energy.gov Project Overview Building Energy Modeling (BEM) Library * Define and ... currently applied to potential energy efficiency measures by building owners when ...

  9. Better Buildings Partners Gather to Plan for the Future | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Better Buildings Partners Gather to Plan for the Future Better Buildings Partners Gather to Plan for the Future Better Buildings Neighborhood Program partners are doing great things across the country to help home and business owners save energy and increase comfort while creating jobs. Better Buildings seed funding helped these programs get underway. Now, less than halfway through the grant period, program partners are already looking ahead to how their programs will continue their

  10. JOBAID-ORGANZIATION OWNER OVERVIEW

    Broader source: Energy.gov [DOE]

    The purpose of this job aid is to guideorganization ownersthrough the step-by-step process of available features within SuccessFactors Learning.

  11. Business Owners: Prepare for Fuel Shortages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Shortages Business Owners: Prepare for Fuel Shortages Business Owners: Prepare for Fuel Shortages You may need fuel for vehicles, generators, and other equipment to continue operating your business during an emergency. During a shortage, local authorities and fuel suppliers will prioritize getting fuel to key assets such as emergency operations centers, hospitals, food supply dealers, water supply plants, and telecommunication networks. Plan ahead to help make sure you have adequate

  12. Buildings

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    is allowing Commercial Buildings (ISO 50003 - Buildings and Building Complexes) ... SEP program, including associated standards, protocols, and application may be used ...

  13. Business Owners: Prepare for Utility Disruptions | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Utility Disruptions Business Owners: Prepare for Utility Disruptions Business Owners: Prepare for Utility Disruptions Have a plan in place in case a natural disaster or other ...

  14. Information System Owner | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Information System Owner (also referred to as System Owner) is responsible for the procurement, development, integration, modification, operation, maintenance, and retirement of an...

  15. Setting Whole-Building Absolute Energy Use Targets for the K-12 School, Retail, and Healthcare Sectors: Preprint

    SciTech Connect (OSTI)

    Leach, M.; Bonnema, E.; Pless, S.; Torcellini, P.

    2012-08-01

    This paper helps owners' efficiency representatives to inform executive management, contract development, and project management staff as to how specifying and applying whole-building absolute energy use targets for new construction or renovation projects can improve the operational energy performance of commercial buildings.

  16. Owners of nuclear power plants

    SciTech Connect (OSTI)

    Hudson, C.R.; White, V.S.

    1996-11-01

    Commercial nuclear power plants in this country can be owned by a number of separate entities, each with varying ownership proportions. Each of these owners may, in turn, have a parent/subsidiary relationship to other companies. In addition, the operator of the plant may be a different entity as well. This report provides a compilation on the owners/operators for all commercial power reactors in the United States. While the utility industry is currently experiencing changes in organizational structure which may affect nuclear plant ownership, the data in this report is current as of July 1996. The report is divided into sections representing different aspects of nuclear plant ownership.

  17. Owners of Nuclear Power Plants

    SciTech Connect (OSTI)

    Reid, R.L.

    2000-01-12

    Commercial nuclear power plants in this country can be owned by a number of separate entities, each with varying ownership proportions. Each of these owners may, in turn, have a parent/subsidiary relationship to other companies. In addition, the operator of the plant may be a different entity as well. This report provides a compilation on the owners/operators for all commercial power reactors in the United States. While the utility industry is currently experiencing changes in organizational structure which may affect nuclear plant ownership, the data in this report is current as of November 1999. The report is divided into sections representing different aspects of nuclear plant ownership.

  18. Commercial Building Energy Asset Score - 2014 BTO Peer Review...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Asset Score - 2014 BTO Peer Review Commercial Building Energy Asset Score - 2014 ... energy efficiency in the commercial building sector is that building owners and ...

  19. Build-

    U.S. Energy Information Administration (EIA) Indexed Site

    0. Cooling Equipment, Number of Buildings for Non-Mall Buildings, 2003" ,"Number of Buildings (thousand)" ,"All Build- ings*","Cooled Build- ings","Cooling Equipment (more than one may apply)" ,,,"Resid- ential- Type Central Air Condi- tioners","Heat Pumps","Indiv- idual Air Condi- tioners","District Chilled Water","Central Chillers","Pack- aged Air Condi- tioning Units","Swamp

  20. Information System Owner (ISO) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Owner (ISO) Information System Owner (ISO) startup-849805_960_720.jpg The Information System Owner (ISO) is responsible for every stage in the lifecycle of an information system, including: procurement development integration modification operation maintenance retirement The ISO is a key contributor in: developing system design specifications testing implementation PDF icon Information System Owner Core Competency Training Worksheet More Documents & Publications Information System Security

  1. Building

    U.S. Energy Information Administration (EIA) Indexed Site

    DIV. Electricity Consumption and Expenditure Intensities by Census Division, 1999" ,"Electricity Consumption",,,"Electricity Expenditures" ,"per Building (thousand kWh)","per...

  2. Build-

    U.S. Energy Information Administration (EIA) Indexed Site

    1. Cooling Equipment, Floorspace for Non-Mall Buildings, 2003" ,"Total Floorspace (million square feet)" ,"All Build- ings*","Cooled Build- ings","Cooling Equipment (more than one may apply)" ,,,"Resid- ential- Type Central Air Condi- tioners","Heat Pumps","Indiv- idual Air Condi- tioners","District Chilled Water","Central Chillers","Pack- aged Air Condi- tioning Units","Swamp

  3. Building technologies

    SciTech Connect (OSTI)

    Jackson, Roderick

    2014-07-14

    After growing up on construction sites, Roderick Jackson is now helping to make buildings nationwide far more energy efficient.

  4. Building technologies

    ScienceCinema (OSTI)

    Jackson, Roderick

    2014-07-15

    After growing up on construction sites, Roderick Jackson is now helping to make buildings nationwide far more energy efficient.

  5. Commercial and Multifamily Building Tenant Energy Usage Aggregation and Privacy

    SciTech Connect (OSTI)

    Livingston, Olga V.; Pulsipher, Trenton C.; Wang, Na

    2014-11-17

    In a number of cities and states, building owners are required to disclose and/or benchmark their building energy use. This requires the building owner to possess monthly whole-building energy usage information, which can be challenging for buildings in which individual tenants have their own utility meters and accounts with the utility. Some utilities and utility regulators have turned to aggregation of customer data as a way to give building owners the whole-building energy usage data while protecting customer privacy. However, no utilities or regulators appear to have conducted a concerted statistical, cybersecurity, and privacy analysis to justify the level of aggregation selected. Therefore, the Tennant Data Aggregation Task was established to help utilities address these issues and provide recommendations as well as a theoretical justification of the aggregation threshold. This study is focused on the use case of submitting data for ENERGY STAR Portfolio Manager (ESPM), but it also looks at other potential use cases for monthly energy consumption data.

  6. Better Buildings Alliance Tech Team Impact Framework - 2014 BTO Peer Review

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Tech Team Impact Framework - 2014 BTO Peer Review Better Buildings Alliance Tech Team Impact Framework - 2014 BTO Peer Review Presenter: Amy Jiron, U.S. Department of Energy The High Impact Technology (HIT) catalyst is designed to help identify and prioritize cost-effective, underutilized, energy-efficient technologies. Commercial building owners, operators, and designers; technology providers; utilities; and governments can use this information to focus resource

  7. Better Buildings Neighborhood Program Multi-family and Low Income...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Multi- family and Low Income Peer Exchange Call: Working with Condominium Owners and ... Buildings (17%) * Working with Middle Income Multifamily Buildings (50%) Participants ...

  8. Buildings*","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings"

    U.S. Energy Information Administration (EIA) Indexed Site

    Occupancy of Nongovernment-Owned and Government-Owned Buildings, Number of Buildings for Non-Mall Buildings, 2003" ,"Number of Buildings (thousand)" ,"All Buildings*","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings" ,,"Nongov- ernment- Owned Buildings","Owner Occupied","Nonowner Occupied","Unocc- upied","Govern- ment- Owned

  9. Visiting With Santa Fe Small Business Owners

    Broader source: Energy.gov [DOE]

    You’ve got to do your homework in order to contract with the federal government. Whether you are a large or small business owner, learning the ins and outs of government contracting takes...

  10. Commercial Building Energy Asset Score Program Overview and Technical Protocol (Version 1.1)

    SciTech Connect (OSTI)

    Wang, Na; Goel, Supriya; Makhmalbaf, Atefe

    2013-08-09

    The U.S. Department of Energy (DOE) is developing a voluntary national scoring system for commercial buildings to help building owners and managers assess a building’s energy-related systems independent of operations. The goal of the score is to facilitate cost-effective investment in energy efficiency improvements of commercial buildings. The system, known as the Commercial Building Energy Asset Score, will allow building owners and managers to compare their building infrastructure against peers and track building upgrades over time. The system will also help other building stakeholders (e.g., building investors, tenants, financiers, and appraisers) understand the relative efficiency of different buildings in a way that is independent from operations and occupancy. This report outlines the technical protocol used to generate the energy asset score, explains the scoring methodology, and provides additional details regarding the energy asset scoring tool. The alternative methods that were considered prior to developing the current approach are described in the Program Overview and Technical Protocol Version 1.0.

  11. Business Owners: Prepare a Business Recovery Plan | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Business Owners: Prepare a Business Recovery Plan Smart business owners develop and test a ... Identify your critical business functions-What resources and personnel will you need to ...

  12. CBEI: Aligning Owners and Service Providers - 2015 Peer Review...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Aligning Owners and Service Providers - 2015 Peer Review CBEI: Aligning Owners and Service Providers - 2015 Peer Review Presenter: Leslie Billhymer, University of Pennsylvania View ...

  13. Danish Wind Turbine Owners Association | Open Energy Information

    Open Energy Info (EERE)

    Turbine Owners Association Jump to: navigation, search Name: Danish Wind Turbine Owners' Association Place: Aarhus C, Denmark Zip: DK-8000 Sector: Wind energy Product: Danish Wind...

  14. Interim Final Report for the Strengthening Retrofit Markets for Comprehensive Savings in Multifamily Buildings

    SciTech Connect (OSTI)

    Meinking, Rick; Adamson, Joy M

    2013-12-20

    Energy efficiency is vitally important in Maine. Nearly 70% of Maine households rely on fuel oil as their primary energy source for home heating, a higher share than in any other state. Coupled with the state's long, cold winters, Maine's dependence on oil renders homeowners particularly vulnerable to fluctuating fuel costs. With $4.5 million in seed funding from the Energy Department's Better Buildings Neighborhood Program, the Governor's Energy Office (GEO), through Efficiency Maine Trust (the Trust), is spurring Maine landlords to lower their monthly energy bills and improve comfort for their tenants during the state's cold winter months and increasingly warmer summers. Maine's aging multifamily housing stock can be expensive to heat and costly to maintain. It is not unusual to find buildings with little or no insulation, drafty windows, and significant air leaks, making them ideal candidates for energy efficiency upgrades. Maine modeled its Multifamily Efficiency Program (MEP) after the state's highly successful Home Energy Savings Program (HESP) for single?family homes. HESP provided cash incentives and financing opportunities to owners of one? to four?unit structures, which resulted in thousands of energy assessments and whole?house energy upgrades in 225 communities. Maine's new MEP multifamily energy efficiency upgrade and weatherization initiative focuses on small to medium?sized (i.e., five to 20 units) apartment buildings. The program's energy efficiency upgrades will provide at least 20% energy savings for each upgraded multifamily unit. The Trusts MEP relies on a network of approved program partners who help move projects through the pipeline from assessment to upgrade. MEP has two components: benchmarking and development of an Energy Reduction Plan (ERP). Using the ENERGY STAR Portfolio Manager benchmarking tool, MEP provides an assessment of current energy usage in the building, establishes a baseline for future energy efficiency improvements, and enables tracking and monitoring of future energy usage at the building all at no cost to the building owner. The ERP is developed by a program partner using either the Trusts approved modeling or prescriptive tools; it provides detailed information about the current energyrelated conditions in the building and recommends energy efficiency, health, and safety improvements. The Trust's delivery contractor provides quality assurance and controls throughout the process. Through this effort, MEP's goal is to establish a self?sustaining, market?driven program, demonstrating the value of energy efficiency to other building owners. The increasing value of properties across the state will help incentivize these owners to continue upgrades after the grant period has ended. Targeting urban areas in Maine with dense clusters of multifamily unitssuch as Portland, Lewiston? Auburn, Bangor, and AugustaMEP engaged a variety of stakeholder groups early on to design its multifamily program. Through direct emails and its website, program officials invited lending institutions, building professionals, engineering firms, equipment distributors, and local property owners associations to attend open meetings around the state to learn about the goals of the multifamily program and to help define its parameters. These meetings helped program administrators understand the diversity of the customer base: some owners are individuals with a single building, while other owners are groups of people or management companies with an entire portfolio of multifamily buildings. The diversity of the customer base notwithstanding, owners see MEP as an opportunity to make gains in their respective properties. Consistently high turnouts at stakeholder meetings fueled greater customer interest as awareness of the program spread through word of mouth. The program also gained traction by utilizing the program partner networks and building on the legacy of the Trusts successful HESP for single?family residences. MEP offers significant incentives for building owners to p

  15. Webinar: Make Your Building Sing!: Building-Retuning to Reduce Energy Waste

    Broader source: Energy.gov [DOE]

    Panelists: Eileen Gohr and Steve Harrison, Parameter Realty Partners; Dennis Bohlayer, Towson University; Benjamin Goldstein, U.S. Department of Energy; Lisa Shulock, Building Owners and Managers...

  16. Commercial Building Energy Asset Score System: Program Overview and Technical Protocol (Version 1.0)

    SciTech Connect (OSTI)

    Wang, Na; Gorrissen, Willy J.

    2013-01-11

    The U.S. Department of Energy (DOE) is developing a national voluntary energy asset score system that includes an energy asset score tool to help building owners evaluate their buildings with respect to the score system. The goal of the energy asset score system is to facilitate cost-effective investment in energy efficiency improvements of commercial buildings. The system will allow building owners and managers to compare their building infrastructure against peers and track building upgrade progress over time. The system can also help other building stakeholders (e.g., building operators, tenants, financiers, and appraisers) understand the relative efficiency of different buildings in a way that is independent from their operations and occupancy. This report outlines the technical protocol used to generate the energy asset score, explains the scoring methodology, and provides additional details regarding the energy asset score tool. This report also describes alternative methods that were considered prior to developing the current approach. Finally, this report describes a few features of the program where alternative approaches are still under evaluation.

  17. Buildings-to-Grid Technical Opportunities: From the Buildings Perspective |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Buildings Perspective Buildings-to-Grid Technical Opportunities: From the Buildings Perspective Technological advances in demand response and energy efficiency have increased the utility of residential and commercial buildings for owners and operators. Yet buildings still lack the capacity to adapt to both internal and external changes, such as occupant needs or grid stability concerns. This report describes technologies and systems needed to transform buildings from the

  18. City of Chicago- Green Building Permit Programs

    Broader source: Energy.gov [DOE]

    The Chicago Department of Buildings (DOB) Green Permit Program provides developers and owners with an incentive to build green by streamlining the permit process timeline for projects which are...

  19. 200 Market Building

    High Performance Buildings Database

    Portland, Oregon The 200 Market Building is a high-rise built in 1973 and located in downtown Portland, Oregon. It was purchased in 1988 by its current owner, 200 Market Associates, primarily because of its optimal location in Portland's central business district. Since 1989 the building has undergone continuous improvements in multiple phases.

  20. Buildings*","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings"

    U.S. Energy Information Administration (EIA) Indexed Site

    8. Occupancy of Nongovernment-Owned and Government-Owned Buildings, Floorspace for Non-Mall Buildings, 2003" ,"Total Floorspace (million square feet)" ,"All Buildings*","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings" ,,"Nongov- ernment- Owned Buildings","Owner Occupied","Nonowner Occupied","Unocc- upied","Govern- ment- Owned

  1. Table HC1-5a. Housing Unit Characteristics by Type of Owner-Occupied Housing Unit,

    U.S. Energy Information Administration (EIA) Indexed Site

    5a. Housing Unit Characteristics by Type of Owner-Occupied Housing Unit, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total Owner- Occupied Units Type of Owner-Occupied Housing Unit RSE Row Factors Single-Family Apartments in Buildings With Mobile Homes Two to Four Units Five or More Units 0.4 0.4 1.8 2.1 1.4 Total ............................................... 72.7 63.2 2.1 1.8 5.7 6.7 Census Region and Division Northeast ......................................

  2. Table HC7-5a. Home Office Equipment by Type of Owner-Occupied Housing Unit,

    U.S. Energy Information Administration (EIA) Indexed Site

    5a. Home Office Equipment by Type of Owner-Occupied Housing Unit, Million U.S. Households, 2001 Home Office Equipment RSE Column Factor: Total Owner- Occupied Units Type of Owner-Occupied Housing Unit RSE Row Factors Single-Family Apartments in Buildings With Mobile Home Two to Four Units Five or More Units 0.3 0.3 2.1 3.0 1.6 Total ............................................... 72.7 63.2 2.1 1.8 5.7 6.7 Households Using Office Equipment .......................... 67.5 59.0 2.0 1.7 4.8 7.0

  3. "Table HC3.1 Housing Unit Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    Housing Unit Characteristics by Owner-Occupied Housing Unit, 2005" " Million Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Housing Unit Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile Homes"

  4. "Table HC3.10 Home Appliances Usage Indicators by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    0 Home Appliances Usage Indicators by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions)" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Home Appliances Usage Indicators",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  5. "Table HC3.11 Home Electronics Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    1 Home Electronics Characteristics by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions)" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Home Electronics Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  6. "Table HC3.12 Home Electronics Usage Indicators by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    2 Home Electronics Usage Indicators by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions)" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Home Electronics Usage Indicators",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  7. "Table HC3.13 Lighting Usage Indicators by Owner-Occupied Housing Unit Zone, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    3 Lighting Usage Indicators by Owner-Occupied Housing Unit Zone, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Lighting Usage Indicators",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile Homes"

  8. "Table HC3.2 Living Space Characteristics by Owner-Occupied Housing Units, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    2 Living Space Characteristics by Owner-Occupied Housing Units, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ," Housing Units (millions) " ,,,"Single-Family Units",,"Apartments in Buildings With--" "Living Space Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile Homes"

  9. "Table HC3.4 Space Heating Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    4 Space Heating Characteristics by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ," Housing Units (millions)" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Space Heating Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile Homes"

  10. "Table HC3.5 Space Heating Usage Indicators by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    5 Space Heating Usage Indicators by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ," Housing Units (millions)" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Space Heating Usage Indicators",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  11. "Table HC3.6 Air Conditioning Characteristics by Owner-Occupied Housing Units, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Air Conditioning Characteristics by Owner-Occupied Housing Units, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Air Conditioning Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  12. "Table HC3.8 Water Heating Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Water Heating Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  13. "Table HC3.9 Home Appliances Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    HC3.9 Home Appliances Characteristics by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Home Appliances Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  14. Commercial Building Partnership General Merchandise Energy Savings Overview

    SciTech Connect (OSTI)

    2013-03-01

    The Commercial Building Partnership (CBP) paired selected commercial building owners and operators with representatives of DOE, national laboratories and private sector exports to explore energy efficiency measures across general merchandise commercial buildings.

  15. Commercial Building Partnership Retail Food Sales Energy Savings Overview

    SciTech Connect (OSTI)

    2013-03-01

    The Commercial Building Partnership (CBP) paired selected commercial building owners and operators with representatives of DOE, national laboratories and private sector exports to explore energy efficiency measures across general merchandise commercial buildings.

  16. Community Resilience: Workshops on Private Sector and Property Owner Requirements for Recovery and Restoration from a Diasaster

    SciTech Connect (OSTI)

    Judd, Kathleen S.; Stein, Steven L.; Lesperance, Ann M.

    2008-12-22

    This report summarizes the results of a proejct sponsored by DTRA to 1) Assess the readiness of private-sector businesses, building owners, and service providers to restore property and recover operations in the aftermath of a wide-area dispersal of anthrax; and 2) Understand what private property owners and businesses "want and need" from federal, state, and local government to support recovery and restoration from such an incident.

  17. Commercial and Multifamily Building Benchmarking and Disclosure |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy and Multifamily Building Benchmarking and Disclosure Commercial and Multifamily Building Benchmarking and Disclosure Better Buildings Residential Network Peer Exchange Call: Commercial and Multifamily Building Benchmarking and Disclosure, Call Slides, July 25, 2013. PDF icon Call Slides and Discussion Summary More Documents & Publications Information Technology Tools for Multifamily Building Programs Working with Condominium Owners and Associations Moving Multifamily

  18. Understanding Building Infrastructure and Building Operation through DOE Asset Score Model: Lessons Learned from a Pilot Project

    SciTech Connect (OSTI)

    Wang, Na; Goel, Supriya; Gorrissen, Willy J.; Makhmalbaf, Atefe

    2013-06-24

    The U.S. Department of Energy (DOE) is developing a national voluntary energy asset score system to help building owners to evaluate the as-built physical characteristics (including building envelope, the mechanical and electrical systems) and overall building energy efficiency, independent of occupancy and operational choices. The energy asset score breaks down building energy use information by simulating building performance under typical operating and occupancy conditions for a given use type. A web-based modeling tool, the energy asset score tool facilitates the implementation of the asset score system. The tool consists of a simplified user interface built on a centralized simulation engine (EnergyPlus). It is intended to reduce both the implementation cost for the users and increase modeling standardization compared with an approach that requires users to build their own energy models. A pilot project with forty-two buildings (consisting mostly offices and schools) was conducted in 2012. This paper reports the findings. Participants were asked to collect a minimum set of building data and enter it into the asset score tool. Participants also provided their utility bills, existing ENERGY STAR scores, and previous energy audit/modeling results if available. The results from the asset score tool were compared with the building energy use data provided by the pilot participants. Three comparisons were performed. First, the actual building energy use, either from the utility bills or via ENERGY STAR Portfolio Manager, was compared with the modeled energy use. It was intended to examine how well the energy asset score represents a buildings system efficiencies, and how well it is correlated to a buildings actual energy consumption. Second, calibrated building energy models (where they exist) were used to examine any discrepancies between the asset score model and the pilot participant buildings [known] energy use pattern. This comparison examined the end use breakdowns and more detailed time series data. Third, ASHRAE 90.1 prototype buildings were also used as an industry standard modeling approach to test the accuracy level of the asset score tool. Our analysis showed that the asset score tool, which uses simplified building simulation, could provide results comparable to a more detailed energy model. The buildings as-built efficiency can be reflected in the energy asset score. An analysis between the modeled energy use through the asset score tool and the actual energy use from the utility bills can further inform building owners about the effectiveness of their buildings operation and maintenance.

  19. Commissioning in Federal Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    in Federal Buildings Commissioning in Federal Buildings Commissioning in Federal Buildings Commissioning is a quality-assurance process used to verify that a building performs according to the original design and intent, and meets the needs of the owners and occupants. The commissioning process also prepares building staff to operate and maintain the building. Federal agencies are required to make sure building systems and equipment are commissioned in new construction and existing buildings.

  20. Help Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos National Laboratory Advanced Simulation and Computing Menu Events Partnerships Help Center Events Partnerships Help Center Videos Advanced Simulation and Computing Program » Help Center Computing Help Center Help hotlines, hours of operation, training, technical assistance, general information Los Alamos National Laboratory Hours: Monday through Friday, 8:00 a.m. - noon, 1:00-5:00 p.m. Mountain time Telephone: (505) 665-4444 option 3 Fax: (505) 665-6333 E-mail: consult@lanl.gov 24

  1. Building America Technology Solutions for New and Existing Homes...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    measures in multifamily hydronic systems, providing a resource to contractors, auditors, and building owners on best practices to improve tenant comfort and lower operating costs. ...

  2. Rebuilding It Better: Greensburg, Kansas, High Performance Buildings...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    was also the location for the county ... based on available data provided by building owners that ... 250 300 350 5.4.7 Arts Center Best Western Plus ...

  3. Better Building Alliance, Plug and Process Loads in Commercial Buildings: Capacity and Power Requirement Analysis (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2014-09-01

    This brochure addresses gaps in actionable knowledge that can help reduce the plug load capacities designed into buildings. Prospective building occupants and real estate brokers lack accurate references for plug and process load (PPL) capacity requirements, so they often request 5-10 W/ft2 in their lease agreements. This brochure should be used to make these decisions so systems can operate more energy efficiently; upfront capital costs will also decrease. This information can also be used to drive changes in negotiations about PPL energy demands. It should enable brokers and tenants to agree about lower PPL capacities. Owner-occupied buildings will also benefit. Overestimating PPL capacity leads designers to oversize electrical infrastructure and cooling systems.

  4. The Lovejoy Building

    High Performance Buildings Database

    Portland, Oregon Originally built in 1910 as the stables for the Marshall-Wells Hardware Company, the Lovejoy Building is the home of Opsis Architects. The owner/architects purchased and renovated the historic building to house their growing business and to provide ground-floor office lease space and second-floor offices for their firm. Opsis wanted to use the building to experience and demonstrate the technologies and practices it promotes with clients.

  5. Improving the Energy Performance of New and Existing Commercial Buildings: A DOE Status Report

    SciTech Connect (OSTI)

    Holuj, Brian; Nicholls, Andrew K.; Sandahl, Linda J.; Torcellini, Paul

    2010-08-01

    It is technically and economically feasible for our nations commercial buildings to consume substantially less energy--and produce substantially less carbon dioxide--than they do. Yet owners of existing buildings are not taking full advantage of todays best energy saving technologies and practices; and developers of new buildings are, most often, constructing to minimum energy codes rather than pushing for greater efficiency. The U.S. Department of Energy (DOE) is addressing these challenges by developing cost-effective technologies and practices that deliver significant improvements in commercial building performance. DOE, through its Commercial Building Initiative, is also collaborating with industry-leading companies and organizations to demonstrate, monitor, and help move these technologies from the laboratory to the marketplace. Ultimately, DOEs dual strategy of pairing aggressive research and development with market engagement, demonstration, and deployment will dramatically improve the energy performance of new and existing commercial buildings throughout the nation.

