National Library of Energy BETA

Sample records for heating fuel market

  1. Combined Heat and Power Market Potential for Opportunity Fuels...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 The purpose of this 2004...

  2. An Assessment of Heating Fuels And Electricity Markets During...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon An Assessment of Heating Fuels And Electricity Markets During the Winters of 2013... Before the House Subcommittee on Energy and Power - Committee on Energy and Commerce

  3. Combined Heat and Power Market Potential for Opportunity Fuels

    SciTech Connect (OSTI)

    Jones, David; Lemar, Paul

    2015-12-01

    This report estimates the potential for opportunity fuel combined heat and power (CHP) applications in the United States, and provides estimates for the technical and economic market potential compared to those included in an earlier report. An opportunity fuel is any type of fuel that is not widely used when compared to traditional fossil fuels. Opportunity fuels primarily consist of biomass fuels, industrial waste products and fossil fuel derivatives. These fuels have the potential to be an economically viable source of power generation in various CHP applications.

  4. An analysis of heating fuel market behavior, 1989--1990

    SciTech Connect (OSTI)

    Not Available

    1990-06-01

    The purpose of this report is to fully assess the heating fuel crisis from a broader and longer-term perspective. Using EIA final, monthly data, in conjunction with credible information from non-government sources, the pricing phenomena exhibited by heating fuels in late December 1989 and early January 1990 are described and evaluated in more detail and more accurately than in the interim report. Additionally, data through February 1990 (and, in some cases, preliminary figures for March) make it possible to assess the market impact of movements in prices and supplies over the heating season as a whole. Finally, the longer time frame and the availability of quarterly reports filed with the Securities and Exchange Commission make it possible to weigh the impact of revenue gains in December and January on overall profits over the two winter quarters. Some of the major, related issues raised during the House and Senate hearings in January concerned the structure of heating fuel markets and the degree to which changes in this structure over the last decade may have influenced the behavior and financial performance of market participants. Have these markets become more concentrated Was collusion or market manipulation behind December's rising prices Did these, or other, factors permit suppliers to realize excessive profits What additional costs were incurred by consumers as a result of such forces These questions, and others, are addressed in the course of this report.

  5. Combined Heat and Power Market Potential for Opportunity Fuels, August 2004

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Power Market Potential for Opportunity Fuels, August 2004 Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 The purpose of this 2004 report was to determine the best opportunity fuel(s) for distributed energy resources and combined heat and power (DER/CHP) applications, examine the DER/CHP technologies that can use them, and assess the potential market impacts of opportunity fueled DER/CHP applications. PDF icon chp_opportunityfuels.pdf More

  6. Northeast Heating Fuel Market The, Assessment and Options

    Reports and Publications (EIA)

    2000-01-01

    In response to the President's request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of the energy markets in the Northeast

  7. The Northeast heating fuel market: Assessment and options

    SciTech Connect (OSTI)

    2000-07-01

    In response to a Presidential request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of tie energy markets in the Northeast. In addition, this report explores the potential for nonresidential users to move away from distillate fuel oil and how this might impact future prices, and discusses conversion of distillate fuel oil users to other fuels over the next 5 years. Because the President's and Secretary's request focused on converting factories and other large-volume users of mostly high-sulfur distillate fuel oil to other fuels, transportation sector use of low-sulfur distillate fuel oil is not examined here.

  8. Combined Heat and Power Market Potential for Opportunity Fuels...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CHP and Bioenergy for Landfills and Wastewater Treatment Plants: Market Opportunities Biomass Program Perspectives on Anaerobic Digestion and Fuel Cell Integration at Biorefineries ...

  9. An Assessment of Heating Fuels And Electricity Markets During the

    Energy Savers [EERE]

    4: The Transportation Issue Amped Up! Volume 1, No. 4: The Transportation Issue Amped_Up_4.jpg Amped Up! is a bimonthly newsletter that highlights the initiatives, events, and technologies in the Office of Energy Efficiency and Renewable Energy that influence change. Features in this issue include: - Meet EV Everywhere Director Bob Graham - Deputy Assistant Secretary for Transportation Reuben Sarkar on the New Optima Initiative - Sustainable Transportation Day 2015 - Fuel Cell Electric Vehicles

  10. An Assessment of Heating Fuels And Electricity Markets During the Winters of 2013-2014 and 2014-2015

    Broader source: Energy.gov [DOE]

    Cold weather that blanketed much of the Eastern United States in 2013-2014 and 2014-2015 exhibited unique characteristics that prompted different — but related — challenges across heating fuels and electricity markets. In an effort to understand the impacts of the winter conditions on these markets, the Office of Electricity Delivery and Energy Reliability conducted an in-depth analysis of regional fuel and electricity sectors during the winters of 2013-2014 and 2014-2015 to assess market behavior and performance.

  11. 2009 Fuel Cell Market Report

    SciTech Connect (OSTI)

    Vincent, Bill; Gangi, Jennifer; Curtin, Sandra; Delmont, Elizabeth

    2010-11-01

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general.

  12. Fuel cell market applications

    SciTech Connect (OSTI)

    Williams, M.C.

    1995-12-31

    This is a review of the US (and international) fuel cell development for the stationary power generation market. Besides DOE, GRI, and EPRI sponsorship, the US fuel cell program has over 40% cost-sharing from the private sector. Support is provided by user groups with over 75 utility and other end-user members. Objectives are to develop and demonstrate cost-effective fuel cell power generation which can initially be commercialized into various market applications using natural gas fuel by the year 2000. Types of fuel cells being developed include PAFC (phosphoric acid), MCFC (molten carbonate), and SOFC (solid oxide); status of each is reported. Potential international applications are reviewed also. Fuel cells are viewed as a force in dispersed power generation, distributed power, cogeneration, and deregulated industry. Specific fuel cell attributes are discussed: Fuel cells promise to be one of the most reliable power sources; they are now being used in critical uninterruptible power systems. They need hydrogen which can be generated internally from natural gas, coal gas, methanol landfill gas, or other fuels containing hydrocarbons. Finally, fuel cell development and market applications in Japan are reviewed briefly.

  13. 2009 Fuel Cell Market Report, November 2010

    SciTech Connect (OSTI)

    Not Available

    2010-11-01

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general.

  14. Assessment of Heating Fuels and Electricity Markets During the Winters of 2013-2014 and 2014-2015 Now Available

    Broader source: Energy.gov [DOE]

    Cold weather that blanketed much of the Eastern United States in 2013-2014 and 2014-2015 exhibited unique characteristics that prompted different — but related — challenges across heating fuels and...

  15. DOE Releases 2013 Fuel Cell Technologies Market Report | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Releases 2013 Fuel Cell Technologies Market Report DOE Releases 2013 Fuel Cell Technologies Market Report November 12, 2014 - 11:13am Addthis The Energy Department today released the 2013 Fuel Cell Technologies Market Report, detailing trends in the U.S. fuel cell and hydrogen technologies market. The report highlights continued growth in fuel cell commercial deployments, including material handling equipment such as forklifts as well as combined heat and power systems and back-up and

  16. Recovery Act Projects Funded for Fuel Cell Market Transformation |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Recovery Act Projects Funded for Fuel Cell Market Transformation Recovery Act Projects Funded for Fuel Cell Market Transformation Following the fuel cell funding announcement, DOE funded the fuel cell market transformation projects listed below. These projects focus on fuel cell systems in emergency backup power, material handling, and combined heat and power applications, with the goal of improving the potential of fuel cells to provide power in stationary, portable,

  17. Energy Smart Guide to Campus Cost Savings: Today's Trends in Project Finance, Clean Fuel Fleets, Combined Heat& Power, Emissions Markets

    SciTech Connect (OSTI)

    Not Available

    2003-07-01

    The Energy Smart Guide to Campus Cost Savings covers today's trends in project finance, combined heat& power, clean fuel fleets and emissions trading. The guide is directed at campus facilities and business managers and contains general guidance, contact information and case studies from colleges and universities across the country.

  18. 2008 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    Vincent, B.

    2010-06-30

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies.

  19. 2008 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    DOE

    2010-06-01

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies.

  20. 2009 Fuel Cell Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of

  1. 2008 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FUEL CELL TECHNOLOGIES MARKET REPORT JUNE 2010 2008 FUEL CELL TECHNOLOGIES MARKET REPORT i Authors This report was written primarily by Bill Vincent of the Breakthrough ...

  2. Market Transformation: Fuel Cell Early Adoption (Presentation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Transformation: Fuel Cell Early Adoption (Presentation) Market Transformation: Fuel Cell Early Adoption (Presentation) Presented at the DOE Fuel Cell Pre-Solicitation Workshop held ...

  3. 2007 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FUEL CELL TECHNOLOGIES MARKET REPORT JULY 2009 Table of Contents Introduction 1 Worldwide Fuel Cell Shipments Increased 70% from 2006 to 2007 3 Percent Production Increase Highest ...

  4. 2011 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2011 FUEL CELL TECHNOLOGIES MARKET REPORT ii Authors This report was a collaborative ... valuable contributions of many men and women in government and in the fuel cell industry. ...

  5. Fuel Cell Markets Ltd | Open Energy Information

    Open Energy Info (EERE)

    Cell Markets Ltd Place: Buckinghamshire, United Kingdom Zip: SL0 9AQ Sector: Hydro, Hydrogen Product: Fuel Cell Markets was set up to assist companies in the fuel cell and...

  6. Moving toward a commercial market for hydrogen fuel cell vehicles...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Moving toward a commercial market for hydrogen fuel cell vehicles Moving toward a commercial market for hydrogen fuel cell vehicles Fuel cell vehicles and fueling stations PDF icon ...

  7. 2009 Fuel Cell Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9 Fuel Cell Market Report 2009 Fuel Cell Market Report This report provides an overview of 2009 trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies. PDF icon 2009 Fuel Cell Market Report More Documents & Publications 2008 Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies

  8. Winter Heating Fuels - Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    Winter Heating Fuels Click on the map to view state specific heating fuels data below | click to reset to U.S. values Click on map above to view state-specific heating fuel data ...

  9. 2010 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Technologies Market Report 2010 Fuel Cell Technologies Market Report This report summarizes 2010 data on fuel cells, including market penetration and industry trends. It also covers cost, price, and performance trends, along with policy and market drivers and the future outlook for fuel cells. PDF icon 2010 Fuel Cell Technologies Market Report More Documents & Publications 2008 Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies Market Report 2009 Fuel Cell Market

  10. Alternative Fuels Market and Policy Trends (Presentation)

    SciTech Connect (OSTI)

    Schroeder, A. N.

    2013-09-01

    Market forces and policies are increasing opportunities for alternative fuels. There is no one-size-fits-all, catch-all, silver-bullet fuel. States play a critical role in the alternative fuel market and are taking a leading role.

  11. 2012 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 Fuel Cell Technologies Market Report 2012 Fuel Cell Technologies Market Report This report describes data compiled in 2013 on trends in the fuel cell industry for 2012 with some comparison to previous years. PDF icon 2012 Fuel Cell Technologies Market Report More Documents & Publications 2008 Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies Market Report 2011

  12. Alternative Fuels Data Center: Alternative Fuel Vehicles Beat the Heat,

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fight the Freeze, and Conquer the Mountains Alternative Fuel Vehicles Beat the Heat, Fight the Freeze, and Conquer the Mountains to someone by E-mail Share Alternative Fuels Data Center: Alternative Fuel Vehicles Beat the Heat, Fight the Freeze, and Conquer the Mountains on Facebook Tweet about Alternative Fuels Data Center: Alternative Fuel Vehicles Beat the Heat, Fight the Freeze, and Conquer the Mountains on Twitter Bookmark Alternative Fuels Data Center: Alternative Fuel Vehicles Beat

  13. NREL: Hydrogen and Fuel Cells Research - Early Fuel Cell Market

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Demonstrations Early Fuel Cell Market Demonstrations Photo of fuel cell backup power system in outdoor setting. Photo of fuel cell forklifts in warehouse setting. Fuel cell backup power systems offer longer continuous runtimes and greater durability than traditional batteries in harsh outdoor environments. For specialty vehicles such as forklifts, fuel cells can be a cost-competitive alternative to traditional lead-acid batteries. Learn More Subscribe to the biannual Fuel Cell and Hydrogen

  14. Winter Heating Fuels - Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    Winter Heating Fuels Click on the map to view state specific heating fuels data below | click to reset to U.S. values Click on map above to view state-specific heating fuel data Propane Heating oil Natural gas Electricity For more data on: Heating oil and propane prices - Heating Oil and Propane Update Propane stocks - Weekly Petroleum Status Report Heating oil/distillate stocks - Weekly Petroleum Status Report Natural gas storage - Weekly Natural Gas Storage Report Natural gas prices - Natural

  15. PADDs 1 and 3 Transportation Fuels Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    PADDs 1 and 3 Transportation Fuels Markets A report prepared by ICF International for EIA Independent Statistics & Analysis www.eia.gov U.S. Department of Energy Washington, DC 20585 February 2016 February 2016 ICF International, LLC for EIA | PADDs 1 and 3 Transportation Fuels Markets i Acknowledgements This report was prepared by ICF International for the U.S. Energy Information Administration (EIA) under the general guidance of Lynn Westfall, Director of Office of Energy Markets and

  16. 2008 Fuel Cell Technologies Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of

  17. Fuel Cell Combined Heat and Power Commercial Demonstration

    SciTech Connect (OSTI)

    Brooks, Kriston P.; Makhmalbaf, Atefe

    2014-09-02

    This is the annual report for the Market Transformation project as required by DOE EERE's Fuel Cell Technologies Office. We have been provided with a specific format. It describes the work that was done in developing evaluating the performance of 5 kW stationary combined heat and power fuel cell systems that have been deployed in Oregon and California. It also describes the business case that was developed to identify markets and address cost.