  6. Owner Receives Keys to Net Zero Energy Habitat for Humanity House - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL Owner Receives Keys to Net Zero Energy Habitat for Humanity House Home to Produce as Much Energy as it Consumes Annually September 15, 2005 Golden, Colo. - Habitat for Humanity of Metro Denver today dedicated the ultimate energy efficient demonstration home: a house designed to produce as much energy as it consumes on an annual basis. The Net Zero Energy Habitat for Humanity House, at 4700 Carr Street in Wheat Ridge, Colo., combines energy efficient building design that

  7. Better Buildings Partners Gather to Plan for the Future | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to help home and business owners save energy and increase comfort while creating jobs. ... conceptualize and enhance their business models to ensure that their efforts thrive well ...

  8. ,"All Buildings","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings"

    U.S. Energy Information Administration (EIA) Indexed Site

    3. Occupancy of Nongovernment-Owned and Government Owned Buildings, Floorspace, 1999" ,"Total Floorspace (million square feet)" ,"All Buildings","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings" ,,"All Nongovern- ment- Owned Buildings","Owner Occupied","Nonowner Occupied","Unoccupied","All Govern-ment- Owned Buildings","Federal","State","Local" "All

  9. Multifamily Energy Savings Program (Existing Buildings and New Construction)

    Broader source: Energy.gov [DOE]

    To begin participating in the program, eligible building owners/managers work with a Focus Energy Advisor to perform a free energy assessment and identify suitable building improvements. For...

  10. Buildings Energy Data Book: 3.6 Office Building Markets and Companies

    Buildings Energy Data Book [EERE]

    5 Top 10 Office Building Owners Globally as of Year End, 2010 (million SF) Owner 1. RREEF Americas 2. Brookfield Properties Corp. 3. The Blackstone Group 4. CB Richard Ellis Investors 5. Hines 6. LaSalleInvestment Management 7. TIAA-CREF 8. Boston Properties 9. Vornado Realty Trust 10. Duke Realty Corp. Total for Top 10: Source(s): National Real Estate Investor, The 2011 Best of The Best Rankings: 2011 Top 25 Office Owners, June 1, 2011.

  11. Lake Encroachment Permit Application, Abutting Land Owner Addendum...

    Open Energy Info (EERE)

    Lake Encroachment Permit Application, Abutting Land Owner Addendum Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Permit ApplicationPermit...

  12. House Simulation Protocols (Building America Benchmark) - Building...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    House Simulation Protocols have helped ensure consistent and accurate energy-efficiency assessments for tens of thousands of new and retrofit homes supported by the Building ...

  13. Building America Partner Program: A Program of the Home Builders Association of Central New Mexico

    SciTech Connect (OSTI)

    Not Available

    2001-11-01

    This tri-fold brochure introduces the Building America Partner Program in central New Mexico and encourages home builders and home owners to participate.

  14. Energy Department Helps Cities, Counties Evaluate and Improve...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the key facts? Many U.S. jurisdictions have recently implemented building energy benchmarking programs and policies to better understand their buildings' energy use To help...

  15. A look at commercial buildings in 1995: Characteristics, energy consumption, and energy expenditures

    SciTech Connect (OSTI)

    1998-10-01

    The commercial sector consists of business establishments and other organizations that provide services. The sector includes service businesses, such as retail and wholesale stores, hotels and motels, restaurants, and hospitals, as well as a wide range of facilities that would not be considered commercial in a traditional economic sense, such as public schools, correctional institutions, and religious and fraternal organizations. Nearly all energy use in the commercial sector takes place in, or is associated with, the buildings that house these commercial activities. Analysis of the structures, activities, and equipment associated with different types of buildings is the clearest way to evaluate commercial sector energy use. The Commercial Buildings Energy Consumption Survey (CBECS) is a national-level sample survey of commercial buildings and their energy suppliers conducted quadrennially (previously triennially) by the Energy Information Administration (EIA). The target population for the 1995 CBECS consisted of all commercial buildings in the US with more than 1,000 square feet of floorspace. Decision makers, businesses, and other organizations that are concerned with the use of energy--building owners and managers, regulators, legislative bodies and executive agencies at all levels of government, utilities and other energy suppliers--are confronted with a buildings sector that is complex. Data on major characteristics (e.g., type of building, size, year constructed, location) collected from the buildings, along with the amount and types of energy the buildings consume, help answer fundamental questions about the use of energy in commercial buildings.

  16. Guide to Combined Heat and Power Systems for Boiler Owners and Operators

    SciTech Connect (OSTI)

    Oland, CB

    2004-08-19

    Combined heat and power (CHP) or cogeneration is the sequential production of two forms of useful energy from a single fuel source. In most CHP applications, chemical energy in fuel is converted to both mechanical and thermal energy. The mechanical energy is generally used to generate electricity, while the thermal energy or heat is used to produce steam, hot water, or hot air. Depending on the application, CHP is referred to by various names including Building Cooling, Heating, and Power (BCHP); Cooling, Heating, and Power for Buildings (CHPB); Combined Cooling, Heating, and Power (CCHP); Integrated Energy Systems (IES), or Distributed Energy Resources (DER). The principal technical advantage of a CHP system is its ability to extract more useful energy from fuel compared to traditional energy systems such as conventional power plants that only generate electricity and industrial boiler systems that only produce steam or hot water for process applications. By using fuel energy for both power and heat production, CHP systems can be very energy efficient and have the potential to produce electricity below the price charged by the local power provider. Another important incentive for applying cogeneration technology is to reduce or eliminate dependency on the electrical grid. For some industrial processes, the consequences of losing power for even a short period of time are unacceptable. The primary objective of the guide is to present information needed to evaluate the viability of cogeneration for new or existing industrial, commercial, and institutional (ICI) boiler installations and to make informed CHP equipment selection decisions. Information presented is meant to help boiler owners and operators understand the potential benefits derived from implementing a CHP project and recognize opportunities for successful application of cogeneration technology. Topics covered in the guide follow: (1) an overview of cogeneration technology with discussions about benefits of applying cogeneration technology and barriers to implementing cogeneration technology; (2) applicable federal regulations and permitting issues; (3) descriptions of prime movers commonly used in CHP applications, including discussions about design characteristics, heat-recovery options and equipment, fuels and emissions, efficiency, maintenance, availability, and capital cost; (4) electrical generators and electrical interconnection equipment; (5) cooling and dehumidification equipment; (6) thermodynamic cycle options and configurations; (7) steps for evaluating the technical and economic feasibility of applying cogeneration technology; and (8) information sources.

  17. Zero Energy Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Buildings » Zero Energy Buildings Zero Energy Buildings Zero Energy Buildings Zero energy buildings combine energy efficiency and renewable energy generation to consume only as much energy as can be produced onsite through renewable resources over a specified time period. Achieving zero energy is an ambitious yet increasingly achievable goal that is gaining momentum across geographic regions and markets. Private commercial property owners have a growing interest in developing zero

  18. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY

    Broader source: Energy.gov [DOE]

    Seattle, Washington, is a diverse, environmentally aware city with a variety of languages, cultures, and income levels. Leveraging relationships with public, private, and nonprofit partners, the...

  19. ,"All Buildings","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings"

    U.S. Energy Information Administration (EIA) Indexed Site

    2. Occupancy of Nongovernment-Owned and Government-Owned Buildings, Number of Buildings, 1999" ,"Number of Buildings (thousand)" ,"All Buildings","Nongovernment-Owned Buildings",,,,"Government-Owned Buildings" ,,"All Nongovern- ment- Owned Buildings","Owner Occupied","Nonowner Occupied","Unoccupied","All Govern-ment- Owned Buildings","Federal","State","Local" "All

  20. Owner/Operator Perspective on Reliability Customer Needs and...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SERVICES AS RELIABLE AS THE SUN OwnerOperator Perspective on Reliability Customer Needs and Field Data Sandia National Laboratories Utility-Scale Grid-Tied PV Inverter Reliability...

  1. Guide to Combined Heat and Power Systems for Boiler Owners and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guide to Combined Heat and Power Systems for Boiler Owners and Operators, July 2004 Guide to Combined Heat and Power Systems for Boiler Owners and Operators, July 2004 Many owners ...

  2. Business Owners: Prepare for Utility Disruptions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Utility Disruptions Business Owners: Prepare for Utility Disruptions Business Owners: Prepare for Utility Disruptions Have a plan in place in case a natural disaster or other hazard knocks out your business's electricity or natural gas service. Identify energy utilities-The utilities that are absolutely necessary to running your business. How might a disaster impact the availability of those utilities? Determine backup options-Contact your utility companies to discuss potential backup options,

  3. Smart Meters Helping Oklahoma Consumers Save Hundreds During Summer Heat |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Meters Helping Oklahoma Consumers Save Hundreds During Summer Heat Smart Meters Helping Oklahoma Consumers Save Hundreds During Summer Heat July 26, 2011 - 4:27pm Addthis Small business owner Steve Kaplan told ABC News’ “Show Me the Money” on Good Morning America that he's saving over $320 per month compared to last summer, which they calculated could result in $1,300 a year. Small business owner Steve Kaplan told ABC News' "Show Me the Money" on

  4. Secretaries Chu and Donovan to Host Conference Call on Home Owners...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Donovan to Host Conference Call on Home Owners Energy-Saving Improvements Program Secretaries Chu and Donovan to Host Conference Call on Home Owners Energy-Saving Improvements ...

  5. Commercial Building Tenant Energy Usage Aggregation and Privacy

    SciTech Connect (OSTI)

    Livingston, Olga V.; Pulsipher, Trenton C.; Anderson, David M.; Wang, Na

    2014-10-31

    A growing number of building owners are benchmarking their building energy use. This requires the building owner to acquire monthly whole-building energy usage information, which can be challenging for buildings in which individual tenants have their own utility meters and accounts with the utility. Some utilities and utility regulators have turned to aggregation of customer energy use data (CEUD) as a way to give building owners whole-building energy usage data while protecting customer privacy. Meter profile aggregation adds a layer of protection that decreases the risk of revealing CEUD as the number of meters aggregated increases. The report statistically characterizes the similarity between individual energy usage patterns and whole-building totals at various levels of meter aggregation.

  6. What is Building America?

    SciTech Connect (OSTI)

    2013-06-20

    DOE's Building America program is helping to bridge the gap between homes with high energy costs and homes that are healthy, durable, and energy efficient.

  7. What is Building America?

    ScienceCinema (OSTI)

    None

    2013-07-22

    DOE's Building America program is helping to bridge the gap between homes with high energy costs and homes that are healthy, durable, and energy efficient.

  8. Building Technologies Program Key Activities

    SciTech Connect (OSTI)

    2011-12-15

    The Building Technologies Program (BTP) employs a balanced approach to making buildings more energy efficient. The three pillars of our program, research and development (R&D), market stimulation, and building and equipment standards, help meet our strategic vision.

  9. Commercial Buildings Integration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Buildings Integration Commercial Buildings Integration Energy Efficiency in Separate Tenant Spaces - A Feasibility Study Energy Efficiency in Separate Tenant Spaces - A Feasibility Study While commercial building owners generally have control over building systems and operations, tenants play a critical role in achieving lasting reductions in energy intensity. In recognition of this collaborative role, the Department of Energy has studied the feasibility of improving energy efficiency

  10. Buildings Interoperability Landscape | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Interoperability Landscape Buildings Interoperability Landscape A vision is emerging of a connected world in which building equipment and systems coordinate with each other to efficiently meet their owners' and occupants' needs and buildings regularly transact business with other buildings and service providers (e.g., gas and electric service providers). While the technology to support this collaboration has been demonstrated at various degrees of maturity, the integration frameworks and

  11. About Buildings-to-Grid Integration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    To fully enable buildings to act as shock absorbers for the grid that also provide new services to their owners, a new, "transactive" approach to energy is required that will allow ...

  12. Scenario Analysis of Peak Demand Savings for Commercial Buildings with Thermal Mass in California

    SciTech Connect (OSTI)

    Yin, Rongxin; Kiliccote, Sila; Piette, Mary Ann; Parrish, Kristen

    2010-05-14

    This paper reports on the potential impact of demand response (DR) strategies in commercial buildings in California based on the Demand Response Quick Assessment Tool (DRQAT), which uses EnergyPlus simulation prototypes for office and retail buildings. The study describes the potential impact of building size, thermal mass, climate, and DR strategies on demand savings in commercial buildings. Sensitivity analyses are performed to evaluate how these factors influence the demand shift and shed during the peak period. The whole-building peak demand of a commercial building with high thermal mass in a hot climate zone can be reduced by 30percent using an optimized demand response strategy. Results are summarized for various simulation scenarios designed to help owners and managers understand the potential savings for demand response deployment. Simulated demand savings under various scenarios were compared to field-measured data in numerous climate zones, allowing calibration of the prototype models. The simulation results are compared to the peak demand data from the Commercial End-Use Survey for commercial buildings in California. On the economic side, a set of electricity rates are used to evaluate the impact of the DR strategies on economic savings for different thermal mass and climate conditions. Our comparison of recent simulation to field test results provides an understanding of the DR potential in commercial buildings.

  13. Small Buildings = Big Opportunity for Energy Savings (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-09-01

    This fact sheet describes the Small Buildings and Small Portfolios roadmap, which outlines approaches and strategic priorities for the U.S. Department of Energy's Building Technologies Office to pursue over the next three to five years that will support the implementation of high-potential energy efficiency opportunities for small business and building owners and operators.

  14. Commercial Building Energy Asset Rating Tool User's Guide

    SciTech Connect (OSTI)

    Wang, Na; Makhmalbaf, Atefe; Matsumoto, Steven W.

    2012-05-01

    The U.S. Department of Energy’s Commercial Building Energy Asset Rating Tool is a web-based system that is designed to allow building owners, managers, and operators to more accurately assess the energy performance of their commercial buildings. This document provide a step-by-step instruction on how to use the tool.

  15. Building Technologies Office | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Technologies Office Energy Efficiency in Separate Tenant Spaces - A Feasibility Study Energy Efficiency in Separate Tenant Spaces - A Feasibility Study While commercial building owners generally have control over building systems and operations, tenants play a critical role in achieving lasting reductions in energy intensity. In recognition of this collaborative role, the Department of Energy has studied the feasibility of improving energy efficiency in tenant spaces. Read more Apply

  16. Commercial Building Energy Asset Scoring Tool | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Building Energy Asset Scoring Tool Commercial Building Energy Asset Scoring ... and help you gain insight into the energy efficiency potential of your building. ...

  17. Solar PV Project Financing: Regulatory and Legislative Challenges for Third-Party PPA System Owners

    SciTech Connect (OSTI)

    Kollins, K.; Speer, B.; Cory, K.

    2009-11-01

    Residential and commercial end users of electricity who want to generate electricity using on-site solar photovoltaic (PV) systems face challenging initial and O&M costs. The third-party ownership power purchase agreement (PPA) finance model addresses these and other challenges. It allows developers to build and own PV systems on customers? properties and sell power back to customers. However, third-party electricity sales commonly face five regulatory challenges. The first three challenges involve legislative or regulatory definitions of electric utilities, power generation equipment, and providers of electric services. These definitions may compel third-party owners of solar PV systems to comply with regulations that may be cost prohibitive. Third-party owners face an additional challenge if they may not net meter, a practice that provides significant financial incentive to owning solar PV systems. Finally, municipalities and cooperatives worry about the regulatory implications of allowing an entity to sell electricity within their service territories. This paper summarizes these challenges, when they occur, and how they have been addressed in five states. This paper also presents alternative to the third-party ownership PPA finance model, including solar leases, contractual intermediaries, standardized contract language, federal investment tax credits, clean renewable energy bonds, and waived monopoly powers.

  18. Strengthening the Workforce in Better Buildings Neighborhoods...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Better Buildings Neighborhoods" video. MUSIC GRAPHIC: Saving energy, creating jobs, ... going to help protect the environment. MUSIC GRAPHIC: The Better Buildings ...

  19. Small Buildings = Big Opportunity for Energy Savings (Fact Sheet), Building Technologies Office (BTO), Energy Efficiency & Renewable Energy (EERE)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Buildings = Big Opportunity for Energy Savings There is nothing small about the impact that small commercial buildings have on energy use in the United States. In fact, the 4.6 million small buildings across the nation consume 44% of the overall energy use in buildings, presenting an enormous opportunity to cut costs, energy use, and greenhouse gas emissions. Despite this potential, small building owners and operators face unique challenges that have historically impeded the adoption of

  20. Cost Control Best Practices for Net Zero Energy Building Projects: Preprint

    SciTech Connect (OSTI)

    Leach, M.; Pless, S.; Torcellini, P.

    2014-02-01

    For net zero energy (NZE) buildings to become the norm in commercial construction, it will be necessary to design and construct these buildings cost effectively. While industry leaders have developed workflows (for procurement, design, and construction) to achieve cost-effective NZE buildings for certain cases, the expertise embodied in those workflows has limited penetration within the commercial building sector. Documenting cost control best practices of industry leaders in NZE and packaging those strategies for adoption by the commercial building sector will help make the business case for NZE. Furthermore, it will promote market uptake of the innovative technologies and design approaches needed to achieve NZE. This paper summarizes successful cost control strategies for NZE procurement, design, and construction that key industry users (such as building owners, architects, and designers) can incorporate into their everyday workflows. It will also evaluate the current state of NZE economics and propose a path forward for greater market penetration of NZE buildings. By demonstrating how to combine NZE technologies and design approaches into an overall efficiency package that can be implemented at minimal (zero, in certain cases) incremental capital cost, the domain of NZE design and construction can be expanded from a niche market to the commercial construction mainstream.

  1. River resort owners find LPG a power behind their success

    SciTech Connect (OSTI)

    Not Available

    1991-01-01

    This paper reports on a restaurant and resort which runs entirely on LPG. It has two generators converted to LPG that supply the power for the complex. Energy supplied from the propane is used in the kitchens, to drive the water pump and provide electricity for lighting and other power needs, and to heat the swimming pool. Far more importantly for the owners has been the fuel cost savings of at least 60%.

  2. Benchmarking Help Center Guide | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    guide provides recommendations for establishing a benchmarking help center based on experiences and lessons learned in New York City and Seattle. PDF icon Benchmarking Help Center Guide More Documents & Publications Energy Disclosure and Leasing Standards: Best Practices Benchmarking Outreach and Data Collection Techniques for External Portfolios Energy Performance Benchmarking and Disclosure Policies for Public and Commercial Buildings

  3. House Simulation Protocols (Building America Benchmark)- Building America Top Innovation

    Broader source: Energy.gov [DOE]

    This Building America Innovations profile describes the DOE-sponsored House Simulation Protocols, which have helped ensure consistent and accurate energy-efficiency assessments for tens of thousands of new and retrofit homes supported by the Building America program.

  4. Study Says Owners of Energy-Efficient Homes Would Recommend Them...

    Energy Savers [EERE]

    Study Says Owners of Energy-Efficient Homes Would Recommend Them to Friends Study Says Owners of Energy-Efficient Homes Would Recommend Them to Friends Photo of a house. A recent ...

  5. Focus group discussions among owners and non-owners of ground source heat pumps

    SciTech Connect (OSTI)

    Roberson, B.F.

    1988-07-01

    This research was sponsored by the Office of Buildings and Community Systems and conducted by the Pacific Northwest Laboratory as part of an ongoing effort to enhance the commercial use of federally developed technology. Federal dollars have supported research on the development of ground source heat pumps (GSHP) for several years. Though several companies currently sell GSHP's for residential use, their share of the total heating and air conditioning business remains less than one percent. Large manufacturing companies with national distribution have not yet added GSHP equipment to their product line. GSHP's use only about one half (Braud 1987) to one third (Bose 1987) of the energy needed to operate conventional furnaces and air conditioners. Consequently, a high level of market penetration by the GSHP offers direct benefits to both utility companies and individual users of the systems. Widespread use of these highly efficient systems will reduce both total energy consupmtion, and problems associated with high levels of energy use during peak periods. This will allow utility companies to delay capital expenditures for new facilities to meet the growing energy demand during peak periods. The cost effective use of electricity also reduces the likelihood of homeowners switching to a different fuel source for heating. 5 refs.

  6. Buildings | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Index for Commercial Buildings Welcome to the Energy Index for Commercial Buildings. Data for this tool comes from the Energy Information Administration's (EIA) 2003 Commercial Buildings Energy Consumption Survey (CBECS). Select categories from the CBECS micro data allow users to search on common building characteristics that impact energy use. Users may select multiple criteria, however if the resulting sample size is too small, the data will be unreliable. If nothing is selected results

  7. Measure Guideline: Air Sealing Attics in Multifamily Buildings

    SciTech Connect (OSTI)

    Otis, C.; Maxwell, S.

    2012-06-01

    This Building America Measure Guideline is intended for owners, builders, contractors, homeowners, and other stakeholders in the multifamily building industry, and focuses on challenges found in existing buildings for a variety of housing types. It explains why air sealing is desirable, explores related health and safety issues, and identifies common air leakage points in multifamily building attics. In addition, it also gives an overview of materials and techniques typically used to perform air sealing work.

  8. SAF130C Pressure/Vacuum System Owners and Design Authorities | Jefferson

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lab SAF130C Pressure/Vacuum System Owners and Design Authorities Required SAF 130C Training to be Held on March 17 for Pressure/Vacuum System Owners and Design Authorities SAF 130C, Pressure and Vacuum Systems Owner Training is a required course for all System Owners and Design Authorities. The training covers general safe operation and maintenance techniques as well as the specific requirements of System Owners defined in the new Pressure and Vacuum System Safety Supplement. Others who

  9. Colorado Better Buildings Project Final Report

    SciTech Connect (OSTI)

    Strife, Susie; Yancey, Lea

    2013-12-30

    The Colorado Better Buildings project intended to bring new and existing energy efficiency model programs to market with regional collaboration and funding partnerships. The goals for Boulder County and its program partners were to advance energy efficiency investments, stimulate economic growth in Colorado and advance the state’s energy independence. Collectively, three counties set out to complete 9,025 energy efficiency upgrades in 2.5 years and they succeeded in doing so. Energy efficiency upgrades have been completed in more than 11,000 homes and businesses in these communities. Boulder County and its partners received a $25 million BetterBuildings grant from the U.S. Department of Energy under the American Recovery and Reinvestment Act in the summer of 2010. This was also known as the Energy Efficiency and Conservation Block Grants program. With this funding, Boulder County, the City and County of Denver, and Garfield County set out to design programs for the residential and commercial sectors to overcome key barriers in the energy upgrade process. Since January 2011, these communities have paired homeowners and business owners with an Energy Advisor – an expert to help move from assessment to upgrade with minimal hassle. Pairing this step-by-step assistance with financing incentives has effectively addressed many key barriers, resulting in energy efficiency improvements and happy customers. An expert energy advisor guides the building owner through every step of the process, coordinating the energy assessment, interpreting results for a customized action plan, providing a list of contractors, and finding and applying for all available rebates and low-interest loans. In addition to the expert advising and financial incentives, the programs also included elements of social marketing, technical assistance, workforce development and contractor trainings, project monitoring and verification, and a cloud-based customer data system to coordinate among field advisors and across local governments and local service vendors. A portion of the BetterBuildings grant went to the Metro Mayors Caucus (MMC) who worked in partnership with the Denver Regional Council of Governments (DRCOG) to conduct a series of 10 energy efficiency workshops for local government officials and other interested parties. The workshops helped showcase lessons learned on energy efficiency and helped guide other local governments in the establishment of similar programs. The workshops covered a wide range of energy efficiency and renewable energy topics such as clean energy finance, social mobilization and communications, specific case studies of Colorado towns, energy efficiency codes, net zero buildings and solar power. Since the programs launched in January 2011, these communities have collectively spurred economic investments in energy efficiency, achieved greater than 5:1 leveraging of grant funds, saved energy and reduced greenhouse gas emissions, provided trainings for a robust local energy contractor network, and proved out viable and replicable program models that local utilities and other communities are adopting, with long lasting market transformation.

  10. Commercial Building Activities | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Building Activities Commercial Building Activities The Building Technologies Office commercial buildings effort researches and deploys advanced technologies and systems to reduce energy consumption in commercial buildings. Industry partners and national laboratories help identify market needs and solutions to accelerate the development of highly energy-efficient buildings. This page outlines some of BTO's key projects. 179d Tax Calculator The 179d Calculator can help determine whether

  11. Anonymous Help Line

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anonymous Help Line Ombuds Anonymous Help Line Committed to the fair and equitable treatment of all employees, contractors, and persons doing business with the Laboratory. Contact Ombuds Office (505)665-2837 Email Help Line (505) 667-9370 Fax (505) 667-3119 Map & Hours Anonymous Help Line: (505) 667-9370 As an option to visiting the Ombuds office, we provide service through a telephone Help Line and email. The telephone Help Line is useful for individuals who have concerns and want advice or

  12. Take Action to Save Energy in Commercial Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial Buildings » Take Action to Save Energy in Commercial Buildings Take Action to Save Energy in Commercial Buildings Commercial building owners, operators and tenants can start saving energy today and use those cost savings for other critical parts of their businesses. The Building Technologies Office offers Commercial Buildings Resource Database and opportunities to partner with peers and technical experts. Manage Organizational Energy Use Photo of participants listening to a speaker

  13. Commercial Building Energy Asset Score- 2014 BTO Peer Review

    Broader source: Energy.gov [DOE]

    Presenter: Nora Wang, Pacific Northwest National Laboratory One of the primary market barriers to enhancing energy efficiency in the commercial building sector is that building owners and investors lack a reliable and low cost source to understand a building’s as-built efficiency and identify opportunities for cost-effective improvements.

  14. Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Buildings Buildings EERE leads a robust network of researchers and other partners to continually develop cost-effective energy-saving solutions that help make our country run better through increased efficiency — promoting better plants, manufacturing processes, and products; more efficient new homes and improved older homes; and other solutions to enhance the buildings in which we work, shop, and lead our everyday lives. EERE leads a robust network of researchers and other partners to

  15. ORISE: Capacity Building

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Capacity Building Because public health agencies must maintain the resources to respond to public health challenges, critical situations and emergencies, the Oak Ridge Institute for Science and Education (ORISE) helps government agencies and organizations develop a solid infrastructure through capacity building. Capacity building refers to activities that improve an organization's ability to achieve its mission or a person's ability do his or her job more effectively. For organizations, capacity

  16. Helpful Links - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Helpful Links Helpful Links Helpful Links Hanford Staff Directory Hanford Site Wide Programs Energy Employees Occupational Illness Compensation Hanford Workers Compensation Projects & Facilities HERO PHOENIX Hanford Meteorological Station Definitions Abbreviations and Acronyms Visitor Control and Site Access Visitor Hanford Computer Access Request Helpful Links Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Contact Us Do you have a question? Contact Hanford

  17. Better Buildings Alliance, Advanced Rooftop Unit Campaign: Rooftop Unit Measurement and Verification (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2014-09-01

    This document provides facility managers and building owners an introduction to measurement and verification (M&V) methods to estimate energy and cost savings of rooftop units replacement or retrofit projects to estimate paybacks or to justify future projects.

  18. Building America Puts Residential Research Results To Work; Building America Research That Works (Fact Sheet)

    SciTech Connect (OSTI)

    2009-01-18

    Residential buildings use more than 20% of the energy consumed annually in the United States. To help reduce that energy use, the Department of Energy (DOE) and its Building America partners conduct research to develop advanced building energy systems tha

  19. Synthesis Report on the Implementation of Building Energy Codes in China

    SciTech Connect (OSTI)

    Shui, Bin; Haiyan, Lin; Congu, Yu; Halverson, Mark A.; Bo, Song; Jingru, Liu; Evans, Meredydd; Xiajiao, Zhu; Siwei, Lang

    2011-03-31

    China building energy code and details to help improve building energy efficiency at global, national and local levels

  20. Wet buildings: A moisture primer

    SciTech Connect (OSTI)

    Lotz, W.A.

    1998-01-01

    This article will attempt to clarify the various issues that must be solved when investigating the cause of a building moisture problem. Several classic errors that result in mechanical engineers and contractors defending themselves in lawsuits will be reviewed. Moisture from internal and external sources is the most frequent cause of building problems and subsequent legal action. Many reported roof leaks are, in reality, condensation problems that have nothing to do with the roofing contractor. Mechanical design engineers need to work closely with the building owner, architect, and contractors to insure a dry, durable building. The first issue to examine is if the moisture is coming from the outside--i.e. rain. Other leaks discussed are ice dams, groundwater leaks, and roof leaks. Also discussed are vapor barriers, continuity of insulation, humidification chilled water, warehouses, trash plants, indoor pools, and hot or humid climates.

  1. OWNER(S)

    Office of Legacy Management (LM)

    - 1 ' 6,' CMED INVOLW?+NT AT SITE .:c---... I----... Control c Health Physics Protection 0 AECIMED managed operations c Little or None 0 AECMED responsible for c ...

  2. OWNER(S) Past:

    Office of Legacy Management (LM)

    ----L---... ----- Lyee (on basis of records reviewed) No Radioactive c Health Physics Protection G Little or None. c AECMED responsibility C Contractoi'responaibility 6 ...

  3. OWNER(S)

    Office of Legacy Management (LM)

    %-cl-CD IN&LUEk4T AT SITE -'---,---...---... .' 'Contkol 1 Health Physics Protection 0 AECMED managed operations c Little ar None ci AECfMED responsible for C ...

  4. SUBJECT: OWNER(S)

    Office of Legacy Management (LM)

    Centrbl 0 AEWHED managed oprrrtionm P l alth ' Phymicm Protection - 0 AEC?lED rerponribla for 0 Littlm or Norm accountability WHED rmmponsibility 0 ntrrctor & ECHED ...

  5. Study Says Owners of Energy-Efficient Homes Would Recommend Them to Friends

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Study Says Owners of Energy-Efficient Homes Would Recommend Them to Friends Study Says Owners of Energy-Efficient Homes Would Recommend Them to Friends Photo of a house. A recent National Association of Home Builders (NAHB) study aimed at uncovering how owners of energy-efficient homes felt after purchasing their homes found that not only would the majority recommend the same green homes to friends, but more than 50% believed the benefits of energy efficiency

  6. Guide to Combined Heat and Power Systems for Boiler Owners and Operators,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 2004 | Department of Energy Guide to Combined Heat and Power Systems for Boiler Owners and Operators, July 2004 Guide to Combined Heat and Power Systems for Boiler Owners and Operators, July 2004 Many owners and operators of industrial, commercial, and institutional (ICI) boiler systems need to use energy more efficiently. This 2004 guide is organized into topics that address many of the fundamental issues encountered in planning a CHP project and focuses on technical subjects

  7. Newport News Business Owner Earns Award From Jefferson Lab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Newport News Business Owner Earns Award From Jefferson Lab Newport News Business Owner Earns Award From Jefferson Lab March 2, 2000 Jefferson Lab and the Department of Energy recently recognized the winner of the laboratory's Small Disadvantaged Business Contractor Award for FY1999. Jefferson Lab's Deputy Director, Christoph Leemann, presented the award to Beverly Hilton, owner of Hilton's Environmental, Inc. of Newport News during a ceremony attended by lab and DOE officials. Hilton and her

  8. Industrial Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Industrial Industrial Manufacturing Buildings Industrialmanufacturing buildings are not considered commercial, but are covered by the Manufacturing Energy Consumption Survey...

  9. Improving Building Performance at Urban Scale with a Framework for Real-time Data Sharing

    SciTech Connect (OSTI)

    Pang, Xiufeng; Hong, Tianzhen; Piette, Mary Ann

    2013-06-03

    This paper describes work in progress toward an urban-scale system aiming to reduce energy use in neighboring buildings by providing three components: a database for accessing past and present weather data from high quality weather stations; a network for communicating energy-saving strategies between building owners; and a set of modeling tools for real-time building energy simulation.

  10. Business Owners: Respond to an Energy Emergency | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and other mobile devices to communicate with your utility companies, and to help you stay up to date on restoration efforts, weather forecasts, and other important information. ...

  11. California commercial building energy benchmarking

    SciTech Connect (OSTI)

    Kinney, Satkartar; Piette, Mary Ann

    2003-07-01

    Building energy benchmarking is the comparison of whole-building energy use relative to a set of similar buildings. It provides a useful starting point for individual energy audits and for targeting buildings for energy-saving measures in multiple-site audits. Benchmarking is of interest and practical use to a number of groups. Energy service companies and performance contractors communicate energy savings potential with ''typical'' and ''best-practice'' benchmarks while control companies and utilities can provide direct tracking of energy use and combine data from multiple buildings. Benchmarking is also useful in the design stage of a new building or retrofit to determine if a design is relatively efficient. Energy managers and building owners have an ongoing interest in comparing energy performance to others. Large corporations, schools, and government agencies with numerous facilities also use benchmarking methods to compare their buildings to each other. The primary goal of Task 2.1.1 Web-based Benchmarking was the development of a web-based benchmarking tool, dubbed Cal-Arch, for benchmarking energy use in California commercial buildings. While there were several other benchmarking tools available to California consumers prior to the development of Cal-Arch, there were none that were based solely on California data. Most available benchmarking information, including the Energy Star performance rating, were developed using DOE's Commercial Building Energy Consumption Survey (CBECS), which does not provide state-level data. Each database and tool has advantages as well as limitations, such as the number of buildings and the coverage by type, climate regions and end uses. There is considerable commercial interest in benchmarking because it provides an inexpensive method of screening buildings for tune-ups and retrofits. However, private companies who collect and manage consumption data are concerned that the identities of building owners might be revealed and hence are reluctant to share their data. The California Commercial End Use Survey (CEUS), the primary source of data for Cal-Arch, is a unique source of information on commercial buildings in California. It has not been made public; however, it was made available by CEC to LBNL for the purpose of developing a public benchmarking tool.

  12. Enhanced Cloud-based Control System for Small Commercial Buildings |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Enhanced Cloud-based Control System for Small Commercial Buildings Enhanced Cloud-based Control System for Small Commercial Buildings Lead Performer: Pacific Northwest National Laboratory - Richland, WA Partner: NorthWrite Inc. - Portland, OR DOE Total Funding: $300,000 Project Term: June 1, 2016 - November 30, 2017 Funding Type: Small Business Vouchers Pilot PROJECT OBJECTIVE NorthWrite Inc. delivers services to owners of small commercial buildings, using a cloud-based

  13. Tax Deductions for Commercial Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tax Deductions for Commercial Buildings Tax Deductions for Commercial Buildings This document has information regarding tax deductions for commercial building owners. PDF icon bt_comm_tax_credit.pdf More Documents & Publications P Financial Incentives Available for Facilities Affected by the US EPA Boiler MACT Proposed Rule, December 2012 Rebuilding Greensburg, Kansas, as a Model Green Community: A Case Study; NREL's Technical Assistance to Greensburg, June 2007-May 2009; Appendices

  14. Building Re-tuning Training | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Re-tuning Training Building Re-tuning Training Lead Performer: Pacific Northwest National Laboratory (PNNL) - Richland, WA Partners: -- Building Owners and Managers Association (BOMA) -- APPA: Leadership in Educational Facilities -- Pennsylvania State University - Philadelphia, PA FY16 DOE Funding: $25,000 Project Term: October 1, 2011 - September 30, 2016 Funding Type: Direct Lab Funding Project Website: https://www4.eere.energy.gov/workforce/projects/buildings-retuning-training PROJECT

  15. Balancing Hydronic Systems in Multifamily Buildings

    SciTech Connect (OSTI)

    Ruch, Russell; Ludwig, Peter; Maurer, Tessa

    2014-07-01

    In multifamily hydronic systems, temperature imbalance may be caused by undersized piping, improperly adjusted balancing valves, inefficient water temperature and flow levels, and owner/occupant interaction with the boilers, distribution, and controls. The imbalance leads to tenant discomfort, higher energy use intensity, and inefficient building operation. This research, conducted by Building America team Partnership for Advanced Residential Retrofit, explores cost-effective distribution upgrades and balancing measures in multifamily hydronic systems, providing a resource to contractors, auditors, and building owners on best practices to improve tenant comfort and lower operating costs. The team surveyed existing knowledge on cost-effective retrofits for optimizing distribution in typical multifamily hydronic systems, with the aim of identifying common situations and solutions, and then conducted case studies on two Chicago area buildings with known balancing issues in order to quantify the extent of temperature imbalance. At one of these buildings a booster pump was installed on a loop to an underheated wing of the building. This study found that unit temperature in a multifamily hydronic building can vary as much as 61°F, particularly if windows are opened or tenants use intermittent supplemental heating sources like oven ranges. Average temperature spread at the building as a result of this retrofit decreased from 22.1°F to 15.5°F.

  16. A Utility Regulator's Guide to Data Access for Commercial Building...

    Broader source: Energy.gov (indexed) [DOE]

    use data to help commercial customers manage energy costs through building energy benchmarking. A Utility Regulator's Guide to Data Access for Commercial Building Energy...

  17. Building America: Making Real Progress for U.S. Homes

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Today, many Building America innovations that improve the lives of families are hidden in ... Building America has helped our business research and develop strong new high performance ...

  18. Commercial Buildings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science & Innovation » Energy Efficiency » Commercial Buildings Commercial Buildings At an estimated cost of $38 billion a year, lighting represents the largest source of electricity consumption in U.S. commercial buildings. A new breakthrough by the Energy Department's <a href="/node/712411">National Renewable Energy Lab</a> could help commercial buildings save on lighting and ventilation costs by improving the accuracy of motion detection. At an estimated cost of

  19. Online help desk

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    with your NERSC-related computing questions and problems. Log in using your NERSC (NIM) login ID and password. Here are some general tips that may help the NERSC consultants...

  20. Knowledge-based sizing of cogeneration plant in buildings

    SciTech Connect (OSTI)

    Williams, J.M.; Griffiths, A.J.; Knight, I.P.

    1998-10-01

    Cogeneration is now accepted as a cost-effective and environmentally friendly means of meeting some of a building`s heating and power needs. Cogeneration plants have been installed in many buildings throughout the United Kingdom. Because of commercial pressures, building owners and cogeneration companies are keen to reduce the time and money involved in sizing units, and a decision support tool has been developed to aid the engineer in selecting the unit size. An initial assessment of the sizing can be made with only knowledge of the building`s type, size, and location, which enables the model to be used in new build situations. For an existing building, the accuracy of the predictions can then be progressively improved by providing more information about the building`s energy use, enabling the optimum unit to be identified. This paper briefly describes the model and demonstrates its use through an example feasibility study.

  1. Building America Research | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Research Building America Research The DOE Building America Program is helping to create homes that are durable and energy efficient. Research-to-Market BA_Research_Image.png Learn how Building America works to accelerate the development and adoption of advanced building energy technologies and practices. Top Innovations 1-1-2 Adv Framing open header.jpg Read about outstanding Building America research achievements. Research Teams hirl3.jpg Learn about the Building America teams who continuously

  2. Balancing Hydronic Systems in Multifamily Buildings

    SciTech Connect (OSTI)

    Ruch, R.; Ludwig, P.; Maurer, T.

    2014-07-01

    In multifamily hydronic systems, temperature imbalance may be caused by undersized piping, improperly adjusted balancing valves, inefficient water temperature and flow levels, and owner/occupant interaction with the boilers, distribution and controls. The effects of imbalance include tenant discomfort, higher energy use intensity and inefficient building operation. This paper explores cost-effective distribution upgrades and balancing measures in multifamily hydronic systems, providing a resource to contractors, auditors, and building owners on best practices to improve tenant comfort and lower operating costs. The research was conducted by The Partnership for Advanced Residential Retrofit (PARR) in conjunction with Elevate Energy. The team surveyed existing knowledge on cost-effective retrofits for optimizing distribution in typical multifamily hydronic systems, with the aim of identifying common situations and solutions, and then conducted case studies on two Chicago area buildings with known balancing issues in order to quantify the extent of temperature imbalance. At one of these buildings a booster pump was installed on a loop to an underheated wing of the building. This study found that unit temperature in a multifamily hydronic building can vary as much as 61 degrees F, particularly if windows are opened or tenants use intermittent supplemental heating sources like oven ranges. Average temperature spread at the building as a result of this retrofit decreased from 22.1 degrees F to 15.5 degrees F.

  3. Transaction-Based Building Controls Framework, Volume 1: Reference Guide

    SciTech Connect (OSTI)

    Somasundaram, Sriram; Pratt, Robert G.; Akyol, Bora A.; Fernandez, Nicholas; Foster, Nikolas AF; Katipamula, Srinivas; Mayhorn, Ebony T.; Somani, Abhishek; Steckley, Andrew C.; Taylor, Zachary T.

    2014-04-28

    This document proposes a framework concept to achieve the objectives of raising buildings efficiency and energy savings potential benefitting building owners and operators. We call it a transaction-based framework, wherein mutually-beneficial and cost-effective market-based transactions can be enabled between multiple players across different domains. Transaction-based building controls are one part of the transactional energy framework. While these controls realize benefits by enabling automatic, market-based intra-building efficiency optimizations, the transactional energy framework provides similar benefits using the same market -based structure, yet on a larger scale and beyond just buildings, to the society at large.

  4. Overheating in Hot Water- and Steam-Heated Multifamily Buildings

    SciTech Connect (OSTI)

    Dentz, J.; Varshney, K.; Henderson, H.

    2013-10-01

    In this project, the ARIES Building America team collected apartment temperature data from the archives of companies that provide energy management systems (EMS) to multifamily buildings in the Northeast U.S. Data was analyzed from more than 100 apartments in eighteen buildings where EMS systems were already installed to quantify the degree of overheating in an effort to answer the question, "What is the magnitude of apartment overheating in multifamily buildings with central hot water or steam heat?" This report provides valuable information to researchers, utility program managers and building owners interested in controlling heating energy waste and improving resident comfort.

  5. Photovoltaics for Buildings: New Applications and Lessons Learned: Preprint

    SciTech Connect (OSTI)

    Hayter, S.; Torcellini, P.; Deru, M.

    2002-07-01

    Photovoltaics (PV) for buildings system applications are experiencing exponential growth. This increased activity is the result of building owners becoming more confident with this new technology, designers becoming more comfortable incorporating PV into architectural and building electrical designs, decreasing PV system cost, the heightened public awareness of depleting conventional energy resources, and issues related to power reliability and stability. Usually, these systems meet primary objectives to offset building electrical loads, decrease building electrical demand, or provide continuous power supply during utility grid outages; but because of design flaws, installation errors, or improper maintenance, these systems can perform below the design expectations.

  6. Better Buildings

    Broader source: Energy.gov [DOE]

    The Better Buildings Initiative aims to make commercial and industrial buildings 20% more energy efficient by 2020 and accelerate private sector investment in energy efficiency.

  7. Mercantile Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Mercantile Characteristics by Activity... Mercantile Mercantile buildings are those used for the sale and display of goods other than food (buildings used for the sales of food are...

  8. Education Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Education Characteristics by Activity... Education Education buildings are buildings used for academic or technical classroom instruction, such as elementary, middle, or high...

  9. Energy-Performance-Based Design-Build Process: Strategies for Procuring High-Performance Buildings on Typical Construction Budgets: Preprint

    SciTech Connect (OSTI)

    Scheib, J.; Pless, S.; Torcellini, P.

    2014-08-01

    NREL experienced a significant increase in employees and facilities on our 327-acre main campus in Golden, Colorado over the past five years. To support this growth, researchers developed and demonstrated a new building acquisition method that successfully integrates energy efficiency requirements into the design-build requests for proposals and contracts. We piloted this energy performance based design-build process with our first new construction project in 2008. We have since replicated and evolved the process for large office buildings, a smart grid research laboratory, a supercomputer, a parking structure, and a cafeteria. Each project incorporated aggressive efficiency strategies using contractual energy use requirements in the design-build contracts, all on typical construction budgets. We have found that when energy efficiency is a core project requirement as defined at the beginning of a project, innovative design-build teams can integrate the most cost effective and high performance efficiency strategies on typical construction budgets. When the design-build contract includes measurable energy requirements and is set up to incentivize design-build teams to focus on achieving high performance in actual operations, owners can now expect their facilities to perform. As NREL completed the new construction in 2013, we have documented our best practices in training materials and a how-to guide so that other owners and owner's representatives can replicate our successes and learn from our experiences in attaining market viable, world-class energy performance in the built environment.

  10. Helpful Links - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Help Solve Solar's Big Challenge Help Solve Solar's Big Challenge December 2, 2013 - 1:00pm Addthis Soft costs now account for more than 60% of the total price of installing residential solar energy systems. <a href="http://www.energy.gov/eere/articles/infographic-lets-get-work-solar-soft-costs">View the full infographic to learn more</a>. Soft costs now account for more than 60% of the total price of installing residential solar energy systems. View the full infographic to

  11. New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cyber Security Standards | Department of Energy New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber Security Standards New No-Cost ANTFARM Tool Maps Control System Networks to Help Implement Cyber Security Standards Funded under the Department of Energy's National SCADA Test Bed Program, Sandia National Laboratories recently released a new software tool that will aid energy utility owners in mapping and visualizing their control system networks-a critical first step

  12. Better Buildings Alliance- Annual Open House Webinar

    Broader source: Energy.gov [DOE]

    The Better Buildings Alliance is hosting a webinar on new energy efficiency resources and upcoming opportunities available this year through DOE's Better Building Alliance. Learn about new solutions that can help reduce energy costs for your organization.

  13. Controlling Capital Costs in High Performance Office Buildings: A Review of Best Practices for Overcoming Cost Barriers

    SciTech Connect (OSTI)

    Pless, S.; Torcellini, P.

    2012-05-01

    This paper presents a set of 15 best practices for owners, designers, and construction teams of office buildings to reach high performance goals for energy efficiency, while maintaining a competitive budget. They are based on the recent experiences of the owner and design/build team for the Research Support Facility (RSF) on National Renewable Energy Facility's campus in Golden, CO, which show that achieving this outcome requires each key integrated team member to understand their opportunities to control capital costs.

  14. Leading by Example: Better Buildings Challenge Partners Cut Energy Use

    Broader source: Energy.gov [DOE]

    Learn how energy efficiency improvements are helping Better Buildings Challenge partners save money and improve their energy intensity.

  15. DOE NSTB Researchers Demonstrate R&D Successes to Asset Owners at EnergySec

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference | Department of Energy NSTB Researchers Demonstrate R&D Successes to Asset Owners at EnergySec Conference DOE NSTB Researchers Demonstrate R&D Successes to Asset Owners at EnergySec Conference More than 150 energy sector leaders-including nearly 100 asset owners and operators-gathered at the 2009 EnergySec Annual Summit in Seattle, WA, on Sept. 23-24, where researchers from the Department of Energy's National SCADA Test Bed (NSTB) Program gave a four-hour demonstration and

  16. Energy use in office buildings

    SciTech Connect (OSTI)

    1980-10-01

    This is the report on Task IB, Familiarization with Additional Data Collection Plans of Annual Survey of BOMA Member and Non-Member Buildings in 20 Cities, of the Energy Use in Office Buildings project. The purpose of the work was to monitor and understand the efforts of the Building Owners and Managers Association International (BOMA) in gathering an energy-use-oriented data base. In order to obtain an improved data base encompassing a broad spectrum of office space and with information suitable for energy analysis in greater detail than is currently available, BOMA undertook a major data-collection effort. Based on a consideration of geographic area, climate, population, and availability of data, BOMA selected twenty cities for data collection. BOMA listed all of the major office space - buildings in excess of 40,000 square feet - in each of the cities. Tax-assessment records, local maps, Chamber of Commerce data, recent industrial-development programs, results of related studies, and local-realtor input were used in an effort to assemble a comprehensive office-building inventory. In order to verify the accuracy and completeness of the building lists, BOMA assembled an Ad-Hoc Review Committee in each city to review the assembled inventory of space. A questionnaire on office-building energy use and building characteristics was developed. In each city BOMA assembled a data collection team operating under the supervision of its regional affiliate to gather the data. For each city a random sample of buildings was selected, and data were gathered. Responses for over 1000 buildings were obtained.

  17. Guiding Principles for Sustainable Federal Buildings

    Broader source: Energy.gov [DOE]

    The Federal Energy Management Program provides guidance to help agencies comply with the Guiding Principles for Federal Leadership in High-Performance and Sustainable Buildings.

  18. Better Buildings Neighborhood Program Business Models Guide

    Broader source: Energy.gov [DOE]

    Uses lessons learned from Better Buildings grantees, existing data, and private sector insights to highlight business models that can help develop a sustainable residential energy efficiency market.

  19. Building America Update - March 11, 2013

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... current photovoltaic and solar thermal building practices ... reports, measure and strategy guidelines, case studies, and other resources to help you boost energy efficiency in new ...

  20. BetterBuildings Network View | December 2014

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Photo: Jonathan House Clean Energy Works Taps Smart Market to Help Homeowners Beat the "Brrr" and Save Better Buildings Residential Network member Clean Energy Works (CEW) is ...

  1. Energy Department Announces Building Energy Efficiency Investments...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to create jobs, boost domestic manufacturing in energy-saving technologies and help American families and businesses save money. "Deploying energy efficiency in our buildings, ...

  2. National Laboratories Supporting Building America | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... reports, measure guidelines, case studies, and other resources to help you boost ... Research Tools & Resources News & Events Publications Building Science Education Home Energy ...

  3. Strategies for Controlling Plug Loads. A Tool for Reducing Plug Loads in Commercial Buildings

    SciTech Connect (OSTI)

    Torcellini, Paul; Bonnema, Eric; Sheppy, Michael; Pless, Shanti

    2015-09-01

    Plug loads are often not considered as part of the energy savings measures in Commercial Buildings; however, they can account for up to 50% of the energy used in the building. These loads are numerous and often scattered throughout a building. Some of these loads are purchased by the owner and some designed into the building or the tenant finishes for a space. This document provides a strategy and a tool for minimizing these loads.

  4. Transcript for Building America Video

    Broader source: Energy.gov [DOE]

    Transcript of a video about how DOE’s Building America program is helping to bridge the gap between homes with high energy costs and homes that are healthy, durable, and energy efficient.

  5. CAMD MSDS Help

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    What is the MSDS Management System? MSDS stands for Material Safety Data Sheet. This is a computerized data base to help you retrieve the information from the MSDS's more rapidly and conveniently. MSDS are mandated as per OSHA 29 CFR 1910.1200 section (g) Hazard Communication or "HAZCOM". MSDS are useful in obtaining all sorts of information about a chemical. Search alphabetically for a specific chemical MSDS from here. Global Harmonization Classifications

  6. READ THIS: Before You Design, Build or Renovate

    SciTech Connect (OSTI)

    Joseph Lstiburek

    2006-12-07

    This pamphlet is designed for members of the residential construction and remodeling industries, as well as owners and managers who work in affordable housing, and presents building guidance for both new construction and rehabilitation, as well as practices that can be used by property maintenance personnel.

  7. Buildings*","Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    8. Primary Space-Heating Energy Sources, Number of Buildings for Non-Mall Buildings, 2003" ,"Number of Buildings (thousand)" ,"All Buildings*","Buildings with Space Heating","Primary Space-Heating Energy Source Used a" ,,,"Electricity","Natural Gas","Fuel Oil","District Heat" "All Buildings* ...............",4645,3982,1258,1999,282,63 "Building Floorspace" "(Square Feet)"

  8. Buildings*","Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    1. Water-Heating Energy Sources, Number of Buildings for Non-Mall Buildings, 2003" ,"Number of Buildings (thousand)" ,"All Buildings*","Buildings with Water Heating","Water-Heating Energy Sources Used (more than one may apply)" ,,,"Elec- tricity","Natural Gas","Fuel Oil","District Heat","Propane" "All Buildings* ...............",4645,3472,1910,1445,94,27,128 "Building Floorspace"

  9. PP-82-3 The Joint Owners of the Highgate Interconnection Facilities...

    Broader source: Energy.gov (indexed) [DOE]

    The Joint Owners of the Highgate Interconnection Facilities to construct, operate, and maintain electric transmission facilities at the U.S. - Canada Border. PDF icon PP-82-3 The ...

  10. br Owner br Facility br Type br Capacity br MW br Commercial...

    Open Energy Info (EERE)

    Owner br Facility br Type br Capacity br MW br Commercial br Online br Date br Geothermal br Area br Geothermal br Region Coordinates Ahuachapan Geothermal Power Plant LaGeo SA de...