  18. 2014 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies Market Report 2014 (This page intentionally left blank) i FUEL CELL TECHNOLOGIES MARKET REPORT 2014 Authors This report was compiled and written by Sandra Curtin and Jennifer Gangi of the Fuel Cell and Hydrogen Energy Association, in Washington, D.C. Acknowledgement The authors relied upon the hard work and valuable contributions of many men and women in government and in the fuel cell industry. The authors especially wish to thank Sunita Satyapal and the staff of the U.S.

  19. Early Markets: Fuel Cells for Backup Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Backup Power Overview Fuel cells convert the chemical energy in hydrogen to electricity with only water and heat as byproducts and are commercially available today for certain ...

  20. 2014 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Fuel Cell Technologies Market Report 2014 Fuel Cell Technologies Market Report This report describes data compiled in 2015 on trends in the fuel cell industry for 2014 with some comparison to previous years. PDF icon 2014 Fuel Cell Technologies Market Report More Documents & Publications 2013 Fuel Cell Technologies Market Report 2012 Fuel Cell Technologies Market Report Fuel Cell Technologies Program Overview: 2012 DOE Polymer and Composite Materials Meetings

  1. Heating subsurface formations by oxidizing fuel on a fuel carrier

    DOE Patents [OSTI]

    Costello, Michael; Vinegar, Harold J.

    2012-10-02

    A method of heating a portion of a subsurface formation includes drawing fuel on a fuel carrier through an opening formed in the formation. Oxidant is supplied to the fuel at one or more locations in the opening. The fuel is combusted with the oxidant to provide heat to the formation.

  2. Waste Heat to Power Market Assessment

    SciTech Connect (OSTI)

    Elson, Amelia; Tidball, Rick; Hampson, Anne

    2015-03-01

    Waste heat to power (WHP) is the process of capturing heat discarded by an existing process and using that heat to generate electricity. In the industrial sector, waste heat streams are generated by kilns, furnaces, ovens, turbines, engines, and other equipment. In addition to processes at industrial plants, waste heat streams suitable for WHP are generated at field locations, including landfills, compressor stations, and mining sites. Waste heat streams are also produced in the residential and commercial sectors, but compared to industrial sites these waste heat streams typically have lower temperatures and much lower volumetric flow rates. The economic feasibility for WHP declines as the temperature and flow rate decline, and most WHP technologies are therefore applied in industrial markets where waste heat stream characteristics are more favorable. This report provides an assessment of the potential market for WHP in the industrial sector in the United States.

  3. 2008 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies Market Report This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies. PDF icon 2008 Fuel Cell Technologies Market Report More Documents &

  4. Liquid Fuels Market Module - NEMS Documentation

    Reports and Publications (EIA)

    2014-01-01

    Defines the objectives of the Liquid Fuels Market Model (LFMM), describes its basic approach, and provides detail on how it works. This report is intended as a reference document for model analysts, users, and the public.

  5. 2011 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 Fuel Cell Technologies Market Report 2011 Fuel Cell Technologies Market Report This report from the U.S. Department of Energy describes data compiled in 2012 on trends in the fuel cell industry for 2011 with some comparison to previous years. PDF icon 2011 Fuel Cell Technologies Market Report More Documents & Publications 2012 Fuel Cell Technologies Market Report 2013 Fuel Cell Technologies Market Report 2010

  6. PADD 5 Transportation Fuels Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    ... during periods of supply disruption and market change. ... to manage distribution system inefficiencies and ... Aromatic hydrocarbons are a class of chemical substances ...

  7. 2013 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Fuel Cell Technologies Market Report Fuel Cell Technologies Office November 2014 (This page intentionally left blank) Section title Unt utaerest in pos eum quo con et i Authors This report was compiled and written by Sandra Curtin and Jennifer Gangi of the Breakthrough Technologies Institute, Inc., in Washington, D.C. Acknowledgement The authors relied upon the hard work and valuable contributions of many men and women in government and in the fuel cell industry. The authors especially wish to

  8. Supply Security in Future Nuclear Fuel Markets

    SciTech Connect (OSTI)

    Seward, Amy M.; Wood, Thomas W.; Gitau, Ernest T.; Ford, Benjamin E.

    2013-11-18

    Previous PNNL work has shown the existing nuclear fuel markets to provide a high degree of supply security, including the ability to respond to supply disruptions that occur for technical and non-technical reasons. It is in the context of new reactor designs – that is, reactors likely to be licensed and market ready over the next several decades – that fuel supply security is most relevant. Whereas the fuel design and fabrication technology for existing reactors are well known, the construction of a new set of reactors could stress the ability of the existing market to provide adequate supply redundancy. This study shows this is unlikely to occur for at least thirty years, as most reactors likely to be built in the next three decades will be evolutions of current designs, with similar fuel designs to existing reactors.

  9. 2008 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies Market Report This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies. PDF icon 48219.pdf More Documents & Publications 2008 Fuel Cell

  10. Market penetration scenarios for fuel cell vehicles

    SciTech Connect (OSTI)

    Thomas, C.E.; James, B.D.; Lomax, F.D. Jr.

    1997-12-31

    Fuel cell vehicles may create the first mass market for hydrogen as an energy carrier. Directed Technologies, Inc., working with the US Department of Energy hydrogen systems analysis team, has developed a time-dependent computer market penetration model. This model estimates the number of fuel cell vehicles that would be purchased over time as a function of their cost and the cost of hydrogen relative to the costs of competing vehicles and fuels. The model then calculates the return on investment for fuel cell vehicle manufacturers and hydrogen fuel suppliers. The model also projects the benefit/cost ratio for government--the ratio of societal benefits such as reduced oil consumption, reduced urban air pollution and reduced greenhouse gas emissions to the government cost for assisting the development of hydrogen energy and fuel cell vehicle technologies. The purpose of this model is to assist industry and government in choosing the best investment strategies to achieve significant return on investment and to maximize benefit/cost ratios. The model can illustrate trends and highlight the sensitivity of market penetration to various parameters such as fuel cell efficiency, cost, weight, and hydrogen cost. It can also illustrate the potential benefits of successful R and D and early demonstration projects. Results will be shown comparing the market penetration and return on investment estimates for direct hydrogen fuel cell vehicles compared to fuel cell vehicles with onboard fuel processors including methanol steam reformers and gasoline partial oxidation systems. Other alternative fueled vehicles including natural gas hybrids, direct injection diesels and hydrogen-powered internal combustion hybrid vehicles will also be analyzed.

  11. 2007 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    McMurphy, K.

    2009-07-01

    The fuel cell industry, which has experienced continued increases in sales, is an emerging clean energy industry with the potential for significant growth in the stationary, portable, and transportation sectors. Fuel cells produce electricity in a highly efficient electrochemical process from a variety of fuels with low to zero emissions. This report describes data compiled in 2008 on trends in the fuel cell industry for 2007 with some comparison to two previous years. The report begins with a discussion of worldwide trends in units shipped and financing for the fuel cell industry for 2007. It continues by focusing on the North American and U.S. markets. After providing this industry-wide overview, the report identifies trends for each of the major fuel cell applications -- stationary power, portable power, and transportation -- including data on the range of fuel cell technologies -- polymer electrolyte membrane fuel cell (PEMFC), solid oxide fuel cell (SOFC), alkaline fuel cell (AFC), molten carbonate fuel cell (MCFC), phosphoric acid fuel cell (PAFC), and direct-methanol fuel cell (DMFC) -- used for these applications.

  12. WORKING PARK-FUEL CELL COMBINED HEAT AND POWER SYSTEM

    SciTech Connect (OSTI)

    Allan Jones

    2003-09-01

    This report covers the aims and objectives of the project which was to design, install and operate a fuel cell combined heat and power (CHP) system in Woking Park, the first fuel cell CHP system in the United Kingdom. The report also covers the benefits that were expected to accrue from the work in an understanding of the full technology procurement process (including planning, design, installation, operation and maintenance), the economic and environmental performance in comparison with both conventional UK fuel supply and conventional CHP and the commercial viability of fuel cell CHP energy supply in the new deregulated energy markets.

  13. 2013 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Fuel Cell Technologies Market Report 2013 Fuel Cell Technologies Market Report This report describes data compiled in 2014 on trends in the fuel cell industry for 2013 with some comparison to previous years. PDF icon 2013 Fuel Cell Technologies Market Report More Documents & Publications State of the States: Fuel Cells in America 2015 State of the States: Fuel Cells in America 2014 Workshop on Gas Clean-Up for Fuel Cell Applications

  14. 2010 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This report summarizes 2010 data on fuel cells, including market penetration and industry trends. It also covers cost, price, and performance trends, along with policy and market ...

  15. 2009 Fuel Cell Market Report, November 2010, Energy Efficiency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2009 FUEL CELL MARKET REPORT NOVEMBER 2010 Authors This report was written primarily by ... of hard work and valuable contributions from government staff and the fuel cell industry. ...

  16. The Fuel Cell Mobile Light Project - A DOE Market Transformation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Mobile Light Project -- A DOE Market Transformation Activity-- Lennie Klebanoff ... Systems Torsten Erbel Multiquip Inc. DOE Fuel Cell Technologies Webinar November 13, ...

  17. Chapter 11. Fuel Economy: The Case for Market Failure

    SciTech Connect (OSTI)

    Greene, David L; German, John; Delucchi, Mark A

    2009-01-01

    The efficiency of energy using durable goods, from automobiles to home air conditioners, is not only a key determinant of economy-wide energy use but also of greenhouse gas (GHG) emissions, climate change and energy insecurity. Energy analysts have long noted that consumers appear to have high implicit discount rates for future fuel savings when choosing among energy using durable goods (Howarth and Sanstad, 1995). In modeling consumers choices of appliances, the Energy Information Administration (EIA) has used discount rates of 30 percent for heating systems, 69 percent for choice of refrigerator and up to 111 percent for choice of water heater (U.S. DOE/EIA, 1996). Several explanations have been offered for this widespread phenomenon, including asymmetric information, bounded rationality and transaction costs. This chapter argues that uncertainty combined with loss aversion by consumers is sufficient to explain the failure to adopt cost effective energy efficiency improvements in the market for automotive fuel economy, although other market failures appear to be present as well. Understanding how markets for energy efficiency function is crucial to formulating effective energy policies (see Pizer, 2006). Fischer et al., (2004), for example, demonstrated that if consumers fully value the discounted present value of future fuel savings, fuel economy standards are largely redundant and produce small welfare losses. However, if consumers value only the first three years of fuel savings, then fuel economy standards can significantly increase consumer welfare. The nature of any market failure that might be present in the market for energy efficiency would also affect the relative efficacy of energy taxes versus regulatory standards (CBO, 2003). If markets function efficiently, energy taxes would generally be more efficient than regulatory standards in increasing energy efficiency and reducing energy use. If markets are decidedly inefficient, standards would likely be more effective. The chapter explores the roles of uncertainty and loss-aversion in the market for automotive fuel economy. The focus is on the determination of the technical efficiency of the vehicle rather than consumers choices among vehicles. Over the past three decades, changes in the mix of vehicles sold has played little if any role in raising the average fuel economy of new light-duty vehicles from 13 miles per gallon (mpg) in 1975 to 21 mpg today (Heavenrich, 2006). Over that same time period, average vehicle weight is up 2 percent, horsepower is up 60 percent, passenger car interior volume increased by 2 percent and the market share of light trucks grew by 31 percentage points. Historically, at least, increasing light-duty vehicle fuel economy in the United States has been a matter of manufacturers decisions to apply technology to increase the technical efficiency of cars and light trucks. Understanding how efficiently the market determines the technical fuel economy of new vehicles would seem to be critical to formulating effective policies to encourage future fuel economy improvement. The central issue is whether or not the market for fuel economy is economically efficient. Rubenstein (1998) lists the key assumptions of the rational economic decision model. The decision maker must have a clear picture of the choice problem he or she faces. He should be fully aware of the set of alternatives from which to choose and have the skill necessary to make complicated calculations needed to discover the optimal course of action. Finally, the decision maker should have the unlimited ability to calculate and be indifferent to alternatives and choice sets.