  11. DOE NSTB Researchers Demonstrate R&D Successes to Asset Owners at EnergySec Conference

    Broader source: Energy.gov [DOE]

    More than 150 energy sector leaders—including nearly 100 asset owners and operators—gathered at the 2009 EnergySec Annual Summit in Seattle, WA, on Sept. 23-24, where researchers from the...

  12. Guide to Combined Heat and Power Systems for Boiler Owners and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    It is part of a suite of publications offered by the Department of Energy to improve steam system performance. PDF icon Guide to Combined Heat and Power Systems for Boiler Owners ...

  13. Building America Technology Solutions for New and Existing Homes: Balancing Hydronic Systems in Multifamily Buildings, Chicago, Illinois (Fact Sheet)

    Broader source: Energy.gov [DOE]

    In this case study , Partnership for Advanced Residential Retrofit and Elevate Energy. explores cost-effective distribution upgrades and balancing measures in multifamily hydronic systems, providing a resource to contractors, auditors, and building owners on best practices to improve tenant comfort and lower operating costs.

  14. NREL Incubator Alliance Helps Entrepreneurs Build Clean Energy...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Golden, Colo., Feb. 23, 2001 - The U.S. Department of Energy's National Renewable Energy ... Texas has an electric utility restructuring law that mandates 2000 megawatts of new ...

  15. EERE 'Buildings Prioritization Tool' Helps Shape EERE Projects

    Broader source: Energy.gov [DOE]

    A new public-private partnership focuses on advancing hydrogen infrastructure to support more transportation energy options, including fuel cell electric vehicles.

  16. DOE Resources Help Measure Building Energy Benchmarking Policy & Program Effectiveness

    Broader source: Energy.gov [DOE]

    The DOE Benchmarking & Transparency Policy and Program Impact Evaluation Handbook provides cost-effective, standardized analytic methods for determining gross and net energy reduction, greenhouse gas (GHG) emissions mitigation, job creation and economic growth impacts.

  17. Power Builds Ships Northwest Hydropower Helps Win World War II

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Volume One Film Collection Volume Two 75th Anniversary Hydropower in the Northwest Woody Guthrie Videos Strategic Direction Branding & Logos Power of the River History Book...

  18. Help Build a Better Energy Information Administration Website

    Broader source: Energy.gov [DOE]

    The U.S. Energy Information Administration (EIA) is launching a beta website that encourages the public, researchers, analysts and others to test and comment on the agency’s latest product enhancements, and review other users’ comments.

  19. Better Buildings Case Competition Helps Develop Future Clean...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Not pictured: Christopher Jones and Wesley Look. | Photo courtesy of Elena Alschuler. Rebecca Matulka Rebecca Matulka Former Digital Communications Specialist, Office of Public ...

  20. SoCal Edge: Accelerating Investments in Innovative Building Technologies

    Broader source: Energy.gov [DOE]

    Any time industry leaders and stakeholders are brought together great strides can be made toward accomplishing mutual goals. The Los Angeles Better Buildings Challenge (LABBC) provided a platform to do just that during its Third Annual Building Technology Showcase, where leading technology companies gave fast-pitch presentations on the best energy and water solutions available in the marketplace to the LABBC’s network of property owners, property managers, and contractors.

  1. Residential Building Energy Analysis

    Energy Science and Technology Software Center (OSTI)

    1990-09-01

    PEAR (Program for Energy Analysis of Residences) provides an easy-to-use and accurate method of estimating the energy and cost savings associated with various energy conservation measures in site-built single-family homes. Measures such as ceiling, wall, and floor insulation; different window type and glazing layers; infiltration levels; and equipment efficiency can be considered. PEAR also allows the user to consider the effects of roof and wall color, movable night insulation on the windows, reflective and heatmore » absorbing glass, an attached sunspace, and use of a night temperature setback. Regression techniques permit adjustments for different building geometries, window areas and orientations, wall construction, and extension of the data to 880 U.S. locations determined by climate parameters. Based on annual energy savings, user-specified costs of conservation measures, fuel, lifetime of measure, loan period, and fuel escalation and interest rates, PEAR calculates two economic indicators; the Simple Payback Period (SPP) and the Savings-to-Investment Ratio (SIR). Energy and cost savings of different sets of conservation measures can be compared in a single run. The program can be used both as a research tool by energy policy analysts and as a method for nontechnical energy calculation by architects, home builders, home owners, and others in the building industry.« less

  2. ENERGY EFFICIENCY AND CONSERVATION BLOCK GRANT (EECBG) - BETTER BUILDINGS NEIGHBORHOOD PROGRAM AT GREATER CINCINNATI ENERGY ALLIANCE Project Title: Home Performance with Energy Star® and Better Buildings Performance

    SciTech Connect (OSTI)

    Holzhauser, Andy; Jones, Chris; Faust, Jeremy; Meyer, Chris; Van Divender, Lisa

    2013-12-30

    The Greater Cincinnati Energy Alliance (Energy Alliance) is a nonprofit economic development agency dedicated to helping Greater Cincinnati and Northern Kentucky communities reduce energy consumption. The Energy Alliance has launched programs to educate homeowners, commercial property owners, and nonprofit organizations about energy efficiency opportunities they can use to drive energy use reductions and financial savings, while extending significant focus to creating/retaining jobs through these programs. The mission of the Energy Alliance is based on the premise that investment in energy efficiency can lead to transformative economic development in a region. With support from seven municipalities, the Energy Alliance began operation in early 2010 and has been among the fastest growing nonprofit organizations in the Greater Cincinnati/Northern Kentucky area. The Energy Alliance offers two programs endorsed by the Department of Energy: the Home Performance with ENERGY STAR® Program for homeowners and the Better Buildings Performance Program for commercial entities. Both programs couple expert guidance, project management, and education in energy efficiency best practices with incentives and innovative energy efficiency financing to help building owners effectively invest in the energy efficiency, comfort, health, longevity, and environmental impact of their residential or commercial buildings. The Energy Alliance has raised over $23 million of public and private capital to build a robust market for energy efficiency investment. Of the $23 million, $17 million was a direct grant from the Department of Energy Better Buildings Neighborhood Program (BBNP). The organization’s investments in energy efficiency projects in the residential and commercial sector have led to well over $50 million in direct economic activity and created over 375,000 hours of labor created or retained. In addition, over 250 workers have been trained through the Building Performance Training Center, a program that was developed and funded by the Energy Alliance and housed at Cincinnati State Technical and Community College. Nearly 100 residential and commercial contractors currently participate in the Energy Alliance’s two major programs, which have together served over 2,800 residential and 100 commercial customers. Additionally, the Energy Alliance established loan programs for homeowners, nonprofits and commercial businesses. The GC-HELP program was established to provide up to ten year low interest, unsecured loans to homeowners to cover the energy efficiency products they purchased through the Energy Alliance approved contractor base. To date the Energy Alliance has financed over $1 million in energy efficiency loans for homeowners, without any loans written off. The nonprofit business community is offered five year, fixed-interest rate loans through the Building Communities Loan Fund of $250,000. Additionally, the Energy Alliance has developed GC-PACE, a commercial financing tool that enables buildings owners to finance their energy upgrades through voluntary property assessments deploying low-interest extended-term capital from the bond market. The Energy Alliance and its partners are actively evaluating additional market-based financing solutions.

  3. Integration of Real-Time Data Into Building Automation Systems

    SciTech Connect (OSTI)

    Mark J. Stunder; Perry Sebastian; Brenda A. Chube; Michael D. Koontz

    2003-04-16

    The project goal was to investigate the possibility of using predictive real-time information from the Internet as an input to building management system algorithms. The objectives were to identify the types of information most valuable to commercial and residential building owners, managers, and system designers. To comprehensively investigate and document currently available electronic real-time information suitable for use in building management systems. Verify the reliability of the information and recommend accreditation methods for data and providers. Assess methodologies to automatically retrieve and utilize the information. Characterize equipment required to implement automated integration. Demonstrate the feasibility and benefits of using the information in building management systems. Identify evolutionary control strategies.

  4. Building America

    SciTech Connect (OSTI)

    Brad Oberg

    2010-12-31

    IBACOS researched the constructability and viability issues of using high performance windows as one component of a larger approach to building houses that achieve the Building America 70% energy savings target.

  5. Buildings*","Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    6. Space Heating Energy Sources, Number of Buildings for Non-Mall Buildings, 2003" ,"Number of Buildings (thousand)" ,"All Buildings*","Buildings with Space Heating","Space-Heating Energy Sources Used (more than one may apply)" ,,,"Elec- tricity","Natural Gas","Fuel Oil","District Heat","Propane","Other a" "All Buildings* ...............",4645,3982,1766,2165,360,65,372,113

  6. Laboratory program helps small businesses

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lab helps small businesses Laboratory program helps small businesses The free program, run jointly by Los Alamos and Sandia National Laboratories, leverages the laboratories'...

  7. Laboratory program helps small businesses

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory program helps small businesses Laboratory program helps small businesses The NMSBA allows for-profit small businesses to request technical assistance that capitalizes on...

  8. Beardmore Building

    High Performance Buildings Database

    Priest River, ID Originally built in 1922 by Charles Beardmore, the building housed offices, mercantile shops, a ballroom and a theater. After decades of neglect under outside ownership, Brian Runberg, an architect and great-grandson of Charles Beardmore, purchased the building in 2006 and began an extensive whole building historic restoration.

  9. Commercial Building Performance Monitoring and Evaluation | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Building Performance Monitoring and Evaluation Commercial Building Performance Monitoring and Evaluation The Building Technologies Office (BTO) uses performance metrics to standardize the measurement and characterization of energy performance in commercial buildings. These metrics help inform the effectiveness of energy efficiency measures in existing buildings and highlight opportunities to improve performance. Various tiers of metrics are available for different users. Performance

  10. Recovery Act Helps Y-12 Exceed Cleanup Goal at Manhattan Project...

    National Nuclear Security Administration (NNSA)

    Helps Y-12 Exceed Cleanup Goal at Manhattan Project-Era Building | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the...

  11. EERE Success Story-EERE Expertise Helps Los Alamos Achieve Significant...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addthis Related Articles EERE Success Story-EERE Energy Literacy: Engaging Spanish Speakers EERE Success Story-EERE 'Buildings Prioritization Tool' Helps Shape EERE Projects EERE ...

  12. NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS Logo of the Building Performance Institute. This spring, ...

  13. Connecting Distributed Energy Resources to the Grid: Their Benefits to the DER Owner etc.

    SciTech Connect (OSTI)

    Poore, WP

    2003-07-09

    The vision of the Distributed Energy Research Program (DER) program of the U.S. Department of Energy (DOE) is that the United States will have the cleanest and most efficient and reliable energy system in the world by maximizing the use of affordable distributed energy resources. Electricity consumers will be able to choose from a diverse number of efficient, cost-effective, and environmentally friendly distributed energy options and easily connect them into the nation's energy infrastructure while providing benefits to their owners and other stakeholders. The long-term goal of this vision is that DER will achieve a 20% share of new electric capacity additions in the United States by 2010, thereby helping to make the nation's electric power generation and delivery system more efficient, reliable, secure, clean, economical, and diverse in terms of fuel use (oil, natural gas, solar, hydroelectric, etc.) and prime mover resource (solar, wind, gas turbines, etc.). Near- and mid-term goals are to develop new technologies for implementing and operating DER and address barriers associated with DER usage and then to reduce costs and emissions and improve the efficiency and reliability of DER. Numerous strategies for meeting these goals have been developed into a research, development, and demonstration (RD&D) program that supports generation and delivery systems architecture, including modeling and simulation tools. The benefits associated with DER installations are often significant and numerous. They almost always provide tangible economic benefits, such as energy savings or transmission and distribution upgrade deferrals, as well as intangible benefits, such as power quality improvements that lengthen maintenance or repair intervals for power equipment. Also, the benefits routinely are dispersed among end users, utilities, and the public. For instance, an end user may use the DER to reduce their peak demand and save money due to lower demand charges. Reduced end user peak demand, in turn, may lower a distribution system peak load such that upgrades are deferred or avoided. This could benefit other consumers by providing them with higher reliability and power quality as well as avoiding their cost share of a distribution system upgrade. In this example, the costs of the DER may be born by the end user, but that user reaps only a share of the benefits. This report, the first product of a study to quantify the value of DER, documents initial project efforts to develop an assessment methodology. The focus of currently available site-specific DER assessment techniques are typically limited to two parties, the owner/user and the local utility. Rarely are the impacts on other stakeholders, including interconnected distribution utilities, transmission system operators, generating system operators, other local utility customers, local and regional industry and business, various levels of government, and the environment considered. The goal of this assessment is to quantify benefits and cost savings that accrue broadly across a region, recognizing that DER installations may have local, regional, or national benefits.

  14. Re-Building Greensburg

    ScienceCinema (OSTI)

    Hewitt, Steven; Wallach, Daniel; Peterson, Stephanie;

    2013-05-29

    Greensburg, KS - A town that was devastated by a tornado in 2007, yet came back to be one of the Nation's most energy-efficient, sustainable communities. Civic leaders and entrepreneurs helped rally residents behind the idea of "greening" Greensburg, inspiring the construction of numerous energy-efficient buildings, some of which generate their own renewable power with solar panels and wind turbines. Many of the town's government buildings use cutting edge energy-saving technologies, saving the local taxpayers' money. Greensburg has demonstrated to the world that any city can reach its energy efficiency and renewable energy goals today using widely available technologies.

  15. Strengthening the Workforce in Better Buildings Neighborhoods

    ScienceCinema (OSTI)

    Sperling, Gil; Adams, Cynthia; Fiori, Laura; Penzkover, Dave; Wood, Danny; Farris, Joshua

    2013-05-29

    The Better Buildings Neighborhood Program is supporting an expanding energy efficiency workforce upgrading buildings in communities around the country. Contractors are being trained and have access to additional job opportunities, spurring local economic growth while helping Americans use less energy, save money, and be more comfortable in their homes and other buildings.

  16. Buildings Interoperability Landscape

    SciTech Connect (OSTI)

    Hardin, Dave; Stephan, Eric G.; Wang, Weimin; Corbin, Charles D.; Widergren, Steven E.

    2015-12-31

    Through its Building Technologies Office (BTO), the United States Department of Energy’s Office of Energy Efficiency and Renewable Energy (DOE-EERE) is sponsoring an effort to advance interoperability for the integration of intelligent buildings equipment and automation systems, understanding the importance of integration frameworks and product ecosystems to this cause. This is important to BTO’s mission to enhance energy efficiency and save energy for economic and environmental purposes. For connected buildings ecosystems of products and services from various manufacturers to flourish, the ICT aspects of the equipment need to integrate and operate simply and reliably. Within the concepts of interoperability lie the specification, development, and certification of equipment with standards-based interfaces that connect and work. Beyond this, a healthy community of stakeholders that contribute to and use interoperability work products must be developed. On May 1, 2014, the DOE convened a technical meeting to take stock of the current state of interoperability of connected equipment and systems in buildings. Several insights from that meeting helped facilitate a draft description of the landscape of interoperability for connected buildings, which focuses mainly on small and medium commercial buildings. This document revises the February 2015 landscape document to address reviewer comments, incorporate important insights from the Buildings Interoperability Vision technical meeting, and capture thoughts from that meeting about the topics to be addressed in a buildings interoperability vision. In particular, greater attention is paid to the state of information modeling in buildings and the great potential for near-term benefits in this area from progress and community alignment.

  17. Intelligent Controls for Net-Zero Energy Buildings

    SciTech Connect (OSTI)

    Li, Haorong; Cho, Yong; Peng, Dongming

    2011-10-30

    The goal of this project is to develop and demonstrate enabling technologies that can empower homeowners to convert their homes into net-zero energy buildings in a cost-effective manner. The project objectives and expected outcomes are as follows: • To develop rapid and scalable building information collection and modeling technologies that can obtain and process “as-built” building information in an automated or semiautomated manner. • To identify low-cost measurements and develop low-cost virtual sensors that can monitor building operations in a plug-n-play and low-cost manner. • To integrate and demonstrate low-cost building information modeling (BIM) technologies. • To develop decision support tools which can empower building owners to perform energy auditing and retrofit analysis. • To develop and demonstrate low-cost automated diagnostics and optimal control technologies which can improve building energy efficiency in a continual manner.

  18. Laboratory Building.

    SciTech Connect (OSTI)

    Herrera, Joshua M.

    2015-03-01

    This report is an analysis of the means of egress and life safety requirements for the laboratory building. The building is located at Sandia National Laboratories (SNL) in Albuquerque, NM. The report includes a prescriptive-based analysis as well as a performance-based analysis. Following the analysis are appendices which contain maps of the laboratory building used throughout the analysis. The top of all the maps is assumed to be north.

  19. DOE Buildings Performance Database

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Budget History Oct. 1, 2012- FY2013 (past) FY2014 (current) FY2015 - (planned) DOE ... owners Seattle, Washington University of Arizona University of Dayton District Department ...

  20. Buildings Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Efficiency & Renewable Energy EERE Home | Programs & Offices | Consumer Information Buildings Database Welcome Guest Log In | Register | Contact Us Home About All Projects...

  1. Vacant Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Vacant Characteristics by Activity... Vacant Vacant buildings are those in which more floorspace was vacant than was used for any single commercial activity at the time of the...

  2. Service Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Service Characteristics by Activity... Service Service buildings are those in which some type of service is provided, other than food service or retail sales of goods. Basic...

  3. Other Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Other Characteristics by Activity... Other Other buildings are those that do not fit into any of the specifically named categories. Basic Characteristics See also: Equipment |...

  4. Secretaries Chu and Donovan to Host Conference Call on Home Owners

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Saving Improvements Program | Department of Energy Donovan to Host Conference Call on Home Owners Energy-Saving Improvements Program Secretaries Chu and Donovan to Host Conference Call on Home Owners Energy-Saving Improvements Program April 20, 2011 - 12:00am Addthis WASHINGTON - Thursday, April 21st, U.S. Department of Energy Secretary Steven Chu and U.S. Housing and Urban Development Secretary Shaun Donovan will launch a new pilot program intended to offer homeowners low-cost

  5. 2014 News | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 News Below are news stories related to Buildings. RSS Learn about RSS. December 23, 2014 NREL Receives Editors' Choice Awards for Supercomputer Research Two prestigious scientific magazines have awarded the Energy Department's National Renewable Energy Laboratory (NREL) with Editors' Choice awards for the Peregrine high-performance computer and the groundbreaking research it made possible. December 18, 2014 Three New Fellows to Help Guide NREL Research The Energy Department's National

  6. Building Energy Monitoring and Analysis

    SciTech Connect (OSTI)

    Hong, Tianzhen; Feng, Wei; Lu, Alison; Xia, Jianjun; Yang, Le; Shen, Qi; Im, Piljae; Bhandari, Mahabir

    2013-06-01

    This project aimed to develop a standard methodology for building energy data definition, collection, presentation, and analysis; apply the developed methods to a standardized energy monitoring platform, including hardware and software, to collect and analyze building energy use data; and compile offline statistical data and online real-time data in both countries for fully understanding the current status of building energy use. This helps decode the driving forces behind the discrepancy of building energy use between the two countries; identify gaps and deficiencies of current building energy monitoring, data collection, and analysis; and create knowledge and tools to collect and analyze good building energy data to provide valuable and actionable information for key stakeholders.

  7. Application for Presidential Permit OE Docket No. PP-82-4 Joint Owners of the Highgate Project

    Broader source: Energy.gov [DOE]

    Amended application from Vermont Electric Power Company, Inc. (VELCO), operating-and-management agent for the Joint Owners of the Highgate Project requesting to remove certain operating conditions...

  8. Better Buildings Neighborhood Program | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Better Buildings Neighborhood Program From 2010 to 2013, the Better Buildings Neighborhood Program helped more than 40 competitively selected state and local governments develop sustainable programs to upgrade the energy efficiency of homes and buildings. These leading communities used innovation and investment in energy efficiency to expand the building improvement industry, test program delivery business models, create jobs, and save consumers hundreds of millions of dollars. From 2010 to

  9. Jackson Park Hospital Green Building Medical Center

    SciTech Connect (OSTI)

    William Dorsey; Nelson Vasquez

    2010-03-01

    Jackson Park Hospital completed the construction of a new Medical Office Building on its campus this spring. The new building construction has adopted the City of Chicagoâ??s recent focus on protecting the environment, and conserving energy and resources, with the introduction of green building codes. Located in a poor, inner city neighborhood on the South side of Chicago, Jackson Park Hospital has chosen green building strategies to help make the area a better place to live and work.

  10. The Council of Industrial Boiler Owners special project on non-utility fossil fuel ash classification

    SciTech Connect (OSTI)

    Svendsen, R.L.

    1996-12-31

    Information is outlined on the Council of Industrial Boiler Owners (CIBO) special project on non-utility fossil fuel ash classification. Data are presented on; current (1996) regulatory status of fossil-fuel combustion wastes; FBC technology identified for further study; CIBO special project methods; Bevill amendment study factors; data collection; and CIBO special project status.

  11. The consumer's guide to earth sheltered housing: A step-by-step workbook for prospective owners

    SciTech Connect (OSTI)

    Rollwagen, M.

    1985-01-01

    Earth sheltered homes have captured the imagination of many homeowners seeking the cost and energy savings features they offer. This book provides the discussion of the advantages and disadvantages of such homes and includes illustrations showing interiors and exteriors with advise to owners on dealine with architects and contractors.

  12. Intelligent Buildings

    SciTech Connect (OSTI)

    Brambley, Michael R.; Armstrong, Peter R.; Kintner-Meyer, Michael CW; Pratt, Robert G.; Katipamula, Srinivas

    2001-01-01

    The topic of "intelligent buildings" (IBs) emerged in the early 1980s. Since, the term has been used to represent a variety of related, yet differing topics, each with a slightly different focus and purpose. Wiring and networking-infrastructure companies emphasize the cabling requirements for communication in intelligent buildings and the need to accommodate future needs for higher-speed broadband. Lucent (Lucent 2000) for example, defines an IB as "...one with a completely integrated wiring architecture. A single cabling system that handles all information traffic - voice, data, video, even the big building management systems."

  13. Commercial Buildings

    Broader source: Energy.gov [DOE]

    Learn how the Energy Department is helping businesses, nonprofits and local governments reduce energy use through energy efficiency and renewable energy technologies.

  14. Sustainable Federal Buildings and Campuses | Department of Energy

    Energy Savers [EERE]

    Sustainable Federal Buildings and Campuses Sustainable Federal Buildings and Campuses An air-intake structure outside this high-performance federal building lowers energy costs by taking in chilly night air to cool the building's data center. An air-intake structure outside this high-performance federal building lowers energy costs by taking in chilly night air to cool the building's data center. The Federal Energy Management Program provides strategies, best practices, and resources to help

  15. Resources for Sustainable Federal Buildings and Campuses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Facilities » Sustainable Buildings & Campuses » Resources for Sustainable Federal Buildings and Campuses Resources for Sustainable Federal Buildings and Campuses Many helpful resources about sustainable federal buildings and campuses are available. Federal Programs Building Energy Codes Program: Website provides information about the 2015 International Energy Conservation Code and ANSI/ASHRAE/IES Standard 90.1-2013 for non-federal buildings. The Federal Energy Management Program

  16. Building America: Making Real Progress

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    America: Making Real Progress for U.S. Homes The U.S. Department of Energy (DOE) Building America Program conducts innovative housing research on energy efficiency to benefit the residential building industry and the public. The program has produced more than 100 innovations and accel- erated the adoption of energy-saving technologies. Since 1995, this work has helped households across the nation save up to $54 billion and avoid the emissions of 500 million tons of carbon dioxide. DOE esti-

  17. INL High Performance Building Strategy

    SciTech Connect (OSTI)

    Jennifer D. Morton

    2010-02-01

    High performance buildings, also known as sustainable buildings and green buildings, are resource efficient structures that minimize the impact on the environment by using less energy and water, reduce solid waste and pollutants, and limit the depletion of natural resources while also providing a thermally and visually comfortable working environment that increases productivity for building occupants. As Idaho National Laboratory (INL) becomes the nation’s premier nuclear energy research laboratory, the physical infrastructure will be established to help accomplish this mission. This infrastructure, particularly the buildings, should incorporate high performance sustainable design features in order to be environmentally responsible and reflect an image of progressiveness and innovation to the public and prospective employees. Additionally, INL is a large consumer of energy that contributes to both carbon emissions and resource inefficiency. In the current climate of rising energy prices and political pressure for carbon reduction, this guide will help new construction project teams to design facilities that are sustainable and reduce energy costs, thereby reducing carbon emissions. With these concerns in mind, the recommendations described in the INL High Performance Building Strategy (previously called the INL Green Building Strategy) are intended to form the INL foundation for high performance building standards. This revised strategy incorporates the latest federal and DOE orders (Executive Order [EO] 13514, “Federal Leadership in Environmental, Energy, and Economic Performance” [2009], EO 13423, “Strengthening Federal Environmental, Energy, and Transportation Management” [2007], and DOE Order 430.2B, “Departmental Energy, Renewable Energy, and Transportation Management” [2008]), the latest guidelines, trends, and observations in high performance building construction, and the latest changes to the Leadership in Energy and Environmental Design (LEED®) Green Building Rating System (LEED 2009). The document employs a two-level approach for high performance building at INL. The first level identifies the requirements of the Guiding Principles for Sustainable New Construction and Major Renovations, and the second level recommends which credits should be met when LEED Gold certification is required.

  18. Whole Building Cost and Performance Measurement: Data Collection Protocol Revision 2

    SciTech Connect (OSTI)

    Fowler, Kimberly M.; Spees, Kathleen L.; Kora, Angela R.; Rauch, Emily M.; Hathaway, John E.; Solana, Amy E.

    2009-03-27

    This protocol was written for the Department of Energys Federal Energy Management Program (FEMP) to be used by the public as a tool for assessing building cost and performance measurement. The primary audiences are sustainable design professionals, asset owners, building managers, and research professionals within the Federal sector. The protocol was developed based on the need for measured performance and cost data on sustainable design projects. Historically there has not been a significant driver in the public or private sector to quantify whole building performance in comparable terms. The deployment of sustainable design into the building sector has initiated many questions on the performance and operational cost of these buildings.