  18. 2010 Fuel Cell Technologies Market Report, June 2011

    SciTech Connect (OSTI)

    Not Available

    2011-06-01

    This report summarizes 2010 data on fuel cells, including market penetration and industry trends. It also covers cost, price, and performance trends, along with policy and market drivers and the future outlook for fuel cells.

  19. Moving toward a commercial market for hydrogen fuel cell vehicles |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Moving toward a commercial market for hydrogen fuel cell vehicles Moving toward a commercial market for hydrogen fuel cell vehicles Fuel cell vehicles and fueling stations PDF icon 20080910_state_regional_vision.pdf More Documents & Publications Vision for Rollout of Fuel Cell Vehicles and Hydrogen Fuel Stations Innovation and Coordination at the Callifornia Fuel Cell Partnership FCEVs and Hydrogen in California

  20. Early Market Applications for Fuel Cell Technologies | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Market Applications for Fuel Cell Technologies Early Market Applications for Fuel Cell Technologies Fuel Cell Technologies Office market transformation efforts focus on several key early market applications: Specialty vehicles Emergency backup power Prime power for critical loads Specialty Vehicles For specialty vehicles such as forklifts, fuel cells can be a cost-competitive alternative to traditional lead-acid batteries because: Photo of a Hydrogenics hydrogen-powered forklift in front of an

  1. Early Markets: Fuel Cells for Backup Power | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Backup Power Early Markets: Fuel Cells for Backup Power This fact sheet describes the advantages of using fuel cell technology for application in emergency backup power. PDF icon Early Markets: Fuel Cells for Backup Power More Documents & Publications Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program -- 2015 Update Backup Power Cost of Ownership Analysis and Incumbent Technology Comparison Market Transformation Fact Sheet

  2. Early Markets: Fuel Cells for Material Handling Equipment | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Material Handling Equipment Early Markets: Fuel Cells for Material Handling Equipment This fact sheet describes the use of hydrogen fuel cells to power material handling equipment (MHE) and includes cost and performance comparisons for fuel cell-powered and battery-powered MHE. PDF icon Early Markets: Fuel Cells for Material Handling Equipment More Documents & Publications An Evaluation of the Total Cost of Ownership of Fuel Cell-Powered Material Handling Equipment Market

  3. Combined Heat And Power Installation Market Analysis | OpenEI...

    Open Energy Info (EERE)

    Combined Heat And Power Installation Market Analysis Home There are currently no posts in this category. Syndicate...

  4. Combined Heat And Power Installation Market Forecast | OpenEI...

    Open Energy Info (EERE)

    Combined Heat And Power Installation Market Forecast Home There are currently no posts in this category. Syndicate...

  5. Cooling, heating, and power for industry: A market assessment

    SciTech Connect (OSTI)

    None, None

    2003-08-01

    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector.

  6. Fuel Cells Today: Early Market Applications and Learning Demonstrations

    SciTech Connect (OSTI)

    2015-09-09

    This MP3 provides an overview of early market fuel cell applications including today's commercially available fuel cells and "learning demonstrations" to validate fuel cell technology in real world conditions.

  7. Fuel-Flexible Microturbine and Gasifier System for Combined Heat...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel-Flexible Microturbine and Gasifier System for Combined Heat and Power Fuel-Flexible Microturbine and Gasifier System for Combined Heat and Power Capstone Turbine Corporation, ...

  8. 2007 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 Fuel Cell Technologies Market Report 2007 Fuel Cell Technologies Market Report The fuel cell industry, which has experienced continued increases in sales, is an emerging clean energy industry with the potential for significant growth in the stationary, portable, and transportation sectors. Fuel cells produce electricity in a highly efficient electrochemical process from a variety of fuels with low to zero emissions. This report describes data compiled in 2008 on trends in the fuel cell

  9. Heated transportable fuel cell cartridges

    DOE Patents [OSTI]

    Lance, Joseph R. (N. Huntingdon, PA); Spurrier, Francis R. (Whitehall, PA)

    1985-01-01

    A fuel cell stack protective system is made where a plurality of fuel cells, each containing liquid electrolyte subject to crystallization, is enclosed by a containing vessel, and where at least one electric heater is placed in the containing vessel and is capable of preventing electrolyte crystallization.

  10. Preliminary Market Assessment for Cold Climate Heat Pumps

    SciTech Connect (OSTI)

    Sikes, Karen; Khowailed, Gannate; Abdelaziz, Omar

    2011-09-01

    Cold climate heat pump (HP) technology is relevant to a substantial portion of the U.S. population, especially with more than one-third of U.S. housing stock concentrated in colder regions of the country and another 31% in the mixed-humid climate region. Specifically, it is estimated that in 2010 almost 1.37 million heating equipment units were shipped to the cold/very cold climate regions and that 1.41 million were shipped to the nation s mixed-humid region. On a national level, the trend in the last decade has indicated that shipments of gas furnaces have grown at a slower rate than HPs. This indicates a potential opportunity for the cold climate HP, a technology that may be initially slow to penetrate its potential market because of the less expensive operating and first costs of gas furnaces. Anticipated implementation of regional standards could also negatively affect gas furnace shipments, especially with the higher initial cost for more efficient gas furnaces. However, as of 2011, the fact that there are more than 500 gas furnace product models that already achieve the expected efficiency standard indicates that satisfying the regional standard will be a challenge but not an obstacle. A look at the heating fuel and equipment currently being used in the housing stock provides an insight into the competing equipment that cold climate HPs hope to replace. The primary target market for the cold climate HP is the 2.6 million U.S. homes using electric furnaces and HPs in the cold/very cold region. It is estimated that 4.75% of these homeowners either replace or buy new heating equipment in a given year. Accordingly, the project team could infer that the cold climate HP primary market is composed of 123,500 replacements of electric furnaces and conventional air-to-air HPs annually. A secondary housing market for the cold climate HP comprises homes in the mixed-humid region of the country that are using electric furnaces. Homes using gas furnaces across both the cold/very cold and mixed-humid regions represent another secondary market for the cold climate HP. The cold climate HP could also target as a secondary market homes across both the cold/very cold and mixed-humid regions that use propane and fuel oil as their primary heating fuel. The combined total of homes in these three secondary markets is 46 million, and we can also infer that about 2.2 million of these systems are replaced annually. When comparing heating equipment stock in 2001, 2005, and 2009 in the cold/very cold region of the country, it appears that gas furnaces are slowly losing market share and that electric furnaces and HPs are making gains. The fact that electricity-dependent heating equipment is rising in preference among homeowners in the colder regions of the country shows that future penetration of the cold climate HP holds promise. Accordingly, cold climate HP technology could achieve an attractive position, given certain favorable market conditions such as reaching a competitive cost point, strong federal incentives, a consistent level of reliable performance, and a product rollout by a credible market leader. The project team relied on payback analysis to estimate the potential market penetration for the cold climate HP in each of its primary and secondary markets. In this analysis, we assumed a $250 price premium for the cold climate HP over the baseline HP. Electricity and gas prices and emissions were based on the 2010 Buildings Energy Data Book. The average heating load was calculated as 25.2 MMBTU per year in the cold/very cold and mixed-humid regions of the United States. Typical installed costs were obtained from the technical document supporting the U.S. Department of Energy rulemaking. The analysis showed that the cold climate HP will have a 2.2 year payback period when replacing an existing electric HP in the colder regions of the nation. The cold climate HP will have a 6 year payback period when replacing gas furnaces in the same climate regions. Accordingly, we estimated that the cold climate HP will have a penetration ratio ranging between 5% and 35% in its potential primary and secondary markets, resulting in a total annual estimated shipment of 298,000 units to both targeted regions of the nation. Once the cold climate HP technology meets its potential market penetration, it would contribute to annual site energy savings of 3,664,405 MMBTU and a CO2 emission reduction of 470,000 Ton.

  11. Install Waste Heat Recovery Systems for Fuel-Fired Furnaces;...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Install Waste Heat Recovery Systems for Fuel-Fired Furnaces For most fuel-fired heating equipment, a large amount of the heat supplied is wasted as exhaust or flue gases. ...

  12. First AEO2015 Liquid Fuels Markets Working Group Meeting

    U.S. Energy Information Administration (EIA) Indexed Site

    July 21, 2014 MEMORANDUM FOR: JOHN CONTI ASSISTANT ADMINISTRATOR FOR ENERGY ANALYSYS JOHN POWELL TEAM LEADER, LIQUID FUELS MARKET TEAM MICHAEL SCHAAL DIRECTOR, OFFICE OF ENERGY ANALYSIS FROM: LIQUID FUELS MARKET TEAM SUBJECT: First AEO2015 Liquid Fuels Markets Working Group Meeting Summary (presented on 07-17-2014) Attendees: (EIA) John Powell, Mindi Farber-DeAnda, Mike Cole, Adrian Geagla, Arup Mallik, David Manowitz, Vishakh Mantri, Beth May, Terry Yen, John Conti, Michael Schaal Bryan Just

  13. ITER Ion Cyclotron Heating and Fueling Systems

    SciTech Connect (OSTI)

    Rasmussen, D.A.; Baylor, L.R.; Combs, S.K.; Fredd, E.; Goulding, R.H.; Hosea, J.; Swain, D.W.

    2005-04-15

    The ITER burning plasma and advanced operating regimes require robust and reliable heating and current drive and fueling systems. The ITER design documents describe the requirements and reference designs for the ion cyclotron and pellet fueling systems. Development and testing programs are required to optimize, validate and qualify these systems for installation on ITER.The ITER ion cyclotron system offers significant technology challenges. The antenna must operate in a nuclear environment and withstand heat loads and disruption forces beyond present-day designs. It must operate for long pulse lengths and be highly reliable, delivering power to a plasma load with properties that will change throughout the discharge. The ITER ion cyclotron system consists of one eight-strap antenna, eight rf sources (20 MW, 35-65 MHz), associated high-voltage DC power supplies, transmission lines and matching and decoupling components.The ITER fueling system consists of a gas injection system and multiple pellet injectors for edge fueling and deep core fueling. Pellet injection will be the primary ITER fuel delivery system. The fueling requirements will require significant extensions in pellet injector pulse length ({approx}3000 s), throughput (400 torr-L/s,) and reliability. The proposed design is based on a centrifuge accelerator fed by a continuous screw extruder. Inner wall pellet injection with the use of curved guide tubes will be utilized for deep fueling.

  14. 2010 Fuel Cell Technologies Market Report, June 2011, Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FUEL CELL TECHNOLOGIES MARKET REPORT JUNE 2011 i Authors This report was a collaborative ... valuable contributions of many men and women in government and in the fuel cell industry. ...

  15. Connecticut Fuel Cell Activities: Markets, Programs, and Models |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Activities: Markets, Programs, and Models Connecticut Fuel Cell Activities: Markets, Programs, and Models Presented by the Connecticut Center for Advanced Technology, Inc. at the bi-monthly informational call for the DOE Fuel Cell Technologies Program on December 16, 2009 PDF icon ccat_hydrogen_ct.pdf More Documents & Publications Job Creation Analysis in the Hydrogen and Fuel Cell Industry State of the States: Fuel Cells in America 2011 2009 DOE Hydrogen Program

  16. Geothermal Heat Pumps: Market Status, Barriers to Adoption, and...

    Open Energy Info (EERE)

    search Tool Summary LAUNCH TOOL Name: Geothermal Heat Pumps: Market Status, Barriers to Adoption, and Actions to Overcome Barriers AgencyCompany Organization: Oak Ridge...

  17. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Sector, January 2000 The Market and Technical Potential for Combined Heat and ... and developed estimates of additional technical potential for CHP in industry. ...

  18. Cooling, Heating, and Power for Industry: A Market Assessment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector. PDF icon chpindustrymarketassessment0803.pdf More ...

  19. Bio-Oil Deployment in the Home Heating Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bio-Oil Deployment in the Home Heating Market March 23, 2015 Dr. Thomas A. Butcher ... and end user acceptance. * Heating oil and diesel transportation both use the same ...

  20. Heat exchanger for fuel cell power plant reformer

    DOE Patents [OSTI]

    Misage, Robert; Scheffler, Glenn W.; Setzer, Herbert J.; Margiott, Paul R.; Parenti, Jr., Edmund K.