  19. Office Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    page, please call 202-586-8800. There were enough buildings in the responding sample to report statistics for all of these types except for research and development, which has...

  20. Lodging Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    were then asked to place the building into the following more specific categories: a hotel a motel, inn, or resort a retirement home a shelter, orphanage, or children's home a...

  1. Together with Key Allies, DOE Launches New Data Collaborative to Help

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cities and States Advance Building Efficiency | Department of Energy Together with Key Allies, DOE Launches New Data Collaborative to Help Cities and States Advance Building Efficiency Together with Key Allies, DOE Launches New Data Collaborative to Help Cities and States Advance Building Efficiency November 9, 2015 - 5:11pm Addthis The U.S. Department of Energy (DOE) - together with the Natural Resources Defense Council (NRDC), the Institute for Market Transformation (IMT), the National

  2. Clean Energy Projects Helping Wisconsin Tribe Achieve Sustainability Goals

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Projects Helping Wisconsin Tribe Achieve Sustainability Goals Clean Energy Projects Helping Wisconsin Tribe Achieve Sustainability Goals January 13, 2014 - 11:19am Addthis Before (left) and after photo of historic Wunder Hall, where Milwaukee's Forest County Potawatomi Community completed a major energy upgrade project. The building now serves as the tribe's economic development center. | Courtesy of Forest County Potawatomi Community Before (left) and after photo of

  3. NREL to Help California Tackle Solar Energy Grid Integration - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL to Help California Tackle Solar Energy Grid Integration Renewable Energy Laboratory Picks Up $2.7 Million in Grants March 30, 2010 The California Public Utilities Commission has tapped experts at the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) to help the state stimulate solar energy research and build a sustainable solar industry. The commission awarded NREL $2,785,000 in California Solar Initiative (CSI) Research, Development, Deployment and

  4. Moving Quarks Help Solve Proton Spin Puzzle | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Moving Quarks Help Solve Proton Spin Puzzle Moving Quarks Help Solve Proton Spin Puzzle NEWPORT NEWS, VA., Sept. 11, 2008 - New theory work at the U.S. Department of Energy's Thomas Jefferson National Accelerator Facility has shown that more than half of the spin of the proton is the result of the movement of its building blocks: quarks. The result, published in the Sept. 5 issue of Physical Review Letters, agrees with recent experiments and supercomputer calculations. It was thought that the

  5. Building America Webinar: High Performance Building Enclosures...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    High Performance Building Enclosures: Part I, Existing Homes Building America Webinar: High Performance Building Enclosures: Part I, Existing Homes The webinar, presented on May ...

  6. Reporting Portal (Cognos) Help & Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reporting Portal (Cognos) Help & Training

  7. Research & Development Needs for Building-Integrated Solar Technologies

    Broader source: Energy.gov [DOE]

    Building Integrated Solar Technologies (BIST) can help achieve the Building Technologies Office goal of reducing energy consumption in residential and commercial buildings by 50% by the year 2030. BIST include technologies for space heating and cooling, water heating, hybrid photovoltaic-thermal systems (PV/T), active solar lighting, and building-integrated photovoltaics (BIPV).

  8. Building Value with Energy-Saving Upgrades in Homes and Businesses

    Broader source: Energy.gov [DOE]

    To help encourage more Americans to upgrade their businesses with energy-saving products, the Department of Energy recently announced a partnership that will help expand access to energy-efficiency and building performance information for commercial buildings.

  9. Help

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reimbursement Get updates on LANL Environmental Programs - Click to subscribe RELATED NEWS Top 10 science stories of the year From supercomputers and climate modeling, to...

  10. NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS NEW CREDENTIAL HELPS HOMES GET HEALTH AND SAFETY CHECK-UPS Logo of the Building Performance Institute. This spring, Residential Network member the Building Performance Institute (BPI) will introduce the Healthy Home Evaluator credential to help the home performance, weatherization, and healthy housing workforce assess home-based environmental health and safety hazards and provide a prioritized list of recommendations to

  11. Integrated Building Management System (IBMS)

    SciTech Connect (OSTI)

    Anita Lewis

    2012-07-01

    This project provides a combination of software and services that more easily and cost-effectively help to achieve optimized building performance and energy efficiency. Featuring an open-platform, cloud- hosted application suite and an intuitive user experience, this solution simplifies a traditionally very complex process by collecting data from disparate building systems and creating a single, integrated view of building and system performance. The Fault Detection and Diagnostics algorithms developed within the IBMS have been designed and tested as an integrated component of the control algorithms running the equipment being monitored. The algorithms identify the normal control behaviors of the equipment without interfering with the equipment control sequences. The algorithms also work without interfering with any cooperative control sequences operating between different pieces of equipment or building systems. In this manner the FDD algorithms create an integrated building management system.

  12. Building Energy Monitoring and Analysis

    SciTech Connect (OSTI)

    Hong, Tianzhen; Feng, Wei; Lu, Alison; Xia, Jianjun; Yang, Le; Shen, Qi; Im, Piljae; Bhandari, Mahabir

    2013-06-01

    U.S. and China are the world’s top two economics. Together they consumed one-third of the world’s primary energy. It is an unprecedented opportunity and challenge for governments, researchers and industries in both countries to join together to address energy issues and global climate change. Such joint collaboration has huge potential in creating new jobs in energy technologies and services. Buildings in the US and China consumed about 40% and 25% of the primary energy in both countries in 2010 respectively. Worldwide, the building sector is the largest contributor to the greenhouse gas emission. Better understanding and improving the energy performance of buildings is a critical step towards sustainable development and mitigation of global climate change. This project aimed to develop a standard methodology for building energy data definition, collection, presentation, and analysis; apply the developed methods to a standardized energy monitoring platform, including hardware and software, to collect and analyze building energy use data; and compile offline statistical data and online real-time data in both countries for fully understanding the current status of building energy use. This helps decode the driving forces behind the discrepancy of building energy use between the two countries; identify gaps and deficiencies of current building energy monitoring, data collection, and analysis; and create knowledge and tools to collect and analyze good building energy data to provide valuable and actionable information for key stakeholders.

  13. Archive Reference Buildings by Building Type: Warehouse

    Broader source: Energy.gov [DOE]

    Here you will find past versions of the reference buildings for new construction commercial buildings, organized by building type and location. A summary of building types and climate zones is...

  14. Building Energy Data Exchange Specification (BEDES) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data Exchange Specification (BEDES) Building Energy Data Exchange Specification (BEDES) Building Energy Data Exchange Specification (BEDES) Overview The Building Energy Data Exchange Specification (BEDES, pronounced "beads" or /bi:ds/) is a dictionary of terms, definitions, and field formats which was created to help facilitate the exchange of information on building characteristics and energy use. It is intended to be used in tools and activities that help stakeholders make

  15. Buildings Energy Data Book: 3.2 Commercial Sector Characteristics

    Buildings Energy Data Book [EERE]

    3 Number of Floors and Type of Ownership, as of 2003 (Percent of Total Floorspace) Floors Ownership One 40% Nongovernment Owned 76% Two 25% Owner-Occupied 36% Three 12% Nonowner-Occupied 37% Four to Nine 16% Unoccupied 3% Ten or More 8% Government Owned 24% Total 100% Federal 3% State 5% Local 15% Total 100% Source(s): EIA, Commercial Building Characteristics 2003, June 2006, Table C1

  16. Project Impact Assessments … Building America FY14 Field Test...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... on project priorities and approach, and helps us interpret DOE priorities. - David Springer, Davis Energy Group ARBI Team Much of the research undertaken in Building America is ...

  17. Building America Case Study: Northwest Energy Efficient Manufactured...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bonneville Power Administration to help four factory builders in the Pacifc Northwest ... Building America Benchmark in a western Washington State marine climate location. The four ...

  18. Energy Efficiency Program Administrators and Building Energy Codes

    SciTech Connect (OSTI)

    none,

    2009-09-01

    Explores how energy efficiency program administrators have helped advance building energy codes at federal, state, and local levels using technical, institutional, financial, and other resources.

  19. Energy Efficiency and Conservation Programs for Buildings and Facilities

    Broader source: Energy.gov [DOE]

    Below are best practices, project resources, and other tools to help you develop and implement programs for designing, building, and operating energy efficient government, commercial, and...

  20. Better Buildings Neighborhood Program Business Models Guide: Executive Summary

    Broader source: Energy.gov [DOE]

    Uses lessons learned from Better Buildings grantees, existing data, and private sector insights to highlight business models that can help develop a sustainable residential energy efficiency market.

  1. Energy and Commerce Departments Announce New Centers for Building...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    deploy programs aimed at training and expanding current and incoming building operators. ... "Improving energy efficiency in business and manufacturing is critical for helping ...

  2. Better Buildings Neighborhood Program Business Models Guide: Introduction

    Broader source: Energy.gov [DOE]

    Uses lessons learned from Better Buildings grantees, existing data, and private sector insights to highlight business models that can help develop a sustainable residential energy efficiency market.

  3. Energy Department Announces $10 Million for Innovative Commercial...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    next generation building systems and components to a broader market faster - helping to save building owners and businesses money by saving energy. The Department also released a...

  4. Energy Department Announces Partnership with CoStar Group, Inc. to Expand Visibility of Energy-Efficient Buildings in U.S. Real Estate Marketplace

    Broader source: Energy.gov [DOE]

    As part of the Obama Administration's effort to cut energy waste in the America's buildings, the U.S. Department of Energy's Better Buildings Initiative today announced a partnership with CoStar Group, Inc., a provider of data and intelligence solutions to commercial real estate professionals, to expand the visibility of energy-efficient buildings in U.S. property markets and promote the benefits of energy efficiency for building owners and occupants.

  5. Building America Update - July 9, 2013

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The EEBA conference offers educational seminars, expert presenters, and hands-on demonstrations to help builders tap into the most up-to-date building science and home performance ...

  6. Building Energy Data Exchange Specification Scoping Report |...

    Broader source: Energy.gov (indexed) [DOE]

    The Building Energy Data Exchange Specification (BEDES), developed by DOE, is a uniform ... for DOE programs, and help unlock the full utility of the data that the DOE collects. ...

  7. Overview of Commercial Building Partnerships in Higher Education

    SciTech Connect (OSTI)

    Schatz, Glenn

    2013-03-01

    Higher education uses less energy per square foot than most commercial building sectors. However, higher education campuses house energy-intensive laboratories and data centers that may spend more than this average; laboratories, in particular, are disproportionately represented in the higher education sector. The Commercial Building Partnership (CBP), a public/private, cost-shared program sponsored by the U.S. Department of Energy (DOE), paired selected commercial building owners and operators with representatives of DOE, its national laboratories, and private-sector technical experts. These teams explored energy-saving measures across building systems–including some considered too costly or technologically challenging–and used advanced energy modeling to achieve peak whole-building performance. Modeling results were then included in new construction or retrofit designs to achieve significant energy reductions.

  8. Overheating in Hot Water- and Steam-Heated Multifamily Buildings

    SciTech Connect (OSTI)

    Dentz, J.; Varshney, K.; Henderson, H.

    2013-10-01

    Apartment temperature data have been collected from the archives of companies that provide energy management systems (EMS) to multifamily buildings in the Northeast U.S. The data have been analyzed from more than 100 apartments in eighteen buildings where EMS systems were already installed to quantify the degree of overheating. This research attempts to answer the question, 'What is the magnitude of apartment overheating in multifamily buildings with central hot water or steam heat?' This report provides valuable information to researchers, utility program managers and building owners interested in controlling heating energy waste and improving resident comfort. Apartment temperature data were analyzed for deviation from a 70 degrees F desired setpoint and for variation by heating system type, apartment floor level and ambient conditions. The data shows that overheating is significant in these multifamily buildings with both hot water and steam heating systems.

  9. Healthy and Affordable Housing: Practical Recommendations for Building, Renovating and Maintaining Housing: Read This Before You Design, Build or Renovate

    SciTech Connect (OSTI)

    2001-09-06

    This document helps builders design, build, or renovate homes, keeping in mind the issues of asthma, health, indoor air quality, dust, and living creatures.

  10. Residential Buildings Integration Program

    Broader source: Energy.gov [DOE]

    Residential Buildings Integration Program Presentation for the 2013 Building Technologies Office's Program Peer Review

  11. Energy Efficient Buildings Hub

    SciTech Connect (OSTI)

    2013-04-01

    Energy Efficient Buildings HUB Lunch Presentation for the 2013 Building Technologies Office's Program Peer Review

  12. Building America System Research

    SciTech Connect (OSTI)

    2013-04-01

    Residential Buildings Integration Project for the 2013 Building Technologies Office's Program Peer Review

  13. Energy Efficient Buildings Hub

    Broader source: Energy.gov [DOE]

    Energy Efficient Buildings HUB Lunch Presentation for the 2013 Building Technologies Office's Program Peer Review

  14. Building Technologies Office Overview

    SciTech Connect (OSTI)

    2013-04-01

    Building Technologies Office Overview Presentation for the 2013 Building Technologies Office's Program Peer Review

  15. Commercial Buildings Consortium

    Broader source: Energy.gov [DOE]

    Commercial Buildings Integration Project for the 2013 Building Technologies Office's Program Peer Review

  16. NET-ZERO ENERGY BUILDING OPERATOR TRAINING PROGRAM (NZEBOT)

    SciTech Connect (OSTI)

    Brizendine, Anthony; Byars, Nan; Sleiti, Ahmad; Gehrig, Bruce; Lu, Na

    2012-12-31

    The primary objective of the Net-Zero Energy Building Operator Training Program (NZEBOT) was to develop certificate level training programs for commercial building owners, managers and operators, principally in the areas of energy / sustainability management. The expected outcome of the project was a multi-faceted mechanism for developing the skill-based competency of building operators, owners, architects/engineers, construction professionals, tenants, brokers and other interested groups in energy efficient building technologies and best practices. The training program draws heavily on DOE supported and developed materials available in the existing literature, as well as existing, modified, and newly developed curricula from the Department of Engineering Technology & Construction Management (ETCM) at the University of North Carolina at Charlotte (UNC-Charlotte). The project goal is to develop a certificate level training curriculum for commercial energy and sustainability managers and building operators that: 1) Increases the skill-based competency of building professionals in energy efficient building technologies and best practices, and 2) Increases the workforce pool of expertise in energy management and conservation techniques. The curriculum developed in this project can subsequently be used to establish a sustainable energy training program that can contribute to the creation of new “green” job opportunities in North Carolina and throughout the Southeast region, and workforce training that leads to overall reductions in commercial building energy consumption. Three energy training / education programs were developed to achieve the stated goal, namely: 1. Building Energy/Sustainability Management (BESM) Certificate Program for Building Managers and Operators (40 hours); 2. Energy Efficient Building Technologies (EEBT) Certificate Program (16 hours); and 3. Energy Efficent Buildings (EEB) Seminar (4 hours). Training Program 1 incorporates the following topics in the primary five-day Building Energy/Sustainability Management Certificate program in five training modules, namely: 1) Strategic Planning, 2) Sustainability Audits, 3) Information Analysis, 4) Energy Efficiency, and 5) Communication. Training Program 2 addresses the following technical topics in the two-day Building Technologies workshop: 1) Energy Efficient Building Materials, 2) Green Roofing Systems, 3) Energy Efficient Lighting Systems, 4) Alternative Power Systems for Buildings, 5) Innovative Building Systems, and 6) Application of Building Performance Simulation Software. Program 3 is a seminar which provides an overview of elements of programs 1 and 2 in a seminar style presentation designed for the general public to raise overall public awareness of energy and sustainability topics.

  17. State-of-the-Art Building Concepts Lower Energy Bills, Pulte Homes - Las Vegas, Nevada

    SciTech Connect (OSTI)

    2002-03-01

    Houses built by Pulte Homes as part of the U.S. Department of Energy's Building America program in Las Vegas, Nevada, save money for the home owners by reducing electric air-conditioning costs and gas heating costs with little or no additional inv

  18. Home Energy Loan Program (HELP)

    Broader source: Energy.gov [DOE]

    In order to participate, a homeowner must contact a participating lender directly and must complete a credit application. The HELP home improvement loans may either be consumer loans or second...

  19. Helping make the holidays happier

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Helping Make The Holidays Happier Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue:May 2016 all issues All Issues » submit Helping make the holidays happier This year's LANL food drive collected enough donations to provide 11,600 meals for those in need. January 1, 2013 dummy image Read our archives Contacts Editor Linda Anderman Email Community Programs Office Kurt Steinhaus Email The contributions by employees included 164 turkeys

  20. Helpful Organizations | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Affairs » Helpful Organizations Helpful Organizations Council of State Governments Established in 1933, the Council of State Governments is the only multi-branch state association in the nation. It offers leadership training, provides research and information products, and focuses on regional problem-solving in an effort to increase states' efficiency and productivity. It keeps offices across the United States that staff regional associations of legislative and executive officials. Energy

  1. Advanced Interactive Facades - Critical Elements for Future GreenBuildings?

    SciTech Connect (OSTI)

    Selkowitz, Stephen; Aschehoug, Oyvind; Lee, Eleanor S.

    2003-11-01

    Building designers and owners have always been fascinated with the extensive use of glass in building envelopes. Today the highly glazed facade has almost become an iconic element for a 'green building' that provides daylighting and a visual connection with the natural environment. Even before the current interest in green buildings there was no shortage of highly glazed building designs. But many of these buildings either rejected sunlight, and some associated daylight and view with highly reflective glazings or used highly transmissive glass and encountered serious internal comfort problems that could only be overcome with large HVAC systems, resulting in significant energy, cost and environmental penalties. From the 1960's to the 1990's innovation in glazing made heat absorbing glass, reflective glass and double glazing commonplace, with an associated set of aesthetic features. In the last decade there has been a subtle shift from trying to optimize an ideal, static design solution using these glazings to making the facade responsive, interactive and even intelligent. More sophisticated design approaches and technologies have emerged using new high-performance glazing, improved shading and solar control systems, greater use of automated controls, and integration with other building systems. One relatively new architectural development is the double glass facade that offers a cavity that can provide improved acoustics, better solar control and enhanced ventilation. Taken to its ultimate development, an interactive facade should respond intelligently and reliably to the changing outdoor conditions and internal performance needs. It should exploit available natural energies for lighting, heating and ventilation, should be able to provide large energy savings compared to conventional technologies, and at the same time maintain optimal indoor visual and thermal comfort conditions. As photovoltaic costs decrease in the future, these onsite power systems will be integrated within the glass skin and these facades will become local, non-polluting energy suppliers to the building. The potential for facilitating sustainable building operations in the future by exploiting these concepts is therefore great. There is growing interest in highly glazed building facades, driven by a variety of architectural, aesthetic, business and environmental rationales. The environmental rationale appears plausible only if conventional glazing systems are replaced by a new generation of high performance, interactive, intelligent facade systems, that meet the comfort and performance needs of occupants while satisfying owner economic needs and broader societal environmental concerns. The challenge is that new technology, better systems integration using more capable design tools, and smarter building operation are all necessary to meet these goals. The opportunity is to create a new class of buildings that are both environmentally responsible at a regional or global level while providing the amenities and working environments that owners and occupants seek.

  2. Building Energy Data Exchange Specification Scoping Report

    Broader source: Energy.gov [DOE]

    Building Energy Data Exchange Specification Scoping Report. The Building Energy Data Exchange Specification (BEDES), developed by DOE, is a uniform format is intended to make it easier for external stakeholders to use DOE tools, streamline reporting for DOE programs, and help unlock the full utility of the data that the DOE collects.

  3. Better Buildings Residential Network Social Media Toolkit

    Energy Savers [EERE]

    Social Media Toolkit BETTER BUILDINGS RESIDENTIAL NETWORK Learn more at betterbuildings.energy.gov/bbrn 1 T his Better Buildings Residential Network toolkit can be used to help residential energy efficiency programs learn to engage potential customers through social media. Social media can build brand awareness concerning home energy upgrades and the entities working on them, which can lead to more energy upgrade projects taking place in the long run. Residential Network members provided input

  4. Technical Meeting: Buildings Interoperability Vision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Buildings Interoperability Vision Technical Meeting: Buildings Interoperability Vision On March 11-12, 2015, BTO held a technical meeting in Seattle to discuss the current landscape of buildings interoperability and hear from technology leaders about Internet of Things (IoT) and next generation buildings automation concepts and challenges. To help frame the vision discussion, BTO assembled experts representing a variety of stakeholder groups in the connected buildings area to discuss the

  5. BTO Seeks Comments on Draft Building Energy Modeling Roadmap | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy BTO Seeks Comments on Draft Building Energy Modeling Roadmap BTO Seeks Comments on Draft Building Energy Modeling Roadmap The Department of Energy's Building Technologies Office (BTO) seeks input from stakeholders on a draft Building Energy Modeling Roadmap. The draft Roadmap provides background and context, then outlines steps that BTO's contractor recommends to help increase the use of BEM tools for the design and operation of energy-efficient buildings. The draft Roadmap is

  6. Fact #856 January 19, 2015 Plug-in and Hybrid Cars Receive High Scores for Owner Satisfaction

    Broader source: Energy.gov [DOE]

    The annual owner-satisfaction survey from Consumer Reports in 2014 covered 350,000 vehicles from one to three years old. They asked subscribers if they would purchase the same vehicle again knowing...

  7. Building America Expert Meeting Report: Hydronic Heating in Multifamily Buildings

    SciTech Connect (OSTI)

    Dentz, J.

    2011-10-01

    The topic of this expert meeting was cost-effective controls and distribution retrofit options for hot water and steam space heating systems in multi-family buildings with the goals of reducing energy waste and improving occupant comfort. The U.S. Department of Energy's Building America program develops technologies with the goal of reducing energy use by 30% to 50% in residential buildings. Toward this goal, the program sponsors 'Expert Meetings' focused on specific building technology topics. The meetings are intended to sharpen Building America research priorities, create a forum for sharing information among industry leaders and build partnerships with professionals and others that can help support the program's research needs and objectives. The topic of this expert meeting was cost-effective controls and distribution retrofit options for hot water and steam space heating systems in multifamily buildings with the goals of reducing energy waste and improving occupant comfort. The objectives of the meeting were to: (1) Share knowledge and experience on new and existing solutions: what works, what doesn't and why, and what's new; (2) Understand the market barriers to currently offered solutions: what disconnects exist in the market and what is needed to overcome or bridge these gaps; and (3) Identify research needs.

  8. World Energy Use: ISO Standards that Can Help | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    World Energy Use: ISO Standards that Can Help World Energy Use: ISO Standards that Can Help This one-page flyer shows total world energy consumption of marketed energy by economic sector as well as a list of ISO standards that can help to manage energy use. PDF icon World Energy Use: ISO Standards that Can Help More Documents & Publications ISO 50001 Brochure ISO launches a project committee to develop an International Standard for energy management Buildings Performance Database - 2013 BTO

  9. Analysis of institutional mechanisms affecting residential and commercial buildings retrofit

    SciTech Connect (OSTI)

    Not Available

    1980-09-01

    Barriers to energy conservation in the residential and commercial sectors influence (1) the willingness of building occupants to modify their energy usage habits, and (2) the willingness of building owners/occupants to upgrade the thermal characteristics of the structures within which they live or work and the appliances which they use. The barriers that influence the willingness of building owners/occupants to modify the thermal efficiency characteristics of building structures and heating/cooling systems are discussed. This focus is further narrowed to include only those barriers that impede modifications to existing buildings, i.e., energy conservation retrofit activity. Eight barriers selected for their suitability for Federal action in the residential and commercial sectors and examined are: fuel pricing policies that in the short term do not provide enough incentive to invest in energy conservation; high finance cost; inability to evaluate contractor performance; inability to evaluate retrofit products; lack of well-integrated or one-stop marketing systems (referred to as lack of delivery systems); lack of precise or customized information; lack of sociological/psychological incentives; and use of the first-cost decision criterion (expanded to include short-term payback criterion for the commercial sector). The impacts of these barriers on energy conservation are separately assessed for the residential and commercial sectors.

  10. New York building stands out, saves energy

    Broader source: Energy.gov [DOE]

    A new energy-efficient building in New York is raising eyebrows and inspiring creativity, but its unique design and innovative features are helping the Cooper Union for the Advancement of Science and Art save energy, help the environment and keep its students’ imaginations fresh.

  11. Btu)","per Building

    U.S. Energy Information Administration (EIA) Indexed Site

    ,"Number of Buildings (thousand)","Floorspace (million square feet)","Floorspace per Building (thousand square feet)","Total (trillion Btu)","per Building (million Btu)","per...

  12. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Rhode Island Building Code Standards Committee adopts, promulgates and administers the state building code. Compliance is determined through the building permit and inspection process by local...

  13. Residential Buildings Integration (RBI)

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    David Lee Program Manager Residential Buildings Integration (RBI) April 22, 2014 Residential Buildings Integration (RBI) MissionVision The Residential Buildings ...

  14. Commercial Buildings Integration (CBI)

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Arah Schuur Program Manager Commercial Buildings Integration (CBI) April 22, 2014 Commercial Buildings Integration (CBI) 2 Commercial Buildings Integration (CBI) Mission...

  15. 1999 Commercial Buildings Characteristics

    U.S. Energy Information Administration (EIA) Indexed Site

    Data Reports > 2003 Building Characteristics Overview 1999 Commercial Buildings Energy Consumption SurveyCommercial Buildings Characteristics Released: May 2002 Topics: Energy...

  16. Category:Help | Open Energy Information

    Open Energy Info (EERE)

    the specific wiki's own license. See Project:PD Help if you want to help us. All English-language public-domain help pages should be categorized into Category:Help (using...

  17. Building America Building Science Translator

    Energy Savers [EERE]

    Building Science Translator February 2015 NOTICE This report was prepared as an account of work sponsored by an agency of the United States government. Neither the United States government nor any agency thereof, nor any of their employees, subcontractors, or affliated partners, make any warranty, express or implied, or assume any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represent that its use

  18. ENERGY STAR Webinar: ENERGY STAR and Green Building Rating Systems

    Office of Energy Efficiency and Renewable Energy (EERE)

    Hosted by the U.S. Environmental Protection Agency's (EPA's) ENERGY STAR, this webinar will help attendees how to use EPA tools and resources to help meet requirements for green building rating systems, such as the U.S. Green Building Council's Leadership in Energy and Environmental Design (LEED), the Green Globes system, and others.