    1988-01-01

    A heat exchanger uses the heat from processed fuel gas from a reformer for a fuel cell to superheat steam, to preheat raw fuel prior to entering the reformer and to heat a water-steam coolant mixture from the fuel cells. The processed fuel gas temperature is thus lowered to a level useful in the fuel cell reaction. The four temperature adjustments are accomplished in a single heat exchanger with only three heat transfer cores. The heat exchanger is preheated by circulating coolant and purge steam from the power section during startup of the latter.

  1. Native Village of Teller Addresses Heating Fuel Shortage, Improves...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    utility, which runs its own diesel fuel bulk storage facility for the diesel generators. However, residential heating oil and fuel for all public buildings except the...

  2. Fuel cell system with combustor-heated reformer

    DOE Patents [OSTI]

    Pettit, William Henry

    2000-01-01

    A fuel cell system including a fuel reformer heated by a catalytic combustor fired by anode effluent and/or fuel from a liquid fuel supply providing fuel for the fuel cell. The combustor includes a vaporizer section heated by the combustor exhaust gases for vaporizing the fuel before feeding it into the combustor. Cathode effluent is used as the principle oxidant for the combustor.

  3. Fundamentals of Understanding & Collecting data for SHOPPs EIA-877 Winter Heating Fuels Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    Data Collection Procedures for Winter Heating Fuels Telephone Survey State Heating Oil and Propane Program (SHOPP) Office of Energy Statistics Office of Petroleum & Biofuels Statistics Petroleum Marketing Statistics Team October 8, 2014 | Washington, D.C. Presentation Roadmap Office of Petroleum and Biofuels Statistics 2 * Survey Overview * Getting Started * Pricing Characteristics * Collecting Additional Information * Weekly Data Submission * Weekly Data Collection Tips * Data

  4. Microfabricated fuel heating value monitoring device

    DOE Patents [OSTI]

    Robinson, Alex L.; Manginell, Ronald P.; Moorman, Matthew W.

    2010-05-04

    A microfabricated fuel heating value monitoring device comprises a microfabricated gas chromatography column in combination with a catalytic microcalorimeter. The microcalorimeter can comprise a reference thermal conductivity sensor to provide diagnostics and surety. Using microfabrication techniques, the device can be manufactured in production quantities at a low per-unit cost. The microfabricated fuel heating value monitoring device enables continuous calorimetric determination of the heating value of natural gas with a 1 minute analysis time and 1.5 minute cycle time using air as a carrier gas. This device has applications in remote natural gas mining stations, pipeline switching and metering stations, turbine generators, and other industrial user sites. For gas pipelines, the device can improve gas quality during transfer and blending, and provide accurate financial accounting. For industrial end users, the device can provide continuous feedback of physical gas properties to improve combustion efficiency during use.

  5. Multi-Function Fuel-Fired Heat Pump

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Multi-Function Fuel-Fired Heat Pump CRADA Ed Vineyard Oak Ridge National Laboratory, ... 10% for a residential multifunction heat pump that provides space conditioning, water ...

  6. Method and apparatus for fuel gas moisturization and heating

    DOE Patents [OSTI]

    Ranasinghe, Jatila; Smith, Raub Warfield

    2002-01-01

    Fuel gas is saturated with water heated with a heat recovery steam generator heat source. The heat source is preferably a water heating section downstream of the lower pressure evaporator to provide better temperature matching between the hot and cold heat exchange streams in that portion of the heat recovery steam generator. The increased gas mass flow due to the addition of moisture results in increased power output from the gas and steam turbines. Fuel gas saturation is followed by superheating the fuel, preferably with bottom cycle heat sources, resulting in a larger thermal efficiency gain compared to current fuel heating methods. There is a gain in power output compared to no fuel heating, even when heating the fuel to above the LP steam temperature.

  7. NREL: Hydrogen and Fuel Cells Research - Market Transformation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Market Transformation NREL's market transformation activities address technical and non-technical barriers to the commercialization of hydrogen and fuel cell technologies to ensure that laboratory advances can be realized in the marketplace. Projects focus on deploying hydrogen and fuel cells in key early markets-specialty vehicles, backup and remote power, portable power, and primary power for critical applications such as hospitals or data centers-and renewable hydrogen production

  8. Developments in U.S. Alternative Fuel Markets

    Reports and Publications (EIA)

    2001-01-01

    The alternative fueled vehicle (AFV)/alternative fuels industry experienced a number of market-related changes in the second half of the 1990s. This article describes each of the alternative transportation fuels and the AFVs in detail. It provides information on the development to date and looks at trends likely to occur in the future.

  9. Report: Efficiency, Alternative Fuels to Impact Market Through 2040

    Office of Energy Efficiency and Renewable Energy (EERE)

    Fuel efficiency improvements and increased use of alternative fuels, will shrink gasoline's share of the fuel market 14% by 2040, according to a new report based on analysis of the U.S. Energy Information Administration in its Annual Energy Outl

  10. Data Analysis of Early Fuel Cell Market Demonstrations (Presentation)

    SciTech Connect (OSTI)

    Kurtz, J.; Ramsden, T.; Wipke, K.; Sprik, S.

    2009-11-17

    Presentation about early fuel cell markets, the National Renewable Energy Laboratory's Hydrogen Secure Data Center and its role in data analysis and demonstrations, and composite data products, and results reported to multiple stakeholders.

  11. 2012 Fuel Cell Technologies Market Report

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    by the U.S. Department of Energy's Fuel Cell Technologies Office within the Office ... valuable contributions of many men and women in government and in the fuel cell industry. ...

  12. Market Transformation: Fuel Cell Early Adoption (Presentation)

    Broader source: Energy.gov [DOE]

    Presented at the DOE Fuel Cell Pre-Solicitation Workshop held January 23-24, 2008 in Golden, Colorado.

  13. Fuel Cells for Supermarkets: Cleaner Energy with Fuel Cell Combined Heat

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Power Systems | Department of Energy for Supermarkets: Cleaner Energy with Fuel Cell Combined Heat and Power Systems Fuel Cells for Supermarkets: Cleaner Energy with Fuel Cell Combined Heat and Power Systems Presented at the Clean Energy States Alliance and U.S. Department of Energy Webinar: Fuel Cells for Supermarkets, April 4, 2011. PDF icon infocallapr11_smith.pdf More Documents & Publications Fuel Cells at Supermarkets: NYSERDA's Perspective Fuel Cell Case Study Hydrogen

  14. 2010 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    none,

    2011-05-01

    This report describes data compiled in 2011 on trends in the fuel cell industry for 2010 with some comparison to previous years.

  15. 2012 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    none,

    2013-10-31

    This report describes data compiled in 2013 on trends in the fuel cell industry for 2012 with some comparison to previous years.

  16. 2012 Fuel Cell Technologies Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    This report describes data compiled in 2013 on trends in the fuel cell industry for 2012 with some comparison to previous years.

  17. 2011 Fuel Cell Technologies Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    This report describes data compiled in 2012 on trends in the fuel cell industry for 2011 with some comparison to previous years.

  18. 2010 Fuel Cell Technologies Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    This report describes data compiled in 2011 on trends in the fuel cell industry for 2010 with some comparison to previous years.

  19. 2011 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    none,

    2012-07-01

    This report describes data compiled in 2012 on trends in the fuel cell industry for 2011 with some comparison to previous years.

  20. Nuclear fuel: a new market dynamic

    SciTech Connect (OSTI)

    Kee, Edward D.

    2007-12-15

    After almost 20 years of low nuclear fuel prices, buyers have come to expect that these low and stable nuclear fuel prices will continue. This conventional wisdom may not reflect the significant changes and higher prices that growing demand, and the end of secondary sources of uranium and enrichment, will bring. (author)

  1. NREL Ignites New Renewable Fuels Heating Plant - News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ignites New Renewable Fuels Heating Plant Innovative DOE Contract Helps Lab Reduce Fuel Use, Carbon Emissions November 20, 2008 Golden, Colo. - With the spark from a high intensity road flare, engineers at the U.S. Department of Energy's National Renewable Energy Laboratory lit its new, smoke-free Renewable Fuels Heating Plant today. The $3.3 million project is the Laboratory's latest step toward operating as a net-zero energy facility. The RFHP will heat NREL's South Table Mountain Campus

  2. Sandia Energy - From Compost to Sustainable Fuels: Heat-Loving...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    From Compost to Sustainable Fuels: Heat-Loving Fungi Are Sequenced Home Renewable Energy Energy Transportation Energy News Modeling Modeling & Analysis From Compost to Sustainable...

  3. Nuclear reactor fuel element having improved heat transfer

    DOE Patents [OSTI]

    Garnier, J.E.; Begej, S.; Williford, R.E.; Christensen, J.A.

    1982-03-03

    A nuclear reactor fuel element having improved heat transfer between fuel material and cladding is described. The element consists of an outer cladding tube divided into an upper fuel section containing a central core of fissionable or mixed fissionable and fertile fuel material, slightly smaller in diameter than the inner surface of the cladding tube and a small lower accumulator section, the cladding tube being which is filled with a low molecular weight gas to transfer heat from fuel material to cladding during irradiation. A plurality of essentially vertical grooves in the fuel section extend downward and communicate with the accumulator section. The radial depth of the grooves is sufficient to provide a thermal gradient between the hot fuel surface and the relatively cooler cladding surface to allow thermal segregation to take place between the low molecular weight heat transfer gas and high molecular weight fission product gases produced by the fuel material during irradiation.

  4. Hydrogen Storage Needs for Early Motive Fuel Cell Markets

    SciTech Connect (OSTI)

    Kurtz, J.; Ainscough, C.; Simpson, L.; Caton, M.

    2012-11-01

    The National Renewable Energy Laboratory's (NREL) objective for this project is to identify performance needs for onboard energy storage of early motive fuel cell markets by working with end users, manufacturers, and experts. The performance needs analysis is combined with a hydrogen storage technology gap analysis to provide the U.S. Department of Energy (DOE) Fuel Cell Technologies Program with information about the needs and gaps that can be used to focus research and development activities that are capable of supporting market growth.

  5. Control apparatus and method for efficiently heating a fuel processor in a fuel cell system

    DOE Patents [OSTI]

    Doan, Tien M.; Clingerman, Bruce J.

    2003-08-05

    A control apparatus and method for efficiently controlling the amount of heat generated by a fuel cell processor in a fuel cell system by determining a temperature error between actual and desired fuel processor temperatures. The temperature error is converted to a combustor fuel injector command signal or a heat dump valve position command signal depending upon the type of temperature error. Logic controls are responsive to the combustor fuel injector command signals and the heat dump valve position command signal to prevent the combustor fuel injector command signal from being generated if the heat dump valve is opened or, alternately, from preventing the heat dump valve position command signal from being generated if the combustor fuel injector is opened.

  6. Model documentation: Electricity Market Module, Electricity Fuel Dispatch Submodule

    SciTech Connect (OSTI)

    Not Available

    1994-04-08

    This report documents the objectives, analytical approach and development of the National Energy Modeling System Electricity Fuel Dispatch Submodule (EFD), a submodule of the Electricity Market Module (EMM). The report catalogues and describes the model assumptions, computational methodology, parameter estimation techniques, model source code, and forecast results generated through the synthesis and scenario development based on these components.

  7. Fuel Cell Project Selected for First Ever Technology-to-Market...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Project Selected for First Ever Technology-to-Market SBIR Award Fuel Cell Project Selected ... electrolyte membrane electrode assemblies for fuel cell and electrolysis applications. ...

  8. Early Stage Market Change and Effects of the Recovery Act Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program -- 2015 Update Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program -- 2015 ...

  9. Early-Stage Market Change and Effects of the Recovery Act Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Early-Stage Market Change and Effects of the Recovery Act Fuel Cell Program Early-Stage Market Change and Effects of the Recovery Act Fuel Cell Program On April 15, 2009, the U.S. ...

  10. Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Dept. Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth ...

  11. U.S. Fuel Cell Market Production and Deployment Continues Strong...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Fuel Cell Market Production and Deployment Continues Strong Growth U.S. Fuel Cell Market Production and Deployment Continues Strong Growth January 8, 2014 - 12:00am Addthis ...

  12. Overview of Aviation Fuel Markets for Biofuels Stakeholders

    SciTech Connect (OSTI)

    Davidson, C.; Newes, E.; Schwab, A.; Vimmerstedt, L.