  19. Buildings Interoperability Planning: Connected Buildings Interoperabil...

    Broader source: Energy.gov (indexed) [DOE]

    Vision Context Steve Widergren PNNL 11 March 2015 Topics Purpose of meeting Buildings automation in the transformative time of connectivity Interoperability - a connected buildings...

  20. Building America Expert Meeting: Transforming Existing Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon exptmtgideaexchange.pdf More Documents & Publications Valuing Green in the Appraisal Process - Building America Top Innovation Building America Residential Energy ...

  1. Building America Building Science Education Roadmap

    Broader source: Energy.gov [DOE]

    This roadmap outlines steps that U.S. Department of Energy Building America program must take to develop a robust building science education curriculum in coming years.

  2. Office Buildings - Types of Office Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  3. 1999 Commercial Buildings Characteristics--Building Size

    U.S. Energy Information Administration (EIA) Indexed Site

    (202) 586-8800. Energy Information Administration Commercial Buildings Energy Consumption Survey Top Return to: "1999 CBECS-Commercial Buildings Characteristics" Specific questions...

  4. Building Technologies Program: Building America Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and existing homes provided by the Building America Program.You may also visit the new Solution Center to find expert building science and energy efficiency resources. RSS...

  5. 1999 Commercial Building Characteristics--Building Activity Comparison

    U.S. Energy Information Administration (EIA) Indexed Site

    Building Activity Comparison Percentage of Floorspace and Buildings by Principal Building Activity, 1999 Percentage of Floorspace and Buildings by Principal Building Activity,...

  6. BSC: Building America, Building Science Consortium - 2015 Peer...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BSC: Building America, Building Science Consortium - 2015 Peer Review BSC: Building America, Building Science Consortium - 2015 Peer Review Presenter: Joe Lstiburek, Building ...

  7. Strengthening Building Retrofit Markets

    SciTech Connect (OSTI)

    Templeton, Mary; Jackson, Robert

    2014-04-15

    The Business Energy Financing (BEF) program offered commercial businesses in Michigan affordable financing options and other incentives designed to support energy efficiency improvements. We worked through partnerships with Michigan utilities, lenders, building contractors, trade associations, and other community organizations to offer competitive interest rates and flexible financing terms to support energy efficiency projects that otherwise would not have happened. The BEF program targeted the retail food market, including restaurants, grocery stores, convenience stores, and wholesale food vendors, with the goal of achieving energy efficiency retrofits for 2 percent of the target market. We offered low interest rates, flexible payments, easy applications and approval processes, and access to other incentives and rebates. Through these efforts, we sought to help customers strive for energy savings retrofits that would save 20 percent or more on their energy use. This program helped Michigan businesses reduce costs by financing energy efficient lighting, heating and cooling systems, insulation, refrigeration, equipment upgrades, and more. Businesses completed the upgrades with the help of our authorized contractors, and, through our lending partners, we provided affordable financing options.

  8. EERE Success Story-EERE Expertise Helps Los Alamos Achieve Significant

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Savings | Department of Energy Expertise Helps Los Alamos Achieve Significant Energy Savings EERE Success Story-EERE Expertise Helps Los Alamos Achieve Significant Energy Savings May 7, 2013 - 12:00am Addthis The Los Alamos National Laboratory Energy Savings Performance Contract (ESPC) partnership project replaced light fixtures in 28 buildings and installed new HVAC systems in nine buildings. In partnership with an energy service company and DOE, the ESPC project is expected to save

  9. Building Envelope Stakeholder Workshop

    Broader source: Energy.gov [DOE]

    Oak Ridge National Laboratory is hosting a building envelope stakeholder workshop on behalf of the DOE Building Technologies Office.

  10. Residential Buildings Integration Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    April 2, 2013 Residential Buildings Integration Program Building Technologies Office ... Overview of the Residential Integration Program Research Implementation tools ...

  11. Buildings | Open Energy Information

    Open Energy Info (EERE)

    influence a building, including incentives, utilities, weather, climate, and locationground temperature. Municipalities and Renewable Energy Opportunities Building...

  12. Building America Webinar: Resolving Codes and Standards Issues to Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovations | Department of Energy Resolving Codes and Standards Issues to Energy Innovations Building America Webinar: Resolving Codes and Standards Issues to Energy Innovations This webinar provided an overview of how Building America has impacted codes and standards in the past through technical and market innovations. The presenter also described new content on the Building America Solution Center that will help builders meet code requirements and will help code officials apply codes to

  13. NERSC Helps Discover Cosmic Transients

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Discover Cosmic Transients NERSC Helps Discover Cosmic Transients June 15, 2009 M31.png This false-color image of our glowing galactic neighbor, the Andromeda Galaxy, was created by layering 400 individual images captured by the PTF camera in February 2009. In one pointing, the camera has a seven square degree field of view, equivalent to approximately 25 full moons. (Palomar Transient Factory/ Peter Nugent, Berkeley Lab) An innovative new sky survey, called the Palomar Transient Factory (PTF),

  14. Commercial Buildings Energy Consumption Survey - Office Buildings

    Reports and Publications (EIA)

    2010-01-01

    Provides an in-depth look at this building type as reported in the 2003 Commercial Buildings Energy Consumption Survey. Office buildings are the most common type of commercial building and they consumed more than 17% of all energy in the commercial buildings sector in 2003. This special report provides characteristics and energy consumption data by type of office building (e.g. administrative office, government office, medical office) and information on some of the types of equipment found in office buildings: heating and cooling equipment, computers, servers, printers, and photocopiers.

  15. Ohkay Owingeh scientist Denise Thronas helps move CMRR project forward

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    San Miguel County Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue:May 2016 all issues All Issues » submit Ohkay Owingeh scientist Denise Thronas helps move CMRR project forward Finding innovative solutions one piece of equipment at a time November 2, 2015 Denise Thronas and colleague Michael Schappert during a meeting in Los Alamos' Radiological Laboratory and Utility Office Building. Denise Thronas and colleague Michael Schappert

  16. Realizing High-Performance Buildings; NREL (National Renewable Energy Laboratory)

    SciTech Connect (OSTI)

    2015-03-02

    High-performance buildings (HPBs) are exceptional examples of both design and practice. Their energy footprints are small, and these are buildings that people want to work in because of their intelligent structure, operations, and coincident comfort. However, the operation of most buildings, even ones that are properly constructed and commissioned at the start, can deviate significantly from the original design intent over time, particularly due to control system overrides and growing plug and data center loads. With early planning for systems such as submetering and occupant engagement tools, operators can identify and remedy the problems. This guide is a primer for owners and owners’ representatives who are pursuing HPBs. It describes processes that have been successful in the planning, procurement, and operation of HPBs with exceptional energy efficiency. Much of the guidance offered results from a series of semi-structured conference calls with a technical advisory group of 15 owners and operators of prominent HPBs in the United States. The guide provides a prescription for planning, achieving, and maintaining an HPB. Although the guide focuses on the operations stage of buildings, many of the operations practices are specified during the planning stage.

  17. Small Buildings and Small Portfolios

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    tenants - Lack of available sector-specific resources and technologies 5 What are the Opportunities? * Big energy savings * Money back in business owners' pockets * Economic ...

  18. The Role of Energy Storage in Commercial Building

    SciTech Connect (OSTI)

    Kintner-Meyer, Michael CW; Subbarao, Krishnappa; Prakash Kumar, Nirupama; Bandyopadhyay, Gopal K.; Finley, C.; Koritarov, V. S.; Molburg, J. C.; Wang, J.; Zhao, Fuli; Brackney, L.; Florita, A. R.

    2010-09-30

    Motivation and Background of Study This project was motivated by the need to understand the full value of energy storage (thermal and electric energy storage) in commercial buildings, the opportunity of benefits for building operations and the potential interactions between a building and a smart grid infrastructure. On-site or local energy storage systems are not new to the commercial building sector; they have been in place in US buildings for decades. Most building-scale storage technologies are based on thermal or electrochemical storage mechanisms. Energy storage technologies are not designed to conserve energy, and losses associated with energy conversion are inevitable. Instead, storage provides flexibility to manage load in a building or to balance load and generation in the power grid. From the building owner's perspective, storage enables load shifting to optimize energy costs while maintaining comfort. From a grid operations perspective, building storage at scale could provide additional flexibility to grid operators in managing the generation variability from intermittent renewable energy resources (wind and solar). To characterize the set of benefits, technical opportunities and challenges, and potential economic values of storage in a commercial building from both the building operation's and the grid operation's view-points is the key point of this project. The research effort was initiated in early 2010 involving Argonne National Laboratory (ANL), the National Renewable Energy Laboratory (NREL), and Pacific Northwest National Laboratory (PNNL) to quantify these opportunities from a commercial buildings perspective. This report summarizes the early discussions, literature reviews, stakeholder engagements, and initial results of analyses related to the overall role of energy storage in commercial buildings. Beyond the summary of roughly eight months of effort by the laboratories, the report attempts to substantiate the importance of active DOE/BTP R&D activities in this space.

  19. Using an Energy Performance Based Design-Build Process to Procure a Large Scale Low-Energy Building: Preprint

    SciTech Connect (OSTI)

    Pless, S.; Torcellini, P.; Shelton, D.

    2011-05-01

    This paper will review a procurement, acquisition, and contract process of a large-scale replicable net zero energy (ZEB) office building. The owners developed and implemented an energy performance based design-build process to procure a 220,000 ft2 office building with contractual requirements to meet demand side energy and LEED goals. We will outline the key procurement steps needed to ensure achievement of our energy efficiency and ZEB goals. The development of a clear and comprehensive Request for Proposals (RFP) that includes specific and measurable energy use intensity goals is critical to ensure energy goals are met in a cost effective manner. The RFP includes a contractual requirement to meet an absolute demand side energy use requirement of 25 kBtu/ft2, with specific calculation methods on what loads are included, how to normalize the energy goal based on increased space efficiency and data center allocation, specific plug loads and schedules, and calculation details on how to account for energy used from the campus hot and chilled water supply. Additional advantages of integrating energy requirements into this procurement process include leveraging the voluntary incentive program, which is a financial incentive based on how well the owner feels the design-build team is meeting the RFP goals.

  20. DOE Commercial Building Energy Asset Rating: Market Research and Program Direction

    SciTech Connect (OSTI)

    Wang, Na; Taylor, Cody; McCabe, Molly J.

    2012-08-12

    This paper presents the development of a voluntary energy asset rating system, to evaluate the physical characteristics and as-built energy efficiency of new and existing commercial buildings. The energy asset rating system is intended to enable commercial building stakeholders to directly compare expected as-built energy performance among similar buildings and to analyze the potential for capital improvements to increase energy efficiency cost-effectively. Market research has been performed to understand the market demand and how to communicate energy and cost savings to owners, investors, financiers, and others to overcome market barriers and motivate capital investment in building energy efficiency. The paper discusses the findings of the market research. Building owners are concerned about redundancy, conflicting requirements, and cost. They also pointed out a data gap and desire a rating program that identifies improvement opportunities. A meaningful linkage between the energy asset rating and other rating systems is essential. Based on the findings, criteria for a successful energy asset rating program have been developed to direct the program design, including validity of ratings, actionable, cost effective recommendations, effective quality control, integration with other rating systems, and necessary training and education. In addition to the rating system, an asset rating tool is being developed to reduce cost and increase standardization, allowing for consistent and reliable comparisons among and between buildings. The asset rating tool is the first step in the process by which owners can enter information about their building structure and receive information on the buildings modeled performance and recommended efficiency measures.

  1. Implementing Solar Photovoltaic Projects on Historic Buildings and in Historic Districts

    SciTech Connect (OSTI)

    Kandt, A.; Hotchkiss, E.; Walker, A.

    2011-01-01

    Despite a global recession, the number of photovoltaic (PV) installations in the United States grew 30% from 2008 to 2009. A number of trends point toward continued growth of new PV installations. The efficiency of solar panels is increasing, while installation costs are going down. At the same time, federal, state, and local regulations are requiring that greater amounts of energy must come from renewable sources. Incentives for solar power technology implementation are being created and regulatory barriers removed. Corporations and governments are focusing on solar power to demonstrate leadership in environmental sustainability and resource conservation. Architects and builders are including PV arrays as a way to meet green building standards and property owners are seeking PV as a way to reduce their utility bills, as well as their carbon footprints. This publication focuses on the implementation of PV systems on historic properties. Many private property owners, as well as local, state, and national government entities, are seeking guidance on how best to integrate solar PV installations on historic buildings. Historic preservationists maintain that preserving, reusing, and maintaining historic structures is a key sustainable design strategy while also recognizing the importance of accommodating renewable energy technologies where they are appropriate. In some cases, however, conflicts have arisen over the installation of PV panels on historic properties. Addressing these conflicts and providing guidance regarding solutions and best practices is an important step toward resolving or eliminating barriers. Historic properties and districts in the United States provide tangible connections to the nation's past. Thousands of buildings, sites, districts, structures, and objects have been recognized for their historic and architectural significance. Local, state, and national designations of historic properties provide recognition, protection, and incentives that help to preserve those properties for future generations. At the national level, the National Register of Historic Places includes more than 86,000 listings, which encompass a total of more than 1.6 million historic resources. State registers of historic places also provide recognition and protection for historic sites and districts. Locally, more than 2,400 communities have established historic preservation ordinances. Typically implemented through zoning overlays, these local land use regulations manage changes to hundreds of thousands of historic properties. Over a period of 2 years (2007 and 2008) the U.S. Department of Energy (DOE) designated 25 major U.S. cities as Solar America Cities. DOE provided financial and technical assistance to help the cities develop comprehensive approaches to accelerate the adoption of solar energy technologies. The Solar America Cities partnerships represent the foundation of DOE's larger Solar America Communities program. As a part of this program, DOE identified the implementation of solar projects on historic properties and in historic districts as one area to address. A workshop titled 'Implementing Solar Projects on Historic Buildings and in Historic Districts' was held in Denver, Colorado, in June of 2010. Participants included representatives from the solar industry as well as historic preservationists from nonprofit organizations and government agencies at the local, state, and national levels. The workshop provided an opportunity to gain a common understanding of solar technologies and historic preservation procedures and priorities. The workshop participants also discussed some of the challenges involved in locating PV systems on historic properties and identified potential solutions. This publication is based on the discussions that occurred at this workshop and the recommendations that were developed by participants. Ideas expressed by participants in the workshop, and included in this document, do not necessarily reflect the opinion of any government council, agency, or entity.

  2. Building energy analysis tool

    DOE Patents [OSTI]

    Brackney, Larry; Parker, Andrew; Long, Nicholas; Metzger, Ian; Dean, Jesse; Lisell, Lars

    2016-04-12

    A building energy analysis system includes a building component library configured to store a plurality of building components, a modeling tool configured to access the building component library and create a building model of a building under analysis using building spatial data and using selected building components of the plurality of building components stored in the building component library, a building analysis engine configured to operate the building model and generate a baseline energy model of the building under analysis and further configured to apply one or more energy conservation measures to the baseline energy model in order to generate one or more corresponding optimized energy models, and a recommendation tool configured to assess the one or more optimized energy models against the baseline energy model and generate recommendations for substitute building components or modifications.

  3. High-Performance Buildings Value, Messaging, Financial and Policy Mechanisms

    SciTech Connect (OSTI)

    McCabe, Molly

    2011-02-22

    At the request of the Pacific Northwest National Laboratory, an in-depth analysis of the rapidly evolving state of real estate investments, high-performance building technology, and interest in efficiency was conducted by HaydenTanner, LLC, for the U.S. Department of Energy (DOE) Building Technologies Program. The analysis objectives were to evaluate the link between high-performance buildings and their market value to identify core messaging to motivate owners, investors, financiers, and others in the real estate sector to appropriately value and deploy high-performance strategies and technologies across new and existing buildings to summarize financial mechanisms that facilitate increased investment in these buildings. To meet these objectives, work consisted of a literature review of relevant writings, examination of existing and emergent financial and policy mechanisms, interviews with industry stakeholders, and an evaluation of the value implications through financial modeling. This report documents the analysis methodology and findings, conclusion and recommendations. Its intent is to support and inform the DOE Building Technologies Program on policy and program planning for the financing of high-performance new buildings and building retrofit projects.

  4. Table HC3.4 Space Heating Characteristics by Owner-Occupied Housing Unit, 2005

    U.S. Energy Information Administration (EIA) Indexed Site

    .4 Space Heating Characteristics by Owner-Occupied Housing Unit, 2005 Million U.S. Housing Units Total................................................................ 111.1 78.1 64.1 4.2 1.8 2.3 5.7 Do Not Have Space Heating Equipment....... 1.2 0.6 0.3 N Q Q Q Have Main Space Heating Equipment.......... 109.8 77.5 63.7 4.2 1.8 2.2 5.6 Use Main Space Heating Equipment............ 109.1 77.2 63.6 4.2 1.8 2.1 5.6 Have Equipment But Do Not Use It.............. 0.8 0.3 Q N Q Q Q Main Heating Fuel

  5. Energy-Saving Homes, Buildings, and Manufacturing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Saving Homes, Buildings, and Manufacturing Energy-Saving Homes, Buildings, and Manufacturing Buildings Buildings Read more Government Energy Management Government Energy Management Read more Homes Homes Read more Manufacturing Manufacturing Read more The Office of Energy Efficiency and Renewable Energy (EERE) leads a robust community of researchers and other partners to continually develop innovative, cost-effective energy-saving solutions, which helps make our country run better through

  6. Buildings Greenhouse Gas Mitigation Estimator Worksheet | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Buildings Greenhouse Gas Mitigation Estimator Worksheet Buildings Greenhouse Gas Mitigation Estimator Worksheet Excel tool helps agencies estimate the greenhouse gas (GHG) mitigation reduction from implementing energy efficiency measures across a portfolio of buildings. It is designed to be applied to groups of office buildings. For example, at a program level (regional or site) that can be summarized at the agency level. While the default savings and cost estimates apply to office

  7. Unvented Crawlspace Code Adoption - Building America Top Innovation |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Unvented Crawlspace Code Adoption - Building America Top Innovation Unvented Crawlspace Code Adoption - Building America Top Innovation Photo of an unvented and insulated crawlspace. This Top Innovation profile describes Building America research by Building Science Corporation that helped to clarify and contribute to code requirements that allow unvented crawlspaces in new home construction. This is critical because unvented crawlspaces save energy while improving

  8. Building America Update Newsletter Archives | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    America Update Newsletter Archives Building America Update Newsletter Archives The Building America Update is a monthly newsletter from the U.S. Department of Energy's Building America program, which helps to engineer American homes for better energy performance, durability, quality, affordability, and comfort. Find archived editions below, or read the current newsletter issue. You can also subscribe to receive the Building America Update by email. 2015 September 2015 August 2015 July 2015 June

  9. DOE ZERH Webinar: Building Energy Optimization Tool (BEopt) Training |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Building Energy Optimization Tool (BEopt) Training DOE ZERH Webinar: Building Energy Optimization Tool (BEopt) Training The National Renewable Energy Laboratory (NREL) is DOE's primary lab for renewable energy and efficiency R&D. Through the Building America Program, NREL has developed free software to help design and sell cost-effective high-efficiency homes. This webinar will provide an overview of the powerful but easy-to-use BEopt (Building Energy Optimization)

  10. Energy Department Invests $14 Million in Innovative Building Efficiency

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies | Department of Energy Invests $14 Million in Innovative Building Efficiency Technologies Energy Department Invests $14 Million in Innovative Building Efficiency Technologies July 15, 2014 - 1:28pm Addthis The Energy Department today announced up to $14 million in funding for 15 research and development projects to support technologies that will contribute to advancing early-stage, breakthrough energy-efficient solutions for buildings and homes. These projects will help building

  11. Building Panels Protect, Provide Comfort - News Feature | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Building Panels Protect, Provide Comfort October 30, 2009 Walking into a building constructed before the days of heating systems and air conditioning, such as a southwestern adobe, still elicits a sense of comfort and coziness. The concept of using thermal mass in walls to help maintain the temperature of a building is not new. And now, this tried and true method is being used to regulate comfort systems of NREL's Research Support Facilities (RSF), one of the most energy efficient buildings in

  12. Building America Whole-House Solutions for Existing Home: Retrofitting a

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1960s Split-Level Cold-Climate Home | Department of Energy Whole-House Solutions for Existing Home: Retrofitting a 1960s Split-Level Cold-Climate Home Building America Whole-House Solutions for Existing Home: Retrofitting a 1960s Split-Level Cold-Climate Home The U.S. Department of Energy Building America team Consortium for Advanced Residential Buildings (CARB) partnered with Preferred Builders and the owners of a 1960s split-level home in Westport, Connecticut, to evaluate and implement a

  13. Building America

    SciTech Connect (OSTI)

    Brad Oberg

    2010-12-31

    Builders generally use a 'spec and purchase' business management system (BMS) when implementing energy efficiency. A BMS is the overall operational and organizational systems and strategies that a builder uses to set up and run its company. This type of BMS treats building performance as a simple technology swap (e.g. a tank water heater to a tankless water heater) and typically compartmentalizes energy efficiency within one or two groups in the organization (e.g. purchasing and construction). While certain tools, such as details, checklists, and scopes of work, can assist builders in managing the quality of the construction of higher performance homes, they do nothing to address the underlying operational strategies and issues related to change management that builders face when they make high performance homes a core part of their mission. To achieve the systems integration necessary for attaining 40% + levels of energy efficiency, while capturing the cost tradeoffs, builders must use a 'systems approach' BMS, rather than a 'spec and purchase' BMS. The following attributes are inherent in a systems approach BMS; they are also generally seen in quality management systems (QMS), such as the National Housing Quality Certification program: Cultural and corporate alignment, Clear intent for quality and performance, Increased collaboration across internal and external teams, Better communication practices and systems, Disciplined approach to quality control, Measurement and verification of performance, Continuous feedback and improvement, and Whole house integrated design and specification.

  14. Alternative Fuels Data Center: Video Download Help

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Case Studies Printable Version Share this resource Send a link to Alternative Fuels Data Center: Video Download Help to someone by E-mail Share Alternative Fuels Data Center: Video Download Help on Facebook Tweet about Alternative Fuels Data Center: Video Download Help on Twitter Bookmark Alternative Fuels Data Center: Video Download Help on Google Bookmark Alternative Fuels Data Center: Video Download Help on Delicious Rank Alternative Fuels Data Center: Video Download Help on Digg Find More

  15. LANL engineers help New Mexico small businesses

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineers help New Mexico small businesses LANL engineers help New Mexico small businesses Charles Lucero and G. Loren Toole received Principal Investigator Excellence (PIE) Awards...

  16. Industrial Assessment Centers Help Students, Communities Learn...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers Help Students, Communities Learn About Energy Efficiency Industrial Assessment Centers Help Students, Communities Learn About Energy Efficiency March ...

  17. PDF File Information (pbl/help)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Site Help > Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov PDF File Information Many of the documents available on the Power...

  18. Widget:HelpTooltip | Open Energy Information

    Open Energy Info (EERE)

    icon to display (optional, default 'help') Acceptable values: info, help, alert, comment, plus, lightbulb, and more.. Supports all icons featured on Widget:IconContainer, simply...

  19. Helping Policymakers Evaluate Distributed Wind Options | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Helping Policymakers Evaluate Distributed Wind Options Helping Policymakers Evaluate Distributed Wind Options April 18, 2013 - 12:00am Addthis With EERE support, eFormative Options...

  20. Help Desk Assistance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Help Desk Assistance Welcome to HelpDesk Assistance Online at Online Learning Center (OLC) Whether you're looking to discover new learning opportunities, better manage your ...

  1. NERSC Helps Develop Next-Gen Batteries

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NERSC Helps Develop Next-Gen Batteries NERSC Helps Develop Next-Gen Batteries A genomics approach to materials research could speed up advancements in battery performance December ...

  2. MARYLAND HELPS RESIDENTS AND BUSINESSES TO BE SMART | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    MARYLAND HELPS RESIDENTS AND BUSINESSES TO BE SMART MARYLAND HELPS RESIDENTS AND BUSINESSES TO BE SMART MARYLAND HELPS RESIDENTS AND BUSINESSES TO BE SMART While the historic downtowns of cities throughout Maryland are known for their charming mix of quaint shops and picturesque homes, many of the older buildings are not energy efficient. Spurred by these historic commercial centers to launch a statewide energy efficiency campaign, the state's Department of Housing and Community Development

  3. High-performance commercial building facades

    SciTech Connect (OSTI)

    Lee, Eleanor; Selkowitz, Stephen; Bazjanac, Vladimir; Inkarojrit, Vorapat; Kohler, Christian

    2002-06-01

    This study focuses on advanced building facades that use daylighting, sun control, ventilation systems, and dynamic systems. A quick perusal of the leading architectural magazines, or a discussion in most architectural firms today will eventually lead to mention of some of the innovative new buildings that are being constructed with all-glass facades. Most of these buildings are appearing in Europe, although interestingly U.S. A/E firms often have a leading role in their design. This ''emerging technology'' of heavily glazed fagades is often associated with buildings whose design goals include energy efficiency, sustainability, and a ''green'' image. While there are a number of new books on the subject with impressive photos and drawings, there is little critical examination of the actual performance of such buildings, and a generally poor understanding as to whether they achieve their performance goals, or even what those goals might be. Even if the building ''works'' it is often dangerous to take a design solution from one climate and location and transport it to a new one without a good causal understanding of how the systems work. In addition, there is a wide range of existing and emerging glazing and fenestration technologies in use in these buildings, many of which break new ground with respect to innovative structural use of glass. It is unclear as to how well many of these designs would work as currently formulated in California locations dominated by intense sunlight and seismic events. Finally, the costs of these systems are higher than normal facades, but claims of energy and productivity savings are used to justify some of them. Once again these claims, while plausible, are largely unsupported. There have been major advances in glazing and facade technology over the past 30 years and we expect to see continued innovation and product development. It is critical in this process to be able to understand which performance goals are being met by current technology and design solutions, and which ones need further development and refinement. The primary goal of this study is to clarify the state-of-the-art of the performance of advanced building facades so that California building owners and designers can make informed decisions as to the value of these building concepts in meeting design goals for energy efficiency, ventilation, productivity and sustainability.

  4. Voluntary Green Building Standards for Public Buildings

    Broader source: Energy.gov [DOE]

    NOTE: The program described below is a voluntary program that encourages state agencies to consider using green building standard. The State of Alabama does not have mandatory Green Building...

  5. Building America Webinar: Ventilation in Multifamily Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ventilation strategies for multifamily buildings, including how to successfully implement those strategies through smart design, specification, and construction techniques. ...

  6. Building Energy Codes Program Logic Model

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    provide funding to help measure & improve code compliance The Building Energy Codes Program aims to "lock in" savings from energy codes by participating in code development processes and supporting local and state governments in the adoption and implementation of progressively more advanced building energy codes across the country. External Influences: DOE budget, Construction industry, Real estate market, State/local policies & budget Objectives Activities / Partners Outputs

  7. Office Buildings: Consumption Tables

    U.S. Energy Information Administration (EIA) Indexed Site

    and Type of Office Building Total (trillion Btu) per Building (million Btu) per Square Foot (thousand Btu) Dollars per Million Btu All Office Buildings 1,089 1,475 90.5 16.32...

  8. Building Energy Code

    Broader source: Energy.gov [DOE]

    In 2006 Iowa enacted H.F. 2361, requiring the State Building Commissioner to adopt energy conservation requirements based on a nationally recognized building energy code. The State Building Code...

  9. 324 Building - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    300 Area 324 Building 325 Building 400 AreaFast Flux Test Facility 618-10 and 618-11 Burial Grounds 700 Area B Plant B Reactor C Reactor Canister Storage Building and Interim ...

  10. 325 Building - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    300 Area 324 Building 325 Building 400 AreaFast Flux Test Facility 618-10 and 618-11 Burial Grounds 700 Area B Plant B Reactor C Reactor Canister Storage Building and Interim ...

  11. Types of Lighting in Commercial Buildings - Building Size and...

    U.S. Energy Information Administration (EIA) Indexed Site

    commercial buildings. Note: Data are for non-mall buildings. Source: Energy Information Administration, 2003 Commercial Buildings Energy Consumption Survey. Office buildings and...

  12. Building America Top Innovations Hall of Fame Profile - Building...

    Energy Savers [EERE]

    Building America Top Innovations Hall of Fame Profile - Building Energy Optimization Analysis Method (BEopt) Building America Top Innovations Hall of Fame Profile - Building Energy...

  13. Commercial Building Loads Providing Ancillary Services in PJM

    SciTech Connect (OSTI)

    MacDonald, Jason; Kiliccote, Sila; Boch, Jim; Chen, Jonathan; Nawy, Robert

    2014-06-27

    The adoption of low carbon energy technologies such as variable renewable energy and electric vehicles, coupled with the efficacy of energy efficiency to reduce traditional base load has increased the uncertainty inherent in the net load shape. Handling this variability with slower, traditional resources leads to inefficient system dispatch, and in some cases may compromise reliability. Grid operators are looking to future energy technologies, such as automated demand response (DR), to provide capacity-based reliability services as the need for these services increase. While DR resources are expected to have the flexibility characteristics operators are looking for, demonstrations are necessary to build confidence in their capabilities. Additionally, building owners are uncertain of the monetary value and operational burden of providing these services. To address this, the present study demonstrates the ability of demand response resources providing two ancillary services in the PJM territory, synchronous reserve and regulation, using an OpenADR 2.0b signaling architecture. The loads under control include HVAC and lighting at a big box retail store and variable frequency fan loads. The study examines performance characteristics of the resource: the speed of response, communications latencies in the architecture, and accuracy of response. It also examines the frequency and duration of events and the value in the marketplace which can be used to examine if the opportunity is sufficient to entice building owners to participate.

  14. Buildings Performance Database Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Overview Buildings.energy.gov/BPD BuildingsPerformanceDatabase@ee.doe.gov 2 * The BPD statistically analyzes trends in the energy performance and physical & operational characteristics of real commercial and residential buildings. The Buildings Performance Database 3 Design Principles * The BPD contains actual data on existing buildings - not modeled data or anecdotal evidence. * The BPD enables statistical analysis without revealing information about individual buildings. * The BPD cleanses

  15. U.S. Team Green Building Challenge 2002

    SciTech Connect (OSTI)

    Not Available

    2002-09-01

    Flier about the U.S. Team and its projects participating in the International Green Building Challenge. Along with many other countries, the United States accepted the Green Building Challenge (GBC), an international effort to evaluate and improve the performance of buildings worldwide. GBC started out in 1996 as a competition to determine which country had the greenest buildings; it evolved into a cooperative process among the countries to measure the performance of green buildings. Although the auto industry can easily measure efficiency in terms of miles per gallon, the buildings industry has no standard way to quantify energy and environmental performance. The Green Building Challenge participants hope that better tools for measuring the energy and environmental performance of buildings will be an outcome of their efforts and that these tools will lead to higher and better performance levels in buildings around the world. The ultimate goal is to design, construct, and operate buildings that contribute to global sustainability by conserving and/or regenerating natural resources and minimizing nonrenewable energy use. The United States' Green Building Challenge Team '02 selected five buildings from around the country to serve as case studies; each of the five U.S. building designs (as well as all international case studies) were assessed using an in-depth evaluation tool, called the Green Building Assessment Tool (GBTool). The GBTool was specifically created and refined by international teams, for the GBC efforts. The goal of this collaborative effort is to improve this evaluation software tool so that it can be used globally, while taking into account regional and national conditions. The GBTool was used by the U.S. Team to assess and evaluate the energy and environmental performance of these five buildings: (1) Retail (in operation): BigHorn Home Improvement Center, Silverthorne, Colorado; (2) Office (in operation), Philip Merrill Environmental; (3) School (in construction), Clearview Elementary School, Hanover, Pennsylvania; (4) Multi-family residential (in construction), Twenty River Terrace, Battery Park City, New York; and (5) Office/lab (in design), National Oceanic Atmospheric Administration, Honolulu, Hawaii. These projects were selected, not only because they were good examples of high-performance buildings and had interested owners/design team members, but also because building data was available as inputs to test the software tool. Both the tool and the process have been repeatedly refined and enhanced since the first Green Building Challenge event in 1998; participating countries are continuously providing feedback to further improve the tool and global process for the greatest positive effect.

  16. Research and Development Needs for Building-Integrated Solar Technologies

    SciTech Connect (OSTI)

    none,

    2014-01-01

    The Building Technologies Office (BTO) has identified Building Integrated Solar Technologies (BIST) as a potentially valuable piece of the comprehensive pathway to help achieve its goal of reducing energy consumption in residential and commercial buildings by 50% by the year 2030. This report helps to identify the key research and development (R&D) needs that will be required for BIST to make a substantial contribution toward that goal. BIST include technologies for space heating and cooling, water heating, hybrid photovoltaic-thermal systems (PV/T), active solar lighting, and building-integrated photovoltaics (BIPV).

  17. Fire victim helped by area programs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fire victim helped by area programs Fire victim helped by local nonprofit organizations A perennial helper, didn't realize that she might someday need help herself. April 3, 2012 Beatrice Dubois is grateful for the help she received from Lab-supported Beatrice Dubois is grateful for the help she received from Lab-supported, local nonprofits during her time of need. Contact Kathy Keith Community Relations & Partnerships (505) 665-4400 Email Beatrice Dubois, dedicated fundraiser, assisted

  18. Building Energy Code

    Broader source: Energy.gov [DOE]

    The California Building Standards Commission (BSC) is responsible for administering California's building standards adoption, publication, and implementation. Since 1989, the BSC has published tr...

  19. NREL: Buildings Research - Facilities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    building technologies and innovations that deliver significant energy savings in buildings, and the new facilities further extend those capabilities. In addition, the NREL...

  20. Office Buildings - Full Report

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  1. Building America Solution Center

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Android app - iOS app (Apple) * Building Science Publications feature fully populated ... * Building America review 2012 Design * Web tool platform built using Drupal * Taxonomy ...

  2. Commercial Building Partnership

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    goals: - show that 50% savings in new construction and 30% savings in existing buildings ... level of savings standard practice Brief History 3 | Building Technologies Office ...

  3. Model Building Energy Code

    Broader source: Energy.gov [DOE]

    The Energy Efficiency Building Performance Standards (EEBPS) are statewide minimum requirements that all new construction and additions to existing buildings must satisfy. Exceptions include...

  4. Building-Level Intensities

    U.S. Energy Information Administration (EIA) Indexed Site

    . Electricity Consumption and Expenditure Intensities for Non-Mall Buildings, 2003" ,"Electricity Consumption",,,,,,"Electricity Expenditures" ,"per Building (thousand kWh)","per...

  5. Buildings | Open Energy Information

    Open Energy Info (EERE)

    work, live, learn, govern, heal, worship, and play in buildings-and they require enormous energy resources. Related Links Buildings Gateway Retrieved from "http:en.openei.orgw...

  6. Commercial Buildings Integration Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Buildings Integration Program Arah Schuur Program Manager arah.schuur@ee.doe.gov April 2, ... Commercial Buildings Integration Program Mission Accelerate voluntary uptake of ...

  7. Better Buildings Workforce Activities

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BETTER BUILDINGS WORKFORCE ACTIVITIES Benjamin Goldstein, Better Buildings Workforce Project Manager, U.S. Department of Energy April 24, 2014 Housekeeping and Overview 1) ...

  8. Building Energy Codes

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...Impacts * Priorities for FY15 and Beyond 2 Building Energy Codes - Mission Support the building energy code and standard development, adoption, implementation and enforcement ...

  9. Building Energy Code

    Broader source: Energy.gov [DOE]

    Public Act 093-0936 (Illinois Energy Conservation Code for Commercial Buildings) was signed into law in August, 2004. The Illinois Energy Conservation Code for Commercial Buildings became...

  10. Food Sales Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    Sales Characteristics by Activity... Food Sales Food sales buildings are buildings that are used for retail or wholesale sale of food. Basic Characteristics See also: Equipment |...

  11. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Connecticut Office of the State Building Inspector establishes and enforces building, electrical, mechanical, plumbing and energy code requirements by reviewing, developing, adopting and...

  12. Office Buildings - Energy Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Consumption Office buildings consumed more than 17 percent of the total energy used by the commercial buildings sector (Table 4). At least half of total energy, electricity,...

  13. Buildings Performance Database

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    * Enable public access to general statistical information about buildings, without ... of real buildings. * The BPD enables statistical analysis without revealing information ...

  14. Building Technologies Program Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewable Energy Building Technologies Program Jerry Dion Acting Program Manager Building Technologies Program State Energy Advisory Board Meeting October 17, 2007 The investment ...

  15. Energy Efficiency and Conservation Block Grant (EECBG)- Better Buildings Neighborhood Program Final Report

    SciTech Connect (OSTI)

    Brown, Donisha; Harris, Barbara; Blue, Cynthia; Gaskins, Charla

    2014-09-16

    The original BetterBuildings for Greensboro grant program included an outreach campaign to inform 100% of the Greensboro community about the benefits of reducing energy use; a plan to reduce energy consumption in at least 34% of the homes and 10% of the other buildings in the east Greensboro target area; and a plan to create and retain jobs in the energy conservation industry. Under the original program structure the City of Greensboro planned to partner with local and regional lenders to create a diversified portfolio of loan products to meet the needs of various income levels and building types. All participants would participate in the loan programs as a method of meeting the program’s 5 to1 private capital match/leverage requirements. In June 2011 the program was restructured to include partnerships with large commercial and multifamily projects, with these partners providing the greater portion of the required match/leverage. The geographic focus was revised to include reducing energy consumption across the entire City of Greensboro, targeting neighborhoods with high concentrations of low-moderate income households and aged housing stock. The community outreach component used a neighborhood-based approach to train community residents and volunteers to conduct door-to-door neighborhood sweeps; delivered high quality information on available program resources; helped residents to evaluate alternative energy efficiency measures and alternative financing sources; assisted with contractor selections and monitoring/evaluation of work; coordinated activities with BetterBuildings program partners; and collected data required by the Department of Energy. Additionally, HERO (Home Energy Response Officers) delivered intro packages (energy efficiency information and products) to thousands of households at the initial point of contact. A pilot program (Early Adopters) was offered from March 1, 2011 through June 30, 2011. The Early Adopters program was designed to offer immediate assistance to property owners ready and able to make their homes more energy efficient, by offering a rebate on their energy assessment and on the cost of upgrades installed. Eligible energy efficient upgrades were inclusive of basic level insulating and weather-stripping, HVAC system and water heater upgrades, to whole home upgrades that include the replacement of windows, doors and appliances. Renewable energy systems such as solar hot water systems were also eligible for the rebate program.

  16. 1999 CBECS Principal Building Activities

    U.S. Energy Information Administration (EIA) Indexed Site

    Data Reports > 2003 Building Characteristics Overview A Look at Building Activities in the 1999 Commercial Buildings Energy Consumption Survey The Commercial Buildings Energy...

  17. Federal Buildings Supplemental Survey -- Overview

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings The Federal Buildings Supplemental Survey 1993 provides building-level energy-related characteristics for a special sample of commercial buildings owned by the...

  18. Health Care Buildings: Equipment Table

    U.S. Energy Information Administration (EIA) Indexed Site

    Equipment Table Buildings, Size and Age Data by Equipment Types for Health Care Buildings Number of Buildings (thousand) Percent of Buildings Floorspace (million square feet)...

  19. Better Buildings Webinar: Making Utility Energy Efficiency Funds Work for You

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy's Better Buildings will host a webinar on innovative collaborations with utilities to bring big energy savings to their building portfolios and help reduce utility peak electricity demand.

  20. Building America Best Practices Series, Volume 7.2: Guide to Determining Climate Regions by County

    Broader source: Energy.gov [DOE]

    This report describes the climate zone designations used by the U.S. Department of Energy Building America Program, and is intended to help builders to identify the appropriate climate designation for the counties in which they are building.

  1. EPA ENERGY STAR Webcast: ENERGY STAR and Green Building Rating Systems

    Broader source: Energy.gov [DOE]

    During this session, attendees will learn how to use EPA tools and resources to help meet requirements for green building rating systems such as the U.S. Green Building Council’s Leadership in...

  2. CNG and Fleets: Building Your Business Case

    SciTech Connect (OSTI)

    2015-09-01

    Two online resources help fleets evaluate the economic soundness of a compressed natural gas program. The National Renewable Energy Laboratory's (NREL's) Vehicle Infrastructure and Cash-Flow Evaluation (VICE 2.0) model and the accompanying report, Building a Business Case for Compressed Natural Gas in Fleet Applications, are uniquely designed for fleet managers considering an investment in CNG and can help ensure wise investment decisions about CNG vehicles and infrastructure.

  3. Buildings GHG Mitigation Estimator Worksheet, Version 1

    Broader source: Energy.gov [DOE]

    Xcel document describes Version 1 of the the Buildings GHG Mitigation Estimator tool. This tool assists federal agencies in estimating the greenhouse gas mitigation reduction from implementing energy efficiency measures across a portfolio of buildings. It is designed to be applied to groups of office buildings, for example, at a program level (regional or site) that can be summarized at the agency level. While the default savings and cost estimates apply to office buildings, users can define their own efficiency measures, costs, and savings estimates for inclusion in the portfolio assessment. More information on user-defined measures can be found in Step 2 of the buildings emission reduction guidance. The output of this tool is a prioritized set of activities that can help the agency to achieve its greenhouse gas reduction targets most cost-effectively.

  4. Measure Guideline: Steam System Balancing and Tuning for Multifamily Residential Buildings

    SciTech Connect (OSTI)

    Choi, J.; Ludwig, P.; Brand, L.

    2013-04-01

    This report was written as a resource for professionals involved in multifamily audits, retrofit delivery, and program design, as well as for building owners and contractors. It is intended to serve as a guide for those looking to evaluate and improve the efficiency and operation of one-pipe steam heating systems. In centrally heated multifamily buildings with steam or hydronic systems, the cost of heat for tenants is typically absorbed into the owner's operating costs. Highly variable and rising energy costs have placed a heavy burden on landlords. In the absence of well-designed and relevant efficiency efforts, increased operating costs would be passed on to tenants who often cannot afford those increases. Misinvestment is a common problem with older heating systems -- multiple contractors may inadequately or inappropriately upgrade parts of systems and reduce system functionality and efficiency, or the system has not been properly maintained.

  5. Better Buildings Challenge Partners Exceed $1.3 Billion in Energy Cost

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Savings, Share Hundreds of Solutions to Help Spur Future Efficiency Efforts | Department of Energy Better Buildings Challenge Partners Exceed $1.3 Billion in Energy Cost Savings, Share Hundreds of Solutions to Help Spur Future Efficiency Efforts Better Buildings Challenge Partners Exceed $1.3 Billion in Energy Cost Savings, Share Hundreds of Solutions to Help Spur Future Efficiency Efforts May 11, 2016 - 9:21am Addthis Better Buildings Challenge Partners Exceed $1.3 Billion in Energy Cost

  6. Safety Evaluation Report related to Hydrogen Control Owners Group assessment of Mark 3 containments

    SciTech Connect (OSTI)

    Li, C.Y.; Kudrick, J.A.

    1990-10-01

    Title 10 of the Code of Federal Regulations (10 CFR), Section 50.44 Standards for Combustible Gas Control System in Light-Water-Cooled Power Reactors,'' requires that systems be provided to control hydrogen concentration in the containment atmosphere following an accident to ensure that containment integrity is maintained. The purpose of this report is to provide regulatory guidance to licensees with Mark III containments with regard to demonstrating compliance with 10 CFR 50.44, Section (c)(3)(vi) and (c)(3)(vii). In this report, the staff provides its evaluation of the generic methodology proposed by the Hydrogen Control Owners Group. This generic methodology is documented in Topical Report HGN-112-NP, Generic Hydrogen Control Information for BWR/6 Mark III Containments.'' In addition, the staff has recommended that the vulnerability to interruption of power to the hydrogen igniters be evaluated further on a plant-specific basis as part of the individual plant examination of the plants with Mark III containments. 10 figs., 1 tab.

  7. Building America Top Innovations 2013 Profile … Window Replacement, Rehabilitation, & Repair Guide

    Energy Savers [EERE]

    Window Replacement, Rehabilitation, & Repair Guide TOP INNOVATOR: BSC Old single-glazed windows have such low thermal resistance that their effect on the overall thermal resistance of the walls can be staggering. Building America recommends several ways to improve the performance of existing windows at varying price points. Owners of older homes who want to improve their homes' efficiency often conclude that window replacement is a necessary first step. They are right that windows can be a

  8. Events | Buildings | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Events Below are upcoming events related to buildings research. No current events have been scheduled

  9. Better Buildings Neighborhood Program

    Broader source: Energy.gov [DOE]

    U.S. Department of Energy Better Buildings Neighborhood Program: Business Models Guide, October 27, 2011.

  10. Passive Energy Building Design Tool

    Energy Science and Technology Software Center (OSTI)

    1994-11-01

    SOLAR5 is a computer aided design tool to help architects design better, more energy efficient buildings. It is intended for use at the beginning of the design process. To get started, only four pieces of information are necessary to compute the energy needed: the square footage, the number of stories, the kind of building (such as school, home, hotel, or any one of 20 types), and its location (the program stores the temperature ranges formore » fourty major cities). Additional information may be given later to fine tune the design. An expert system using heuristics from a wide range of sources, automatically creates a passive solar baseline building from the four facts specified for that project. By modifying and adapting prior designs the user can create and work upon as many as nine schemes simultaneously. SOLAR5 can analyze the buildings thermal performance for each hour of each month and plot its total heat gain or loss as a three-dimensional surface. After reading the plot, the user can immediately redesign the building and rerun the analysis. Separate heat gain/loss surfaces can be plotted for each of the different parts of the building or schemes that add together to make up the total, including walls, roof, windows, skylights, floor, slab on grade, people, lights, equipment, and infiltration. Two different schemes can be instantly compared by asking for a three-dimensional plot showing only the difference in their performances. The objective of SOLAR5 is to allow the designer to make changes easily and quickly with detailed instantaneous pictorial feedback of the implications of the change.« less

  11. Building an All-of-the-Above Portfolio with Loan Guarantees for...

    Broader source: Energy.gov (indexed) [DOE]

    play in helping to build a strong U.S. nuclear power industry for the future before a ... thermal efficiency, modularized construction, safety systems, and standardized design. ...

  12. A Utility Regulators Guide to Data Access for Commercial Building Energy Performance Benchmarking

    SciTech Connect (OSTI)

    Existing Commercial Buildings Working Group

    2013-05-23

    Offers policy options and considerations to state utility commissions in providing access to energy use data to help commercial customers manage energy costs through building energy benchmarking.

  13. Building America Best Practices Series Volume 16: 40% Whole-House...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This guide book is a resource to help builders design and construct highly energy-efficient homes, while addressing building durability, indoor air quality, and occupant health, ...

  14. Building America Best Practices Series Volume 15: 40% Whole-House...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This guide book is a resource to help builders design and construct highly energy-efficient homes, while addressing building durability, indoor air quality, and occupant health, ...

  15. Energy Department Invests to Save Small Buildings Money by Saving Energy

    Broader source: Energy.gov [DOE]

    The Energy Department announced an award of $10 million for six projects to help small commercial buildings save money by saving energy

  16. DOE Dunking Booth Helps Paducah Charities

    Broader source: Energy.gov [DOE]

    PADUCAH, KY – The Department of Energy (DOE) and its Paducah contractors have raised nearly $1,100 to help restock the shelves of six Paducah service organizations that help the hungry.

  17. SC e-journals Help page

    Office of Scientific and Technical Information (OSTI)

    Need Help With Searching? 'Web of Science' Search: The Web of Science search link takes ... Detailed search information is provided on the Web of Science Help page. General Search ...

  18. Federal Energy Management: Helping Agencies Achieve Savings ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    agencies shift their behavior to help save energy and resources now and for the long-term. ... and expertise FEMP offers to help federal agencies achieve their energy management goals. ...

  19. Buildings Energy Data Book

    Buildings Energy Data Book [EERE]

    Current and Past EditionsGlossaryPopular TablesQuery Tools Contact Us Search What Is the Buildings Energy Data Book? The Data Book includes statistics on residential and commercial building energy consumption. Data tables contain statistics related to construction, building technologies, energy consumption, and building characteristics. The Building Technologies Program within the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy developed this resource to provide a

  20. Buildings Energy Data Book

    Buildings Energy Data Book [EERE]

    4.1 Federal Buildings Energy Consumption 4.2 Federal Buildings and Facilities Characteristics 4.3 Federal Buildings and Facilities Expenditures 4.4 Legislation Affecting Energy Consumption of Federal Buildings and Facilities 5Envelope and Equipment 6Energy Supply 7Laws, Energy Codes, and Standards 8Water 9Market Transformation Glossary Acronyms and Initialisms Technology Descriptions Building Descriptions Other Data Books Biomass Energy Transportation Energy Power Technologies Hydrogen Download

  1. Buildings Energy Data Book

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Type Definition Includes These Sub-Categories from 2003 CBECS Questionnaire Education Buildings used for academic or technical classroom instruction, such as elementary, middle, or high schools, and classroom buildings on college or university campuses. Buildings on education campuses for which the main use is not classroom are included in the category relating to their use. For example, administration buildings are part of "Office", dormitories are "Lodging", and

  2. Building Awards | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Building Awards NREL's high-performance buildings are sustainability models for the use of energy efficiency and renewable energy technologies. Each building on NREL's South Table Mountain campus is designed to meet the Gold or Platinum standards of the U.S. Green Building Council's Leadership in Energy and Environmental Design (LEED®) program. Find information about awards for NREL's exceptional buildings below. Energy Systems Integration Facility Energy Systems Integration Facility 2014

  3. High Performance Home Building Guide for Habitat for Humanity Affiliates

    SciTech Connect (OSTI)

    Lindsey Marburger

    2010-10-01

    This guide covers basic principles of high performance Habitat construction, steps to achieving high performance Habitat construction, resources to help improve building practices, materials, etc., and affiliate profiles and recommendations.

  4. OpenStudio: Building Design Expertise at Your Fingertips

    Broader source: Energy.gov [DOE]

    The newest version of the OpenStudio Application Suite and Development Platform developed by the National Renewable Energy Laboratory helps architects and engineers model whole-building energy use.

  5. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and targeted programs to help its customers achieve their energy saving goals. The Building Tune-Up Program offers owners of... Eligibility: Commercial, Industrial, Nonprofit,...

  6. Savings by Design (Offered by five Utilities)

    Broader source: Energy.gov [DOE]

    In conjunction with the California Department of Public Utilities, Savings by Design offers services and incentives to help owners and designers of commercial buildings raise energy performance....

  7. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    with the California Department of Public Utilities, Savings by Design offers services and incentives to help owners and designers of commercial buildings raise energy...

  8. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    PSE also offers flexible and targeted programs to help its customers achieve their energy saving goals. The Building Tune-Up Program offers owners of... Eligibility: Commercial,...

  9. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Utilities) In conjunction with the California Department of Public Utilities, Savings by Design offers services and incentives to help owners and designers of commercial buildings...

  10. Help Desk Assistance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Help Desk Assistance Help Desk Assistance Welcome to HelpDesk Assistance Online at Online Learning Center (OLC)! Whether you're looking to discover new learning opportunities, better manage your career, request external training or connect your employees with the learning they need, OLC provides new features and services to help. Fulfill your training needs with ease and save money on travel and training costs Explore the enhanced catalog and complete a course at your own pace to stay abreast in

  11. Benchmarking Buildings to Prioritize Sites for Emissions Analysis

    Broader source: Energy.gov [DOE]

    When actual energy use by building type is known, benchmarking the performance of those buildings to industry averages can help establish those with greatest opportunities for GHG reduction. Energy intensity can be used as a basis for benchmarking by building type and can be calculated using actual energy use, representative buildings, or available average estimates from agency energy records. Energy intensity should be compared to industry averages, such as the Commercial Buildings Energy Consumption Survey (CBECS) or an agency specific metered sample by location.