    2014-07-01

    This report is for biofuels stakeholders interested the U.S. aviation fuel market. Jet fuel production represents about 10% of U.S. petroleum refinery production. Exxon Mobil, Chevron, and BP top producers, and Texas, Louisiana, and California are top producing states. Distribution of fuel primarily involves transport from the Gulf Coast to other regions. Fuel is transported via pipeline (60%), barges on inland waterways (30%), tanker truck (5%), and rail (5%). Airport fuel supply chain organization and fuel sourcing may involve oil companies, airlines, airline consortia, airport owners and operators, and airport service companies. Most fuel is used for domestic, commercial, civilian flights. Energy efficiency has substantially improved due to aircraft fleet upgrades and advanced flight logistic improvements. Jet fuel prices generally track prices of crude oil and other refined petroleum products, whose prices are more volatile than crude oil price. The single largest expense for airlines is jet fuel, so its prices and persistent price volatility impact industry finances. Airlines use various strategies to manage aviation fuel price uncertainty. The aviation industry has established goals to mitigate its greenhouse gas emissions, and initial estimates of biojet life cycle greenhouse gas emissions exist. Biojet fuels from Fischer-Tropsch and hydroprocessed esters and fatty acids processes have ASTM standards. The commercial aviation industry and the U.S. Department of Defense have used aviation biofuels. Additional research is needed to assess the environmental, economic, and financial potential of biojet to reduce greenhouse gas emissions and mitigate long-term upward price trends, fuel price volatility, or both.

  13. The Fuel Cell Mobile Light Project - A DOE Market Transformation Activity |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy The Fuel Cell Mobile Light Project - A DOE Market Transformation Activity The Fuel Cell Mobile Light Project - A DOE Market Transformation Activity Download the presentation slides from the Fuel Cell Technologies Program webinar, "Fuel Cell Mobile Lighting," held on November 13, 2012. PDF icon Fuel Cell Mobile Lighting Webinar Slides More Documents & Publications DOE/Boeing Sponsored Projects in Aviation Fuel Cell Technology at Sandia Fuel Cell Product

  14. Install Waste Heat Recovery Systems for Fuel-Fired Furnaces | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Waste Heat Recovery Systems for Fuel-Fired Furnaces Install Waste Heat Recovery Systems for Fuel-Fired Furnaces This tip sheet recommends installing waste heat recovery systems for fuel-fired furnaces to increase the energy efficiency of process heating systems. PROCESS HEATING TIP SHEET #8 PDF icon Install Waste Heat Recovery Systems for Fuel-Fired Furnaces (September 2005) More Documents & Publications Load Preheating Using Flue Gases from a Fuel-Fired Heating System Using Waste

  15. York Electric Cooperative- Dual Fuel Heat Pump Rebate Program

    Broader source: Energy.gov [DOE]

    York Electric Cooperative, Inc. (YEC) offers a $200 rebate to members who install a dual fuel heat pump in homes or businesses. The rebates are for primary residences, commercial, and industrial...

  16. Refundable Clean Heating Fuel Tax Credit (Corporate)

    Broader source: Energy.gov [DOE]

    The state of New York began offering a corporate income tax credit for biodiesel purchases used for residential space heating and water heating beginning in 2006. The original credit was authorized...

  17. Fuel Cells Market Exceeds $1.3 Billion in Worldwide Sales

    Broader source: Energy.gov [DOE]

    The market for fuel cells is growing, exceeding $1.3 billion in worldwide sales during 2013, according to the recently released "Business Case for Fuel Cells" report from the Fuel Cell Technologies Office.

  18. Cooling, Heating, and Power for Industry: A Market Assessment, August 2003

    Broader source: Energy.gov [DOE]

    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector.

  19. A methodology for assessing the market benefits of alternative motor fuels: The Alternative Fuels Trade Model

    SciTech Connect (OSTI)

    Leiby, P.N.

    1993-09-01

    This report describes a modeling methodology for examining the prospective economic benefits of displacing motor gasoline use by alternative fuels. The approach is based on the Alternative Fuels Trade Model (AFTM). AFTM development was undertaken by the US Department of Energy (DOE) as part of a longer term study of alternative fuels issues. The AFTM is intended to assist with evaluating how alternative fuels may be promoted effectively, and what the consequences of substantial alternative fuels use might be. Such an evaluation of policies and consequences of an alternative fuels program is being undertaken by DOE as required by Section 502(b) of the Energy Policy Act of 1992. Interest in alternative fuels is based on the prospective economic, environmental and energy security benefits from the substitution of these fuels for conventional transportation fuels. The transportation sector is heavily dependent on oil. Increased oil use implies increased petroleum imports, with much of the increase coming from OPEC countries. Conversely, displacement of gasoline has the potential to reduce US petroleum imports, thereby reducing reliance on OPEC oil and possibly weakening OPEC`s ability to extract monopoly profits. The magnitude of US petroleum import reduction, the attendant fuel price changes, and the resulting US benefits, depend upon the nature of oil-gas substitution and the supply and demand behavior of other world regions. The methodology applies an integrated model of fuel market interactions to characterize these effects.

  20. Geography of Existing and Potential Alternative Fuel Markets in the United States

    SciTech Connect (OSTI)

    Johnson, C.; Hettinger, D.

    2014-11-01

    When deploying alternative fuels, it is paramount to match the right fuel with the right location, in accordance with local market conditions. We used six market indicators to evaluate the existing and potential regional market health for each of the five most commonly deployed alternative fuels: electricity (used by plug-in electric vehicles), biodiesel (blends of B20 and higher), E85 ethanol, compressed natural gas (CNG), and propane. Each market indicator was mapped, combined, and evaluated by industry experts. This process revealed the weight the market indicators should be given, with the proximity of fueling stations being the most important indicator, followed by alternative fuel vehicle density, gasoline prices, state incentives, nearby resources, and finally, environmental benefit. Though markets vary among states, no state received 'weak' potential for all five fuels, indicating that all states have an opportunity to use at least one alternative fuel. California, Illinois, Indiana, Pennsylvania, and Washington appear to have the best potential markets for alternative fuels in general, with each sporting strong markets for four of the fuels. Wyoming showed the least potential, with weak markets for all alternative fuels except for CNG, for which it has a patchy market. Of all the fuels, CNG is promising in the greatest number of states--largely because freight traffic provides potential demand for many far-reaching corridor markets and because the sources of CNG are so widespread geographically.

  1. Describing current and potential markets for alternative-fuel vehicles

    SciTech Connect (OSTI)

    1996-03-26

    Motor vehicles are a major source of greenhouse gases, and the rising numbers of motor vehicles and miles driven could lead to more harmful emissions that may ultimately affect the world`s climate. One approach to curtailing such emissions is to use, instead of gasoline, alternative fuels: LPG, compressed natural gas, or alcohol fuels. In addition to the greenhouse gases, pollutants can be harmful to human health: ozone, CO. The Clean Air Act Amendments of 1990 authorized EPA to set National Ambient Air Quality Standards to control this. The Energy Policy Act of 1992 (EPACT) was the first new law to emphasize strengthened energy security and decreased reliance on foreign oil since the oil shortages of the 1970`s. EPACT emphasized increasing the number of alternative-fuel vehicles (AFV`s) by mandating their incremental increase of use by Federal, state, and alternative fuel provider fleets over the new few years. Its goals are far from being met; alternative fuels` share remains trivial, about 0.3%, despite gains. This report describes current and potential markets for AFV`s; it begins by assessing the total vehicle stock, and then it focuses on current use of AFV`s in alternative fuel provider fleets and the potential for use of AFV`s in US households.

  2. Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Adopters | Department of Energy Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market Adopters Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market Adopters Plenary III: Early Market Adopters Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market Adopters Nancy N. Young, Vice President, Environmental Affairs, Airlines for America PDF icon young_bioenergy_2015.pdf More Documents & Publications QER - Comment of Airlines for America

  3. Study of the competitive viability of minority fuel oil marketers. Final report

    SciTech Connect (OSTI)

    1981-09-30

    Previous studies on the competitive viability of the fuel oil heating market had addressed some of the unique problems facing minority fuel oil marketers (MFMs) within the total market sector (TMS). This study focused on identifying and developing quantitative information on MFMs in the TMS. The specific objective was to determine whether the business problems experienced by MFMs were directly related to their minority status or were characterstic of any firm in the TMS operating under comparable conditions. As an overall conclusion, thorough investigation of the MFMs considered to constitute the universe of minoriy firms within the TMS did not reveal any evidence of overt discrimination affecting the competitive viability of MFMs. Upon analysis, the problems reported by MFMs could not be reasonably ascribed to discrimination on the basis of their minority business status. The study, however, did point up problems unique to MFMs as the result of typical operational and financial characteristics. For example, MFMs, compared to the TMS norm, have not been in the market as long and are smaller in terms of total assets, number of employees, number of trucks, number of accounts and annual volume of oil delivered. Their primary customers are low-income families in urban areas. Financial indicators suggest that the average MFM does not have long-term financial stability. The basis for this overall conclusion, derived by analyses of information from MFMs, as well as many independent sources, is summarized in three parts: (1) MFM industry profile; (2) financial analyses; and (3) problem analyses.

  4. Refundable Clean Heating Fuel Tax Credit (Personal)

    Broader source: Energy.gov [DOE]

    The value of the tax credit is $0.01/gallon for each percent of biodiesel blended with conventional home heating oil, up to a maximum of $0.20/ gallon. In other words, the purchaser of a mixture ...

  5. Thermoacoustic sensor for nuclear fuel temperaturemonitoring and heat transfer enhancement

    SciTech Connect (OSTI)

    James A. Smith; Dale K. Kotter; Randall A. Alli; Steven L. Garrett

    2013-05-01

    A new acoustical sensing system for the nuclear power industry has been developed at The Pennsylvania State University in collaboration with Idaho National Laboratories. This sensor uses the high temperatures of nuclear fuel to convert a nuclear fuel rod into a standing-wave thermoacoustic engine. When a standing wave is generated, the sound wave within the fuel rod will be propagated, by acoustic radiation, through the cooling fluid within the reactor or spent fuel pool and can be monitored a remote location external to the reactor. The frequency of the sound can be correlated to an effective temperature of either the fuel or the surrounding coolant. We will present results for a thermoacoustic resonator built into a Nitonic-60 (stainless steel) fuel rod that requires only one passive component and no heat exchangers.

  6. Hydrogen Storage Needs for Early Motive Fuel Cell Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Storage Needs for Early Motive Fuel Cell Markets J. Kurtz, C. Ainscough, L. Simpson, and M. Caton Technical Report NREL/TP-5600-52783 November 2012 NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. National Renewable Energy Laboratory 15013 Denver West Parkway Golden, Colorado 80401 303-275-3000 * www.nrel.gov Contract No. DE-AC36-08GO28308 Hydrogen Storage Needs for Early

  7. Second AEO2-015 Liquid Fuels Markets Working Group Meeting Summary

    U.S. Energy Information Administration (EIA) Indexed Site

    September 24, 2014 MEMORANDUM FOR: JOHN CONTI ASSISTANT ADMINISTRATOR FOR ENERGY ANALYSYS MICHAEL SCHAAL DIRECTOR, OFFICE OF ENERGY ANALYSIS JOHN POWELL TEAM LEADER, LIQUID FUELS MARKET TEAM FROM: LIQUID FUELS MARKET TEAM SUBJECT: Second AEO2015 Liquid Fuels Markets Working Group Meeting Summary (presented on 09-24-2014) Attendees: (EIA) John Powell, Mindi Farber-DeAnda, Mike Cole, Adrian Geagla, David Manowitz, Beth May Seth Meyer (USDA) Austin Brown (NREL) Robert Smith (US DOE) Ben Salisbury

  8. Energy Department Reports: U.S. Fuel Cell Market Production and Deployment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Continues Strong Growth | Department of Energy Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth Energy Department Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth December 22, 2015 - 10:00am Addthis The three reports released by the Energy Department highlight continued strength, progress and innovation in the U.S. fuel cell hydrogen technologies market. The three reports released by the Energy Department highlight continued

  9. Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Continues Strong Growth | Department of Energy Fuel Cell Market Production and Deployment Continues Strong Growth Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth December 19, 2013 - 11:36am Addthis News Media Contact (202) 586-4940 WASHINGTON - The Energy Department released three new reports today showcasing strong growth across the U.S. fuel cell and hydrogen technologies market - continuing America's leadership in clean energy innovation and

  10. Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Continues Strong Growth | Department of Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment Continues Strong Growth December 19, 2013 - 12:00am Addthis The Energy Department released three new reports today showcasing strong growth across the U.S. fuel cell and hydrogen technologies market-€continuing America's leadership in clean energy innovation and providing U.S. businesses

  11. Market development directory for solar industrial process heat systems

    SciTech Connect (OSTI)

    1980-02-01

    The purpose of this directory is to provide a basis for market development activities through a location listing of key trade associations, trade periodicals, and key firms for three target groups. Potential industrial users and potential IPH system designers were identified as the prime targets for market development activities. The bulk of the directory is a listing of these two groups. The third group, solar IPH equipment manufacturers, was included to provide an information source for potential industrial users and potential IPH system designers. Trade associates and their publications are listed for selected four-digit Standard Industrial Code (SIC) industries. Since industries requiring relatively lower temperature process heat probably will comprise most of the near-term market for solar IPH systems, the 80 SIC's included in this chapter have process temperature requirements less than 350/sup 0/F. Some key statistics and a location list of the largest plants (according to number of employees) in each state are included for 15 of the 80 SIC's. Architectural/engineering and consulting firms are listed which are known to have solar experience. Professional associated and periodicals to which information on solar IPH sytstems may be directed also are included. Solar equipment manufacturers and their associations are listed. The listing is based on the SERI Solar Energy Information Data Base (SEIDB).

  12. U.S. Fuel Cell Market Production and Deployment Continues Strong Growth |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy U.S. Fuel Cell Market Production and Deployment Continues Strong Growth U.S. Fuel Cell Market Production and Deployment Continues Strong Growth January 8, 2014 - 12:00am Addthis The Energy Department released three new reports on December 19 showcasing strong growth across the U.S. fuel cell and hydrogen technologies market. According to these reports, the United States continues to be one of the world's largest and fastest growing markets for fuel cell and hydrogen

  13. Identification and Characterization of Near-Term Direct Hydrogen PEM Fuel Cell Markets

    Fuel Cell Technologies Publication and Product Library (EERE)

    This document provides information about near-term markets (such as for forklifts and telecommunications) for proton exchange membrane fuel cells.

  14. Identification and Characterization of Near-Term Direct Hydrogen PEM Fuel Cell Markets

    SciTech Connect (OSTI)

    Mahadevan, K.; Judd, K.; Stone, H.; Zewatsky, J.; Thomas, A.; Mahy, H.; Paul, D.

    2007-04-15

    This document provides information about near-term markets (such as for forklifts and telecommunications) for proton exchange membrane fuel cells.

  15. Solar Thermochemical Fuels Production: Solar Fuels via Partial Redox Cycles with Heat Recovery

    SciTech Connect (OSTI)

    2011-12-19

    HEATS Project: The University of Minnesota is developing a solar thermochemical reactor that will efficiently produce fuel from sunlight, using solar energy to produce heat to break chemical bonds. The University of Minnesota is envisioning producing the fuel by using partial redox cycles and ceria-based reactive materials. The team will achieve unprecedented solar-to-fuel conversion efficiencies of more than 10% (where current state-of-the-art efficiency is 1%) by combined efforts and innovations in material development, and reactor design with effective heat recovery mechanisms and demonstration. This new technology will allow for the effective use of vast domestic solar resources to produce precursors to synthetic fuels that could replace gasoline.

  16. RTP Green Fuel: A Proven Path to Renewable Heat and Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewable Fuel Oil - A Commercial Perspective Steve Lupton Technical Information Exchange on Pyrolysis Oil: Potential for a Renewable Heating Oil Substitution Fuel in New ...

  17. The Market - Who Needs Heat Pump Water Heaters? (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Journal Article: The Market - Who Needs Heat Pump Water Heaters? Citation Details In-Document Search Title: The Market - Who Needs Heat Pump Water Heaters? Heat pump water heaters use less power than traditional ones, but they cost more. Does the investment make sense for you? for your neighbor? Well, it depends, and it's a question not only for consumers, but also for manufacturers, retailers and efficiency programs seeking to understand their markets, set prices and incentives, and

  18. The market and technical potential for combined heat and power in the commercial/institutional sector

    SciTech Connect (OSTI)

    None, None

    2000-01-01

    Report of an analysis to determine the potential for cogeneration or combined heat and power (CHP) in the commercial/institutional market.

  19. 2007 Fuel Cell Technologies Market Report | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    power, and transportation -- including data on the range of fuel cell technologies -- polymer electrolyte membrane fuel cell (PEMFC), solid oxide fuel cell (SOFC), alkaline...

  20. The Fuel Cell Mobile Light Project - A DOE Market Transformation...

    Broader source: Energy.gov (indexed) [DOE]

    Download the presentation slides from the Fuel Cell Technologies Program webinar, "Fuel Cell Mobile Lighting," held on November 13, 2012. PDF icon Fuel Cell Mobile Lighting Webinar ...

  1. GenSys Blue: Fuel Cell Heating Appliance | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GenSys Blue: Fuel Cell Heating Appliance GenSys Blue: Fuel Cell Heating Appliance Presented at the High Temperature Membrane Working Group Meetng, Nov. 16, 2009. PDF icon ...

  2. Load Preheating Using Flue Gases from a Fuel-Fired Heating System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Load Preheating Using Flue Gases from a Fuel-Fired Heating System This tip sheet discusses ... PROCESS HEATING TIP SHEET 9 PDF icon Load Preheating Using Flue Gases from a Fuel-Fired ...

  3. Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power - Fact Sheet, 2015 Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power - Fact Sheet, 2015 TDA Research ...

  4. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CommercialInstitutional Sector, January 2000 The Market and Technical Potential for ... and developed estimates of additional technical potential for CHP in these markets. ...

  5. Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    -- 2015 Update | Department of Energy Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program -- 2015 Update Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program -- 2015 Update A 2015 Update to "Early Stage Market Change and Effects of the Recovery Act Fuel Cell Program." A report prepared for Lawrence Berkeley National Laboratory, April 17, 2015. PDF icon 2015 Update Report More Documents & Publications Early-Stage Market Change and

  6. Alternative Fuels Data Center: The Heat Is on in St. Louis Buses

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    The Heat Is on in St. Louis Buses to someone by E-mail Share Alternative Fuels Data Center: The Heat Is on in St. Louis Buses on Facebook Tweet about Alternative Fuels Data Center: The Heat Is on in St. Louis Buses on Twitter Bookmark Alternative Fuels Data Center: The Heat Is on in St. Louis Buses on Google Bookmark Alternative Fuels Data Center: The Heat Is on in St. Louis Buses on Delicious Rank Alternative Fuels Data Center: The Heat Is on in St. Louis Buses on Digg Find More places to share

  7. Assessment of Large Combined Heat and Power Market, April 2004 | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Large Combined Heat and Power Market, April 2004 Assessment of Large Combined Heat and Power Market, April 2004 This 2004 report summarizes an assessment of the 2-50 MW combined heat and power (CHP) market and near-term opportunities for a fixed set of CHP technologies. This size range has been the biggest contributor to the traditional inside-the-fence CHP market to date. PDF icon chp_large.pdf More Documents & Publications CHP Assessment, California Energy Commission, October

  8. Fossil fuel-fired peak heating for geothermal greenhouses

    SciTech Connect (OSTI)

    Rafferty, K.

    1997-01-01

    Greenhouses are a major application of low-temperature geothermal resources. In virtually all operating systems, the geothermal fluid is used in a hot water heating system to meet 100% of both the peak and annual heating requirements of the structure. This strategy is a result of the relatively low costs associated with the development of most US geothermal direct-use resources and past tax credit programs which penalized systems using any conventional fuel sources. Increasingly, greenhouse operations will encounter limitations in available geothermal resource flow due either to production or disposal considerations. As a result, it will be necessary to operate additions at reduced water temperatures reflective of the effluent from the existing operations. Water temperature has a strong influence on heating system design. Greenhouse operators tend to have unequivocal preferences regarding heating system equipment. Many growers, particularly cut flower and bedding plant operators, prefer the {open_quotes}bare tube{close_quotes} type heating system. This system places small diameter plastic tubes under the benches or adjacent to the plants. Hot water is circulated through the tubes providing heat to the plants and the air in the greenhouse. Advantages include the ability to provide the heat directly to the plants, low cost, simple installation and the lack of a requirement for fans to circulate air. The major disadvantage of the system is poor performance at low (<140{degrees}F) water temperatures, particularly in cold climates. Under these conditions, the quantity of tubing required to meet the peak heating load is substantial. In fact, under some conditions, it is simply impractical to install sufficient tubing in the greenhouse to meet the peak heating load.

  9. Panel 3, PEM Electrolysis Technology R&D and Near-Term Market...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Markets Power Plants Energy Markets capability Power Plants Heat Treating Semiconductors Laboratories Government Fueling Backup Power Renewable Energy Storage 2 Energy ...

  10. Fuel Accident Condition Simulator (FACS) Furnace for Post-Irradiation Heating Tests of VHTR Fuel Compacts

    SciTech Connect (OSTI)

    Paul A Demkowicz; Paul Demkowicz; David V Laug

    2010-10-01

    Abstract Fuel irradiation testing and post-irradiation examination are currently in progress as part of the Next Generation Nuclear Plant Fuels Development and Qualification Program. The PIE campaign will include extensive accident testing of irradiated very high temperature reactor fuel compacts to verify fission product retention characteristics at high temperatures. This work will be carried out at both the Idaho National Laboratory (INL) and the Oak Ridge National Laboratory, beginning with accident tests on irradiated fuel from the AGR-1 experiment in 2010. A new furnace system has been designed, built, and tested at INL to perform high temperature accident tests. The Fuel Accident Condition Simulator furnace system is designed to heat fuel specimens at temperatures up to 2000C in helium while monitoring the release of volatile fission metals (e.g. Cs, Ag, Sr, Eu, and I) and fission gases (Kr, Xe). Fission gases released from the fuel to the sweep gas are monitored in real time using dual cryogenic traps fitted with high purity germanium detectors. Condensable fission products are collected on a plate attached to a water-cooled cold finger that can be exchanged periodically without interrupting the test. Analysis of fission products on the condensation plates involves dry gamma counting followed by chemical analysis of selected isotopes. This paper will describe design and operational details of the Fuel Accident Condition Simulator (FACS) furnace system, as well as preliminary system calibration results.

  11. Connecticut Fuel Cell Activities: Markets, Programs, and Models

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joel M. Rinebold 2 2 * Connecticut Hydrogen Roadmap (Fuel Cell Economic Development Plan) ... Connecticut Hydrogen Roadmap 4 4 Economic Multipliers * For each job the hydrogen and fuel ...

  12. Connecticut Fuel Cell Activities: Markets, Programs, and Models...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Job Creation Analysis in the Hydrogen and Fuel Cell Industry State of the States: Fuel Cells in America 2011 2009 DOE Hydrogen Program Review ...

  13. Early Markets: Fuel Cells for Material Handling Equipment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Material Handling Equipment Overview Fuel cells can be used to produce power for many ... natural gas, or biogas to electricity, fuel cells can effciently provide power while ...

  14. EIA model documentation: Electricity market module - electricity fuel dispatch

    SciTech Connect (OSTI)

    1997-01-01

    This report documents the National Energy Modeling System Electricity Fuel Dispatch Submodule (EFD), a submodule of the Electricity Market Module (EMM) as it was used for EIA`s Annual Energy Outlook 1997. It replaces previous documentation dated March 1994 and subsequent yearly update revisions. The report catalogues and describes the model assumptions, computational methodology, parameter estimation techniques, model source code, and forecast results generated through the synthesis and scenario development based on these components. This document serves four purposes. First, it is a reference document providing a detailed description of the model for reviewers and potential users of the EFD including energy experts at the Energy Information Administration (EIA), other Federal agencies, state energy agencies, private firms such as utilities and consulting firms, and non-profit groups such as consumer and environmental groups. Second, this report meets the legal requirement of the Energy Information Administration (EIA) to provide adequate documentation in support of its statistical and forecast reports. Third, it facilitates continuity in model development by providing documentation which details model enhancements that were undertaken for AE097 and since the previous documentation. Last, because the major use of the EFD is to develop forecasts, this documentation explains the calculations, major inputs and assumptions which were used to generate the AE097.

  15. Refiner/marketer targets production of transportation fuels and distillates

    SciTech Connect (OSTI)

    Thompson, J.E.

    1997-01-01

    Citgo Petroleum Corp., the wholly owned subsidiary of Petroleos de Venezuela, S.A. (PDVSA), the Venezuelan national oil company, owns two gasoline producing refineries, a 305,000-b/d system in Lake Charles, La., and a 130,000-b/d facility in Corpus Christi, Texas. Each is considered a deep conversion facility capable of converting heavy, sour crudes into a high percentage of transportation fuels and distillates. Two smaller refineries, one in Paulsboro, N.J., and one in Savannah, GA., have the capacity to process 40,000 b/d and 28,000 b/d of crude, respectively, for asphalt products. In the past two years, Citgo`s light oils refineries operated safely and reliably with a minimum of unscheduled shutdowns. An ongoing emphasis to increase reliability has resulted in extended run lengths at the refineries. Citgo has invested $314 million at its facilities in 1995, much of this toward environmental and regulatory projects, such as the new waste water treatment unit at the Lake Charles refinery. Over the next few years, Citgo expects to complete $1.5 billion in capital spending for major processing units such as a 60,000-b/d FCC feed hydrotreater unit at the Lake Charles refinery and crude expansion at the Corpus Christi refinery. Product exchanges and expanded transport agreements are allowing Citgo to extend its marketing reach.