  12. Building America Building Science Education Roadmap

    Energy Savers [EERE]

    ... (district heating and cooling, landfill gas generation, etc.) 14. Putting it all ... building performance to financing and insurance: e.g. energy improvement mortgages ...

  13. 1999 Commercial Buildings Characteristics--Principal Building...

    U.S. Energy Information Administration (EIA) Indexed Site

    contact the National Energy Information Center at (202) 586-8800. Energy Information Administration Commercial Buildings Energy Consumption Survey Differences between the...

  14. Building Green in Greensburg: City Hall Building

    Broader source: Energy.gov [DOE]

    This poster highlights energy efficiency, renewable energy, and sustainable features of the high-performing City Hall building in Greensburg, Kansas.

  15. Building Green in Greensburg: Business Incubator Building

    Broader source: Energy.gov [DOE]

    This poster highlights energy efficiency, renewable energy, and sustainable features of the high-performing SunChips Business Incubator building in Greensburg, Kansas.

  16. Building America: Bringing Building Innovations to Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy America: Bringing Building Innovations to Market Building America: Bringing Building Innovations to Market New Building America Fact Sheet Highlights Program New Building America Fact Sheet Highlights Program Read more Building America Research-to-Market Plan Released Building America Research-to-Market Plan Released Read the plan that will guide Building America's research and development activities over the coming years. Read more Building America Projects Focus on Building

  17. Building America - Resources for Energy Efficient Homes

    SciTech Connect (OSTI)

    2012-04-19

    Building America publications help builders achieve whole-house energy savings in five major climate zones. Using the recommendation and process improvements outlined in the Best Practices Series handbooks, builders can re-engineer their designs to improve energy performance and quality. Case studies for new and existing homes provide results from actual projects.

  18. Building Technologies Program Vision, Mission, and Goals

    SciTech Connect (OSTI)

    2011-12-15

    The Vision, Mission, and Goals of the Building Technologies Program (BTP) focus on short term energy efficiency outcomes such as improved economic environment, enhanced comfort, and affordability that collectively benefit our nation. Long-term goals focus on helping secure our nation's energy independence.

  19. Building International Emergency Management Systems | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Building International Emergency Management Systems NNSA helps nations develop the core elements of an emergency response program. Based on preliminary discussions with counterparts, NNSA develops emergency management programs with partner nations to exchange views and enhance development of effective emergency management systems. Generally, NNSA will assist foreign governments and international organizations with integration of emergency-program core elements,

  20. Building Energy Monitoring Software Aids Native Alaskan Villages |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Building Energy Monitoring Software Aids Native Alaskan Villages Building Energy Monitoring Software Aids Native Alaskan Villages March 9, 2016 - 1:08pm Addthis Energy Department financial support for Alaska is helping remote facilities like the Toksook Bay Well House to identify critical savings opportunities with energy monitoring software. Toksook Bay has a population of about 600. Energy Department financial support for Alaska is helping remote facilities like the

  1. 3 Innovations That Are Transforming America's Home Building Industry |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Innovations That Are Transforming America's Home Building Industry 3 Innovations That Are Transforming America's Home Building Industry December 12, 2013 - 3:07pm Addthis A worker caulks the exterior of a home window. Advanced window framing techniques can help homeowners save energy and money. | Photo courtesy of Weatherization Assistance Program Technical Center A worker caulks the exterior of a home window. Advanced window framing techniques can help homeowners save

  2. Development of whole-building energy design targets for commercial buildings: Phase 1, Planning: Volume 2, Technical report

    SciTech Connect (OSTI)

    Crawley, D.B.; Briggs, R.S.; Jones, J.W.; Seaton, W.W.; Kaufman, J.E.; Deringer, J.J.; Kennett, E.W.

    1987-08-01

    This is the second volume of the Phase 1 report and discusses the 10 tasks performed in Phase 1. The objective of this research is to develop a methodology for setting energy design targets to provide voluntary guidelines for the buildings industry. The whole-building energy targets project is being conducted at the Pacific Northwest Laboratory (PNL) for the US Department of Energy (DOE) to encourage the construction of energy-efficient buildings by informing designers and owners about cost-effective goals for energy use in new commercial buildings. The outcome of this research will be a flexible methodology for setting such targets. The tasks are listed and discussed in this report as follows: Task 1 - Develop Detailed Project Goals and Objectives; Task 2 - Establish Buildings-Industry Liaison; Task 3 - Develop Approaches to the Energy Targets Model, Building Operations, and Climate; Task 4 - Develop an Approach for Treating Economic Considerations; Task 5 - Develop an Approach for Treating Energy Sources; Task 6 - Collect Energy-Use Data; Task 7 - Survey Energy Expert Opinion; Task 8 - Evaluation Procedure Specification and Integration; Task 9 - Phase 1 Report Development; and Task 10 - Phase 1 Review Planning.

  3. Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City

    Broader source: Energy.gov [DOE]

    Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City, a publication of the U.S. Department of Energy's Better Buildings Program.

  4. NREL Helps Greensburg, KS Launch GreenHome Partnership - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Helps Greensburg, KS Launch GreenHome Partnership KBIA's partnership with Greensburg is a model for communities needing to rebuild April 28, 2009 The U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL), in collaboration with the City Council of Greensburg, Kansas, and the Kansas Building Industry Association (KBIA), announce the launch of Greensburg GreenHome Residential Green Building Program. Greensburg GreenHome is a voluntary program with KBIA and supported

  5. Analysis of the Russian Market for Building Energy Efficiency

    SciTech Connect (OSTI)

    Lychuk, Taras; Evans, Meredydd; Halverson, Mark A.; Roshchanka, Volha

    2012-12-01

    This report provides analysis of the Russian energy efficiency market for the building sector from the perspective of U.S. businesses interested in exporting relevant technologies, products and experience to Russia. We aim to help U.S. energy efficiency and environmental technologies businesses to better understand the Russian building market to plan their market strategy.

  6. DOE's Public Database for Green Building Case Studies: Preprint

    SciTech Connect (OSTI)

    Torcellini, P. A.; Crawley, D. B.

    2003-11-01

    To help capture valuable information on''green building'' case studies, the U.S. Department of Energy has created an online database for collecting, standardizing, and disseminating information about high-performance, green projects. Type of information collected includes green features, design processes, energy performance, and comparison to other high-performance, green buildings.

  7. Forward Thinking of Employees at Hanford Site Helps in Accelerated Cleanup

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Forward Thinking of Employees at Hanford Site Helps in Accelerated Cleanup Forward Thinking of Employees at Hanford Site Helps in Accelerated Cleanup April 27, 2016 - 12:15pm Addthis An ancillary building in the H Reactor Area is among many in the soil and groundwater program that was demolished ahead of schedule. An ancillary building in the H Reactor Area is among many in the soil and groundwater program that was demolished ahead of schedule. RICHLAND, Wash. - EM's

  8. Workplace Charging Credit for Green Building Certification | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Credit for Green Building Certification Workplace Charging Credit for Green Building Certification Employers across the country are widely using green building practices to obtain independent green certifications Organizations seeking to meet the interests of clients, employees, and the market are undertaking new sustainability practices every year. Installing workplace charging for plug-in electric vehicles (PEVs) demonstrates a commitment to sustainability efforts and can help

  9. Milwaukee Showcases Leadership in Energy Efficiency, Better Buildings

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Challenge | Department of Energy Showcases Leadership in Energy Efficiency, Better Buildings Challenge Milwaukee Showcases Leadership in Energy Efficiency, Better Buildings Challenge November 6, 2013 - 9:30am Addthis News Media Contact (202) 586-4940 WASHINGTON - As part of the Obama Administration's efforts to double energy productivity by 2030, the Energy Department today recognized the city of Milwaukee, Wis., for its leadership in the Department's Better Buildings Challenge - helping the

  10. Joseph Vance Building, The

    High Performance Buildings Database

    Seattle, WA In 2006, the Rose Smart Growth Investment Fund acquired the historic Joseph Vance Building with the purpose of transforming it into "the leading green and historic class B" building in the marketplace. The terra cotta Vance Building was constructed in 1929 and has 14 floors - 13 floors of offices over ground-floor retail with a basement for mechanical equipment and storage. In 2009 the U.S. Green Building Council (USGBC) awarded the Vance Building LEED for Existing Buildings (EB) Gold certification.

  11. Building Performance Database

    Broader source: Energy.gov [DOE]

    The Building Performance Database (BPD) unlocks the power of building data by providing access to the largest publicly-available dataset of information about the physical and operational characteristics of real buildings. The BPD enables users to perform statistical analysis on an anonymous dataset of hundreds of thousands of commercial and residential buildings from across the country. Users can examine specific building types and geographic areas, compare performance trends among similar buildings, identify and prioritize cost-saving energy efficiency improvements, and assess the range of likely savings from these improvements.

  12. Advanced Energy Design Guides Slash Energy Use in Schools and Retail Buildings by 50% (Fact Sheet), NREL Highlights, Research & Development, NREL (National Renewable Energy Laboratory)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Results Achievement NREL's Commercial Buildings Group executed advanced energy modeling simulations and optimized the design of schools and retail buildings to develop recommendations that result in 50% energy savings over code. NREL developed the simulation tools and led the committee that produced the guides. Key Result The Advanced Energy Design Guides, based on the work of NREL's researchers, provide owners, contractors, engineers, and architects user-friendly, how-to guidance by

  13. Buildings Energy Data Book: 3.1 Commercial Sector Energy Consumption

    Buildings Energy Data Book [EERE]

    1 2003 Commercial Delivered Energy Consumption Intensities, by Ownership of Unit (1) Ownership Nongovernment Owned 85.1 72% Owner-Occupied 87.3 35% Nonowner-Occupied 88.4 36% Government Owned 105.3 28% 100% Note(s): Source(s): Consumption (thousand Btu/SF) 1) Mall buildings are no longer included in most CBECs tables; therefore, some data is not directly comparable to past CBECs. EIA, 2003 Commercial Buildings Energy Consumption and Expenditures: Consumption and Expenditures Tables, June 2006,

  14. Evaluation of Boulder, CO, SmartRegs Ordinance and Better Buildings Program

    SciTech Connect (OSTI)

    Arena, L.; Vijayakumar, G.

    2012-04-01

    Under the SmartRegs ordinance in the city of Boulder, Colorado, all rental properties in the city must achieve an energy efficiency level comparable to a HERS Index of approximately 120 points or lower by the year 2019. The City of Boulder received a $12 million grant from the DOE's Better Buildings initiative to create and incentivize their EnergySmart Program. In this report, the Consortium for Advanced Residential Buildings (CARB) describes its work with the program, including energy audits of rental properties, developing training programs for insulators and inspectors, and conducting interviews with property owners.

  15. Evaluation of Boulder, CO,SmartRegs Ordinance and Better Buildings Program

    SciTech Connect (OSTI)

    Arena, L.; Vijayakumar, G.

    2012-04-01

    Under the SmartRegs ordinance in the city of Boulder, Colorado, all rental properties in the city must achieve an energy efficiency level comparable to a HERS Index of approximately 120 points or lower by the year 2019. The City of Boulder received a $12 million grant from the DOEs Better Buildings initiative to create and incentivize their EnergySmart Program. In this report, the Consortium for Advanced Residential Buildings (CARB) describes its work with the program, including energy audits of rental properties, developing training programs for insulators and inspectors, and conducting interviews with property owners.

  16. Deep Energy Retrofit Guidance for the Building America Solutions Center

    SciTech Connect (OSTI)

    Less, Brennan; Walker, Iain

    2015-01-01

    The U.S. DOE Building America program has established a research agenda targeting market-relevant strategies to achieve 40% reductions in existing home energy use by 2030. Deep Energy Retrofits (DERs) are part of the strategy to meet and exceed this goal. DERs are projects that create new, valuable assets from existing residences, by bringing homes into alignment with the expectations of the 21st century. Ideally, high energy using, dated homes that are failing to provide adequate modern services to their owners and occupants (e.g., comfortable temperatures, acceptable humidity, clean, healthy), are transformed through comprehensive upgrades to the building envelope, services and miscellaneous loads into next generation high performance homes. These guidance documents provide information to aid in the broader market adoption of DERs.

  17. Jackson Park Hospital Green Building Medical Center

    SciTech Connect (OSTI)

    William Dorsey; Nelson Vasquez

    2010-03-31

    Jackson Park Hospital completed the construction of a new Medical Office Building on its campus this spring. The new building construction has adopted the City of Chicago's recent focus on protecting the environment, and conserving energy and resources, with the introduction of green building codes. Located in a poor, inner city neighborhood on the South side of Chicago, Jackson Park Hospital has chosen green building strategies to help make the area a better place to live and work. The new green building houses the hospital's Family Medicine Residency Program and Specialty Medical Offices. The residency program has been vital in attracting new, young physicians to this medically underserved area. The new outpatient center will also help to allure needed medical providers to the community. The facility also has areas designated to women's health and community education. The Community Education Conference Room will provide learning opportunities to area residents. Emphasis will be placed on conserving resources and protecting our environment, as well as providing information on healthcare access and preventive medicine. The new Medical Office Building was constructed with numerous energy saving features. The exterior cladding of the building is an innovative, locally-manufactured precast concrete panel system with integral insulation that achieves an R-value in excess of building code requirements. The roof is a 'green roof' covered by native plantings, lessening the impact solar heat gain on the building, and reducing air conditioning requirements. The windows are low-E, tinted, and insulated to reduce cooling requirements in summer and heating requirements in winter. The main entrance has an air lock to prevent unconditioned air from entering the building and impacting interior air temperatures. Since much of the traffic in and out of the office building comes from the adjacent Jackson Park Hospital, a pedestrian bridge connects the two buildings, further decreasing the amount of unconditioned air that enters the office building. The HVAC system has an Energy Efficiency Rating 29% greater than required. No CFC based refrigerants were used in the HVAC system, thus reducing the emission of compounds that contribute to ozone depletion and global warming. In addition, interior light fixtures employ the latest energy-efficient lamp and ballast technology. Interior lighting throughout the building is operated by sensors that will automatically turn off lights inside a room when the room is unoccupied. The electrical traction elevators use less energy than typical elevators, and they are made of 95% recycled material. Further, locally manufactured products were used throughout, minimizing the amount of energy required to construct this building. The primary objective was to construct a 30,000 square foot medical office building on the Jackson Park Hospital campus that would comply with newly adopted City of Chicago green building codes focusing on protecting the environment and conserving energy and resources. The energy saving systems demonstrate a state of the-art whole-building approach to energy efficient design and construction. The energy efficiency and green aspects of the building contribute to the community by emphasizing the environmental and economic benefits of conserving resources. The building highlights the integration of Chicago's new green building codes into a poor, inner city neighborhood project and it is designed to attract medical providers and physicians to a medically underserved area.

  18. BSC: Building America, Building Science Consortium - 2015 Peer Review |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy BSC: Building America, Building Science Consortium - 2015 Peer Review BSC: Building America, Building Science Consortium - 2015 Peer Review Presenter: Joe Lstiburek, Building Science Corp. View the Presentation PDF icon BSC: Building America, Building Science Consortium - 2015 Peer Review More Documents & Publications Building America Technology Solutions for New and Existing Homes Case Study: Field Testing an Unvented Roof with Fibrous Insulation and Tiles Building

  19. Bridging the Gap: Helping Small Businesses With Big Ideas Develop New

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industries | Department of Energy Bridging the Gap: Helping Small Businesses With Big Ideas Develop New Industries Bridging the Gap: Helping Small Businesses With Big Ideas Develop New Industries October 25, 2011 - 3:59pm Addthis Semprius, solar panels shown above, announced that it is building a factory in Henderson, NC to manufacture its high concentration photovoltaic (HCPV) solar modules and is expected to create more than 250 full-time jobs over the next five years. Semprius, solar

  20. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  1. Going Deeper in the Heart of Texas Helps Retired Officers Save | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Going Deeper in the Heart of Texas Helps Retired Officers Save Going Deeper in the Heart of Texas Helps Retired Officers Save In San Antonio, Texas, Better Buildings Neighborhood Program partner CPS Energy Savers worked with the Army Residence Community (ARC) to pull off a nearly-200-unit energy upgrade with military precision. The ARC, a nonprofit community for retired military officers and their spouses, was looking to upgrade the attic insulation in 189 single-family cottages

  2. CREED to Help Cleantech Start-ups with Go-to-Market Strategies - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL CREED to Help Cleantech Start-ups with Go-to-Market Strategies August 17, 2011 The Colorado Center for Renewable Energy Economic Development (CREED) at U.S. Department of Energy's National Renewable Energy Laboratory (NREL) invites cleantech entrepreneurs to attend the next event in its Entrepreneur Series. The Aug. 25 class, "Go-to-Market Strategies," will help cleantech entrepreneurs analyze primary and secondary markets and teach them how to build and use a

  3. Building Energy Code

    Broader source: Energy.gov [DOE]

    Much of the information presented in this summary is drawn from the U.S. Department of Energy’s (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more...

  4. Buildings interoperability landscape - Draft

    SciTech Connect (OSTI)

    Hardin, Dave B.; Stephan, Eric G.; Wang, Weimin; Corbin, Charles D.; Widergren, Steven E.

    2015-02-01

    Buildings are an integral part of our nation’s energy economy. The advancement in information and communications technology (ICT) has revolutionized energy management in industrial facilities and large commercial buildings. As ICT costs decrease and capabilities increase, buildings automation and energy management features are transforming the small-medium commercial and residential buildings sectors. A vision of a connected world in which equipment and systems within buildings coordinate with each other to efficiently meet their owners’ and occupants’ needs, and where buildings regularly transact business with other buildings and service providers (such as gas and electric service providers) is emerging. However, while the technology to support this collaboration has been demonstrated at various degrees of maturity, the integration frameworks and ecosystems of products that support the ability to easily install, maintain, and evolve building systems and their equipment components are struggling to nurture the fledging business propositions of their proponents.

  5. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Virginia Uniform Statewide Building Code (USBC) is a statewide minimum requirement that local jurisdictions cannot amend. The code is applicable to all new buildings in the commonwealth. The...

  6. Building Energy Code

    Broader source: Energy.gov [DOE]

    Much of the information presented in this summary is drawn from the U.S. Department of Energy’s (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more deta...

  7. Building Energy Code

    Broader source: Energy.gov [DOE]

    Prior to 1997, South Carolina's local governments adopted and enforced the building codes. In 1997, the law required statewide use of the most up-to-date building codes, which then required the...

  8. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Massachusetts Board of Building Regulations and Standards has authority to promulgate the Massachusetts State Building Code (MSBC). The energy provisions in the MSBC were developed by the Boa...

  9. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Florida Building Commission (FBC) is directed to adopt, revise, update, and maintain the Florida Building Code in accordance with Chapter 120 of the state statutes. The code is mandatory...

  10. Building Energy Code

    Broader source: Energy.gov [DOE]

    Much of the information presented in this summary is drawn from the U.S. Department of Energys (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more...

  11. Building Energy Code

    Broader source: Energy.gov [DOE]

    Note: Much of the information presented in this summary is drawn from the U.S. Department of Energys (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more...

  12. 2015 Better Buildings Summit

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy's Better Buildings Summit is a national meeting where leading organizations across key sectors showcase solutions to cut energy intensity in their buildings portfolio...

  13. Building Energy Code

    Broader source: Energy.gov [DOE]

    The 2012 IECC is in effect for all residential and commercial buildings, Idaho schools, and Idaho jurisdictions that adopt and enforce building codes, unless a local code exists that is more...

  14. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Kentucky Building Code (KBC) is updated every three years on a cycle one year behind the publication year for the International Building Code. Any changes to the code by the state of Kentucky...

  15. Guam- Building Energy Code

    Broader source: Energy.gov [DOE]

    Much of the information presented in this summary is drawn from the U.S. Department of Energy’s (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more...

  16. Better Buildings Summit 2015

    Broader source: Energy.gov [DOE]

    The Better Buildings Summit is a national meeting where Better Buildings partners, including AMO’s Better Plants Program partners, and leading organizations can exchange best practices and showcase...

  17. Food Service Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    was a food service building were only asked whether the building was a restaurant, bar, fast food chain, or cafeteria (all the same category) or some other type of food service...

  18. Building Efficiency Report

    Broader source: Energy.gov [DOE]

    Buildings use 40% of total energy in the United States – more than either the industrial or transportation sectors. Technical improvements and cost reductions (see Appendix 3) in building materials...

  19. Building Energy Code

    Broader source: Energy.gov [DOE]

    Missouri does not have a statewide building or energy code for private residential and commercial buildings, and there currently is no state regulatory agency authorized to promulgate, adopt, or...

  20. Building Energy Code

    Broader source: Energy.gov [DOE]

    The Board of Building Standards is the primary state agency that protects the public's safety by: adopting rules governing the construction, repair, and rehabilitation of buildings in the state;...

  1. Building Design & Construction - Sustainability

    SciTech Connect (OSTI)

    2003-11-01

    Offers a brief history of green building; presents the results of a specially commissioned survey; and analyzes the chief trends, issues, and published research, based on interviews with dozens of experts and participants in green building.

  2. Special Building Renovations

    Broader source: Energy.gov [DOE]

    A number of building types have specific energy uses and needs, and as such the renewable opportunities may be different from a typical office building. This section briefly discusses the following...

  3. Building Materials Property Table

    SciTech Connect (OSTI)

    2010-04-16

    This information sheet describes a table of some of the key technical properties of many of the most common building materials taken from ASHRAE Fundamentals - 2001, Moisture Control in Buildings, CMHC, NRC/IRC, IEA Annex 24, and manufacturer data.

  4. Building Energy Code

    Broader source: Energy.gov [DOE]

    Note: Much of the information presented in this summary is drawn from the U.S. Department of Energy’s (DOE) Building Energy Codes Program and the Building Codes Assistance Project (BCAP). For more...

  5. Health Care Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    also tended to be larger than those not on complexes. The average building on a complex was 79.9 thousand square feet, compared to 11.2 thousand square feet for buildings...

  6. 1999 Commercial Buildings Characteristics--Building Shell and...

    U.S. Energy Information Administration (EIA) Indexed Site

    & Practices > Building Shell & Lighting Conservation Features Building Shell and Lighting Conservation Features The 1999 CBECS collected information on two types of building shell...

  7. Building America Top Innovations Hall of Fame Profile - Building...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Top Innovations Hall of Fame Profile - Building America's Top Innovations Propel the Home Building Industry toward Higher Performance Building America Top Innovations Hall of Fame ...

  8. Building America Webinar: Building America: Research for Real...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building America Webinar: Building America: Research for Real-World Results This presentation was delivered on Dec. 17, 2014, by Eric Werling, Building America Research ...

  9. Trends in Commercial Buildings--Buildings and Floorspace

    U.S. Energy Information Administration (EIA) Indexed Site

    activity. Number of Commercial Buildings In 1979, the Nonresidential Buildings Energy Consumption Survey estimated that there were 3.8 million commercial buildings in the...

  10. Building America Solution Center - Building America Top Innovation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building America Solution Center - Building America Top Innovation SCimagemale.jpg The Building America Solution Center is a Web-based tool connecting users to fast, free, and ...

  11. Building America Top Innovations 2013 Profile - Building America...

    Energy Savers [EERE]

    Building America Top Innovations 2013 Profile - Building America Solution Center PNNL set up the framework for the Building America Solution Center, a web tool connecting users to ...

  12. Buildings Energy Data Book

    Buildings Energy Data Book [EERE]

    1.1 Buildings Sector Energy Consumption 1.2 Building Sector Expenditures 1.3 Value of Construction and Research 1.4 Environmental Data 1.5 Generic Fuel Quad and Comparison 1.6 Embodied Energy of Building Assemblies 2The Residential Sector 3Commercial Sector 4Federal Sector 5Envelope and Equipment 6Energy Supply 7Laws, Energy Codes, and Standards 8Water 9Market Transformation Glossary Acronyms and Initialisms Technology Descriptions Building Descriptions Other Data Books Biomass Energy

  13. Buildings Energy Data Book

    Buildings Energy Data Book [EERE]

    The Energy Index for Commercial Buildings Welcome to the Energy Index for Commercial Buildings. Data for this tool comes from the Energy Information Administration's (EIA) 2003 Commercial Buildings Energy Consumption Survey (CBECS). Select categories from the CBECS micro data allow users to search on common building characteristics that impact energy use. Users may select multiple criteria, however if the resulting sample size is too small, the data will be unreliable. If nothing is selected

  14. Buildings Energy Databook

    Buildings Energy Data Book [EERE]

    2 BUILDINGS ENERGY DATABOOK U.S. DEPARTMENT OF ENERGY OFFICE OF ENERGY EFFICIENCY AND RENEWABLE ENERGY DOE's Office of Energy Efficiency and Renewable Energy Buildings Energy Databook The United States Department of Energy's Office of Energy Efficiency and Renewable Energy has developed this Buildings Energy Databook to provide a current and accurate set of comprehensive buildings-related data and to promote the use of such data for consistency throughout DOE programs. The Databook is considered

  15. BUILDING AMERICA PROGRAM EVALUATION

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Examples include changing local building codes, creating ... the program held monthly education classes for any ... errors including systematic and experimental ...

  16. Autotune Building Energy Models

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    quantification to determine importance of individual parameters * Suite of machine learning algorithms to generate calibration functions based on building dynamics * ...

  17. Kiowa County Commons Building

    Broader source: Energy.gov [DOE]

    This poster describes the energy efficiency features and sustainable materials used in the Kiowa County Commons Building in Greensburg, Kansas.

  18. High Performance Sustainable Buildings

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Buildings Goal 3: High Performance Sustainable Buildings Maintaining the conditions of a building improves the health of not only the surrounding ecosystems, but also the well-being of its occupants. Energy Conservation» Efficient Water Use & Management» High Performance Sustainable Buildings» Greening Transportation» Green Purchasing & Green Technology» Pollution Prevention» Science Serving Sustainability» ENVIRONMENTAL SUSTAINABILITY GOALS at LANL The Radiological Laboratory

  19. Building Energy Code

    Broader source: Energy.gov [DOE]

    In March 2006, SB 459 was enacted to promote renewable energy and update the state's building energy codes.

  20. Building Technologies Office Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office (BTO) Ecosystem Emerging Technologies ... Heat Flow + Air Flow + Water Flow Ventilation Thermal ... and related services 3. Enable buildings to ...