  16. Fuel Cell Technologies Office Launches National Laboratory Tech-to-Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Activities | Department of Energy Office Launches National Laboratory Tech-to-Market Activities Fuel Cell Technologies Office Launches National Laboratory Tech-to-Market Activities November 3, 2014 - 5:32pm Addthis The U.S. Department of Energy's (DOE's) Fuel Cell Technologies Office (FCTO) announces the launch of the National Laboratory Tech-to-Market activities taking place at the 2014 Fuel Cell Seminar and Energy Exposition (FCS&EE) on November 11 in Los Angeles, California. In an

  17. Fuel-Flexible Microturbine and Gasifier System for Combined Heat and Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Fuel-Flexible Microturbine and Gasifier System for Combined Heat and Power Fuel-Flexible Microturbine and Gasifier System for Combined Heat and Power Capstone Turbine Corporation, in collaboration with the University of California-Irvine, Packer Engineering, and Argonne National Laboratory, will develop and demonstrate a prototype microturbine combined heat and power system fueled by synthesis gas and integrated with a biomass gasifier, enabling reduced fossil fuel

  18. Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power to

    Office of Scientific and Technical Information (OSTI)

    Replace Fossil Fuels, Final Technical Report (Technical Report) | SciTech Connect Technical Report: Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power to Replace Fossil Fuels, Final Technical Report Citation Details In-Document Search Title: Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power to Replace Fossil Fuels, Final Technical Report The primary objectives of this work can be summed into two major categories. Firstly, the fundamentals of the combustion of

  19. Early-Stage Market Change and Effects of the Recovery Act Fuel Cell Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Early-Stage Market Change and Effects of the Recovery Act Fuel Cell Program Early-Stage Market Change and Effects of the Recovery Act Fuel Cell Program On April 15, 2009, the U.S. Department of Energy (DOE) announced $41.9 million in funding for 12 fuel cell (FC) projects under the American Recovery and Reinvestment Act (ARRA). This effort, denoted in this document as the American Recovery and Reinvestment Act Fuel Cell Program (ARRA-FCP), was intended to accelerate FC

  20. Business Case for a Micro-Combined Heat and Power Fuel Cell System in Commercial Applications

    SciTech Connect (OSTI)

    Brooks, Kriston P.; Makhmalbaf, Atefe; Anderson, David M.; Amaya, Jodi P.; Pilli, Siva Prasad; Srivastava, Viraj; Upton, Jaki F.

    2013-10-30

    Combined heat and power fuel cell systems (CHP-FCSs) provide consistent electrical power and hot water with greater efficiency and lower emissions than alternative sources. These systems can be used either as baseload, grid-connected, or as off-the-grid power sources. This report presents a business case for CHP-FCSs in the range of 5 to 50 kWe. Systems in this power range are considered micro-CHP-FCS. For this particular business case, commercial applications rather than residential or industrial are targeted. To understand the benefits of implementing a micro-CHP-FCS, the characteristics that determine their competitive advantage must first be identified. Locations with high electricity prices and low natural gas prices are ideal locations for micro-CHP-FCSs. Fortunately, these high spark spread locations are generally in the northeastern area of the United States and California where government incentives are already in place to offset the current high cost of the micro-CHP-FCSs. As a result of the inherently high efficiency of a fuel cell and their ability to use the waste heat that is generated as a CHP, they have higher efficiency. This results in lower fuel costs than comparable alternative small-scale power systems (e.g., microturbines and reciprocating engines). A variety of markets should consider micro-CHP-FCSs including those that require both heat and baseload electricity throughout the year. In addition, the reliable power of micro-CHP-FCSs could be beneficial to markets where electrical outages are especially frequent or costly. Greenhouse gas emission levels from micro-CHP-FCSs are 69 percent lower, and the human health costs are 99.9 percent lower, than those attributed to conventional coal-fired power plants. As a result, FCSs can allow a company to advertise as environmentally conscious and provide a bottom-line sales advantage. As a new technology in the early stages of adoption, micro-CHP-FCSs are currently more expensive than alternative technologies. As the technology gains a foothold in its target markets and demand increases, the costs will decline in response to improved manufacturing efficiencies, similar to trends seen with other technologies. Transparency Market Research forecasts suggest that the CHP-FCS market will grow at a compound annual growth rate of greater than 27 percent over the next 5 years. These production level increases, coupled with the expected low price of natural gas, indicate the economic payback period will move to less than 5 years over the course of the next 5 years. To better understand the benefits of micro-CHP-FCSs, The U.S. Department of Energy worked with ClearEdge Power to install fifteen 5-kWe fuel cells in the commercial markets of California and Oregon. Pacific Northwest National Laboratory is evaluating these systems in terms of economics, operations, and their environmental impact in real-world applications. As expected, the economic analysis has indicated that the high capital cost of the micro-CHP-FCSs results in a longer payback period than typically is acceptable for all but early-adopter market segments. However, a payback period of less than 3 years may be expected as increased production brings system cost down, and CHP incentives are maintained or improved.

  1. Global Fuel Cells Market to Value USD910.3 million by 2018 |...

    Open Energy Info (EERE)

    Global Fuel Cells Market to Value USD910.3 million by 2018 Home > Groups > Renewable Energy RFPs John55364's picture Submitted by John55364(100) Contributor 15 May, 2015 - 02:14...

  2. Assumptions for Annual Energy Outlook 2014: Liquid Fuels Markets Working Group

    U.S. Energy Information Administration (EIA) Indexed Site

    4: Liquid Fuels Markets Working Group AEO2014 Liquid Fuels Markets Working Group Meeting Office of Petroleum, Natural Gas & Biofuels Analysis July 24, 2013 | Washington, DC WORKING GROUP PRESENTATION FOR DISCUSSION PURPOSES DO NOT QUOTE OR CITE AS RESULTS ARE SUBJECT TO CHANGE Discussion topics Office of Petroleum, Natural Gas, & Biofuels Analysis Working Group Presentation for Discussion Purposes Washington DC, July 24, 2013 DO NOT QUOTE OR CITE as results are subject to change 2 *

  3. Coal-fueled high-speed diesel engine development: Task 2, Market assessment and economic analysis

    SciTech Connect (OSTI)

    Kakwani, R. M.; Wilson, Jr., R. P.; Winsor, R. E.

    1991-12-01

    Based on the preliminary coal engine design developed, this task was conducted to identify the best opportunity(s) to enter the market with the future coal-fueled, high-speed diesel engine. The results of this market and economic feasibility assessment will be used to determine what specific heavy duty engine application(s) are most attractive for coal fuel, and also define basic economic targets for the engine to be competitive.

  4. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Domestic hot water, space heating, pools Museums 100 kW - 1+ MW Space heating, domestic ... 15 0 Golf Clubs 14,040 3,800 820 205 30 Museums 9,090 330 290 50 0 Correctional ...

  5. Describing Current & Potential Markets for Alternative-Fuel Vehicles

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy, and Safety Data" on alternative fuels and alternative-fuel vehicles. No specific projects are currently underway. Some related data may be developed as part of the EPACT...

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  7. Numerical simulation of gas dynamics and heat exchange tasks in fuel assemblies of the nuclear reactors

    SciTech Connect (OSTI)

    Zhuchenko, S. V.

    2014-11-12

    This report presents a PC-based program for solution gas dynamics and heat exchange mathematical tasks in fuel assemblies of the fast-neutron nuclear reactors. A fuel assembly consisting of bulk heat-generating elements, which are integrated together by the system of supply and pressure manifolds, is examined. Spherical heat-generating microelements, which contain nuclear fuel, are pulled into the heat-generating elements. Gaseous coolant proceed from supply manifolds to heat-generating elements, where it withdraws the nuclear reaction heat and assembles in pressure manifolds.

  8. Natural convection heat transfer within horizontal spent nuclear fuel assemblies

    SciTech Connect (OSTI)

    Canaan, R.E.

    1995-12-01

    Natural convection heat transfer is experimentally investigated in an enclosed horizontal rod bundle, which characterizes a spent nuclear fuel assembly during dry storage and/or transport conditions. The basic test section consists of a square array of sixty-four stainless steel tubular heaters enclosed within a water-cooled rectangular copper heat exchanger. The heaters are supplied with a uniform power generation per unit length while the surrounding enclosure is maintained at a uniform temperature. The test section resides within a vacuum/pressure chamber in order to subject the assembly to a range of pressure statepoints and various backfill gases. The objective of this experimental study is to obtain convection correlations which can be used in order to easily incorporate convective effects into analytical models of horizontal spent fuel systems, and also to investigate the physical nature of natural convection in enclosed horizontal rod bundles in general. The resulting data consist of: (1) measured temperatures within the assembly as a function of power, pressure, and backfill gas; (2) the relative radiative contribution for the range of observed temperatures; (3) correlations of convective Nusselt number and Rayleigh number for the rod bundle as a whole; and (4) correlations of convective Nusselt number as a function of Rayleigh number for individual rods within the array.

  9. PADD 1 and PADD 3 Transportation Fuels Markets

    Reports and Publications (EIA)

    2016-01-01

    This study examines supply, consumption, and distribution of transportation fuels in Petroleum Administration for Defense Districts (PADDs) 1 and 3, or the U.S. East Coast and the Gulf Coast, respectively. The East Coast region includes states from Maine to Florida along the U.S. Atlantic Coast. The Gulf Coast region comprises states between New Mexico in the west to Alabama in the east along the Gulf of Mexico. For this study, transportation fuels include gasoline, diesel fuel and jet fuel. Residual fuel oil supply is also analyzed where applicable.

  10. The Market and Technical Potential for Combined Heat and Power in the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial/Institutional Sector, January 2000 | Department of Energy Commercial/Institutional Sector, January 2000 The Market and Technical Potential for Combined Heat and Power in the Commercial/Institutional Sector, January 2000 ONSITE SYCOM Energy Corporation (OSEC) assisted the U.S. Department of Energy's Energy Information Administration in determining the potential for cogeneration or combined heat and power (CHP) in the commercial/institutional market. As part of this effort, in this

  11. The Market and Technical Potential for Combined Heat and Power in the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Sector, January 2000 | Department of Energy Industrial Sector, January 2000 The Market and Technical Potential for Combined Heat and Power in the Industrial Sector, January 2000 This January 2000 ONSITE SYCOM Energy Corporation (OSEC) report provides information on the potential for cogeneration or combined heat and power (CHP) in the industrial market. As part of this effort, OSEC has characterized typical technologies used in industrial CHP, analyzed existing CHP capacity in

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  13. In-Cylinder Mechanisms of PCI Heat-Release Rate Control by Fuel Reactivity Stratification

    Broader source: Energy.gov [DOE]

    Explores in-cylinder mechanisms by which fuel reactivity stratification via a two fuel system affects premixed charge compression ignition heat release rate to achieve diesel-like efficiency

  14. Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power

    Broader source: Energy.gov [DOE]

    With their clean and quiet operation, fuel cells represent a promising means of implementing small-scale distributed power generation in the future. Waste heat from the fuel cell can be harnessed...

  15. Portland Community College Celebrates Commissioning of Combined Heat and Power Fuel Cell System

    Broader source: Energy.gov [DOE]

    U.S. Energy Secretary Steven Chu today applauded the commissioning of a combined heat and power (CHP) fuel cell system at Portland Community College in Oregon. The CHP fuel cell system will help...

  16. Case Study: Fuel Cells Provide Combined Heat and Power at Verizon...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Case Study: Fuel Cells Provide Com- bined Heat and Power at Verizon's Garden City Central ... installed a 1.4 MW phosphoric acid fuel cell (PAFC) system, consisting of seven ...

  17. RTP Green Fuel: A Proven Path to Renewable Heat and Power | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy RTP Green Fuel: A Proven Path to Renewable Heat and Power RTP Green Fuel: A Proven Path to Renewable Heat and Power Steve Lupton presentation at the May 9, 2012, Pyrolysis Oil Worskshop on RTP green fuel. PDF icon pyrolysis_lupton.pdf More Documents & Publications Known Challenges Associated with the Production, Transportation, Storage and Usage of Pyrolysis Oil in Residential and Industrial Settings Cellulosic Liquid Fuels Commercial Production Today Technical Information

  18. Combined Heat and Power: Connecting the Gap between Markets and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... In theory, these changes opened the market to competing ... to the electric power transmission and distribution (T&D) ... is dangerous both to utility line workers and the public. ...

  19. Secretary Chu Announces $41.9 Million to Spur Growth of Fuel Cell Markets |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 1.9 Million to Spur Growth of Fuel Cell Markets Secretary Chu Announces $41.9 Million to Spur Growth of Fuel Cell Markets April 15, 2009 - 12:00am Addthis WASHINGTON, DC -- To expand the use of clean and renewable energy sources and reduce America's dependence on foreign oil, Energy Secretary Steven Chu today announced $41.9 million in American Recovery and Reinvestment Act funding for fuel cell technology. These efforts will accelerate the commercialization and

  20. EA-1573-S1: Proposed Renewable Fuel Heat Plant Improvements at...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the National Renewable Energy Laboratory South Table Mountain Site, Golden, CO EA-1573-S1: Proposed Renewable Fuel Heat Plant Improvements at the National Renewable Energy...

  1. Case Study: Fuel Cells Provide Combined Heat and Power at Verizon...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Provide Combined Heat and Power at Verizon's Garden Central Office Case Study: Fuel Cells Provide Combined Heat and Power at Verizon's Garden Central Office This is a case study ...

  2. High Temperature Fuel Cell Tri-Generation of Power, Heat & H2...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tri-Generation of Power, Heat & H2 from Biogas High Temperature Fuel Cell Tri-Generation of Power, Heat & H2 from Biogas Success story about using waste water treatment gas for ...

  3. Moving toward a commercial market for hydrogen fuel cell vehicles

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Promoting fuel cell vehicle commercialization as a means of moving towards a sustainable energy future, increasing energy efficiency and reducing or eliminating air pollution and ...

  4. Report: Efficiency, Alternative Fuels to Impact Market Through...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    analyzes projections made by the U.S. Energy Information Administration in its Annual Energy Outlook 2014. Liquid fuelsgasoline, diesel fuel, and E85, which can...

  5. Liquid Fuels Market Model of the National Energy Modeling System...

    Gasoline and Diesel Fuel Update (EIA)

    correlations), AIChE papers, Petroleum Review. * An extensive review of foreign journals obtained with the aid of ORNL for the high-density jet fuel study. * Contractor...

  6. Liquid Fuels Market Module of the National Energy Modeling System...

    Gasoline and Diesel Fuel Update (EIA)

    correlations), AIChE papers, Petroleum Review. * An extensive review of foreign journals obtained with the aid of ORNL for the high-density jet fuel study. * Contractor...

  7. Projected Biomass Utilization for Fuels and Power in a Mature Market

    Broader source: Energy.gov [DOE]

    The U.S. biomass resource can be used several ways that provide domestic, renewable energy to users. Understanding the capacity of the biomass resource, its potential in energy markets, and the most economic utilization of biomass is important in policy development and project selection. This study analyzed the potential for biomass within markets and the competition between them. The study found that biomass has the potential to compete well in the jet fuel and gasoline markets, penetration of biomass in markets is likely to be limited by the size of the resource, and that biomass is most cost effectively used for fuels instead of power in mature markets unless carbon capture and sequestration is available and the cost of carbon is around $80/metric ton CO2e.

  8. Environmental assessment for radioisotope heat source fuel processing and fabrication

    SciTech Connect (OSTI)

    Not Available

    1991-07-01

    DOE has prepared an Environmental Assessment (EA) for radioisotope heat source fuel processing and fabrication involving existing facilities at the Savannah River Site (SRS) near Aiken, South Carolina and the Los Alamos National Laboratory (LANL) near Los Alamos, New Mexico. The proposed action is needed to provide Radioisotope Thermoelectric Generators (RTG) to support the National Aeronautics and Space Administration's (NASA) CRAF and Cassini Missions. Based on the analysis in the EA, DOE has determined that the proposed action does not constitute a major Federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act (NEPA) of 1969. Therefore, an Environmental Impact Statement is not required. 30 refs., 5 figs.

  9. Experimental Investigation of Turbine Vane Heat Transfer for Alternative Fuels

    SciTech Connect (OSTI)

    Nix, Andrew Carl

    2015-03-23

    The focus of this program was to experimentally investigate advanced gas turbine cooling schemes and the effects of and factors that contribute to surface deposition from particulate matter found in coal syngas exhaust flows on turbine airfoil heat transfer and film cooling, as well as to characterize surface roughness and determine the effects of surface deposition on turbine components. The program was a comprehensive, multi-disciplinary collaborative effort between aero-thermal and materials faculty researchers and the Department of Energy, National Energy Technology Laboratory (NETL). The primary technical objectives of the program were to evaluate the effects of combustion of syngas fuels on heat transfer to turbine vanes and blades in land-based power generation gas turbine engines. The primary questions to be answered by this investigation were; What are the factors that contribute to particulate deposition on film cooled gas turbine components? An experimental program was performed in a high-temperature and pressure combustion rig at the DOE NETL; What is the effect of coal syngas combustion and surface deposition on turbine airfoil film cooling? Deposition of particulate matter from the combustion gases can block film cooling holes, decreasing the flow of the film coolant and the film cooling effectiveness; How does surface deposition from coal syngas combustion affect turbine surface roughness? Increased surface roughness can increase aerodynamic losses and result in decreased turbine hot section efficiency, increasing engine fuel consumption to maintain desired power output. Convective heat transfer is also greatly affected by the surface roughness of the airfoil surface; Is there any significant effect of surface deposition or erosion on integrity of turbine airfoil thermal barrier coatings (TBC) and do surface deposits react with the TBC in any way to decrease its thermal insulating capability? Spallation and erosion of TBC is a persistent problem in modern turbine engines; and What advancements in film cooling hole geometry and design can increase effectiveness of film cooling in turbines burning high-hydrogen coal syngas due to the higher heat loads and mass flow rates of the core flow? Experimental and numerical investigations of advanced cooling geometries that can improve resistance to surface deposition were performed. The answers to these questions were investigated through experimental measurements of turbine blade surface temperature and coolant coverage (via infrared camera images and thermocouples) and time-varying surface roughness in the NETL high-pressure combustion rig with accelerated, simulated surface deposition and advanced cooling hole concepts, coupled with detailed materials analysis and characterization using conventional methods of Scanning Electron Microscopy (SEM), Transmission Electron Microscopy (TEM), X-Ray Diffraction (XRD), 3-D Surface Topography (using a 3-D stylus profilometer). Detailed surface temperatures and cooling effectiveness could not be measured due to issues with the NETL infrared camera system. In collaboration with faculty startup funding from the principal investigator, experimental and numerical investigations were performed of an advanced film cooling hole geometry, the anti-vortex hole (AVH), focusing on improving cooling effectiveness and decreasing the counter-rotating vortex of conventional cooling holes which can entrain mainstream particulate matter to the surface. The potential benefit of this program is in gaining a fundamental understanding of how the use of alternative fuels will effect the operation of modern gas turbine engines, providing valuable data for more effective cooling designs for future turbine systems utilizing alternative fuels.

  10. Redundancy of Supply in the International Nuclear Fuel Fabrication Market: Are Fabrication Services Assured?

    SciTech Connect (OSTI)

    Seward, Amy M.; Toomey, Christopher; Ford, Benjamin E.; Wood, Thomas W.; Perkins, Casey J.

    2011-11-14

    For several years, Pacific Northwest National Laboratory (PNNL) has been assessing the reliability of nuclear fuel supply in support of the U.S. Department of Energy/National Nuclear Security Administration. Three international low enriched uranium reserves, which are intended back up the existing and well-functioning nuclear fuel market, are currently moving toward implementation. These backup reserves are intended to provide countries credible assurance that of the uninterrupted supply of nuclear fuel to operate their nuclear power reactors in the event that their primary fuel supply is disrupted, whether for political or other reasons. The efficacy of these backup reserves, however, may be constrained without redundant fabrication services. This report presents the findings of a recent PNNL study that simulated outages of varying durations at specific nuclear fuel fabrication plants. The modeling specifically enabled prediction and visualization of the reactors affected and the degree of fuel delivery delay. The results thus provide insight on the extent of vulnerability to nuclear fuel supply disruption at the level of individual fabrication plants, reactors, and countries. The simulation studies demonstrate that, when a reasonable set of qualification criteria are applied, existing fabrication plants are technically qualified to provide backup fabrication services to the majority of the world's power reactors. The report concludes with an assessment of the redundancy of fuel supply in the nuclear fuel market, and a description of potential extra-market mechanisms to enhance the security of fuel supply in cases where it may be warranted. This report is an assessment of the ability of the existing market to respond to supply disruptions that occur for technical reasons. A forthcoming report will address political disruption scenarios.

  11. Global Heat Exchangers Market to be driven by Rapidly Expanding...

    Open Energy Info (EERE)

    by Rapidly Expanding End-user Industries Home > Groups > Renewable Energy RFPs Wayne31jan's picture Submitted by Wayne31jan(150) Contributor 2 July, 2015 - 00:43 Heat...

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  13. Home Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heating Home Heating Energy Saver 101 Infographic: Home Heating Energy Saver 101 Infographic: Home Heating Everything you need to know about home heating, including how heating systems work, the different types on the market and proper maintenance. Read more Thermostats Thermostats Save money on heating by automatically setting back your thermostat when you are asleep or away. Read more Wood and Pellet Heating Wood and Pellet Heating Wood and pellets are renewable fuel sources, and modern wood

  14. Hydrogen Fuel Cell Performance in the Key Early Markets of Material Handling Equipment and Backup Power (Presentation)

    SciTech Connect (OSTI)

    Kurtz, J.; Sprik, S.; Ramsden, T.; Saur, G.; Ainscough, C.; Post, M.; Peters, M.

    2013-10-01

    This presentation summarizes the results of NREL's analysis of hydrogen fuel cell performance in the key early markets of material handling equipment (MHE) and backup power.

  15. Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA); Quarter 1 2012 Composite Data Products - Deployment (Presentation)

    SciTech Connect (OSTI)

    Kurtz, J.; Wipke, K.; Sprik, S.; Ramsden, T.; Ainscough, C.

    2012-06-01

    This presentation is about the Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA). Quarter 1 2012 Composite Data Products - Deployment March 8, 2012.

  16. Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA); November 2011 Composite Data Products - Deployment (Presentation)

    SciTech Connect (OSTI)

    Kurtz, J.; Wipke, K.; Sprik, S.; Ramsden, T.; Ainscough, C.

    2012-06-01

    This presentation is about the Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA). November 2011 Composite Data Products - Deployment November 30, 2011.

  17. DME: The next market breakthrough or a methanol-related fuel

    SciTech Connect (OSTI)

    Gradassi, M.J.; Basu, A.; Fleisch, T.H.; Masin, J.G.

    1995-12-31

    Amoco has been involved for several years in the development of technology for the synthesis of liquid fuels from remote natural gas. In a recent collaborative work with Haldor Topsoe S/A, AVL LIST GmbH and Navistar, Amoco identified Dimethyl Ether (DME) as a new, ultraclean alternative fuel for diesel engines. DME can be handled like liquefied petroleum gas (LPG), itself an important alternative transportation fuel. However, unlike most other fuels, the raw exhaust of diesel engines fueled with DME satisfies California 1998 ULEV (Ultra Low Emission Vehicle) standards, now. DME`s greenhouse gas emissions, measured from cradle-to-grave, are lowest among all transportation fuel alternatives. Today, DME is manufactured from methanol and is used primarily as an aerosol propellant because of its attractive physical properties and its environmentally benign characteristics. Haldor Topsoe S/A developed a process for the direct production of DME from natural gas. The process can be used for the large scale manufacture of DME using predominantly single-train process units. When manufactured at large scale, DME can be produced and marketed at a cost comparable to conventional transportation fuels. The market driven demand for DME as a transportation fuel is envisioned to grow in three stages. Initially, DME is envisioned to be produced via methanol dehydration, followed by retrofits, and lastly by large scale dedicated plants. DME fuel demonstration fleet tests are scheduled to commence during 1996. Today`s methanol producer likely also will be tomorrow`s DME producer.

  18. Modeling Cladding-Coolant Heat Transfer of High-Burnup Fuel During RIA

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Modeling Cladding-Coolant Heat Transfer of High-Burnup Fuel During RIA Citation Details In-Document Search Title: Modeling Cladding-Coolant Heat Transfer of High-Burnup Fuel During RIA This paper describes a model for the cladding-coolant heat transfer of high burnup fuel during a Reactivity Initiated Accident (RIA) which is implemented in the fuel performance code FRAPTRAN 1.2. The minimum stable film boiling temperature, affected by the subcooling and the

  19. Conceptual study of measures against heat generation for TRU fuel fabrication system

    SciTech Connect (OSTI)

    Kawaguchi, Koichi; Namekawa, Takashi

    2007-07-01

    To lower the reprocessing cost and the environmental burden, the Japan Atomic Energy Agency (JAEA) has developed low decontamination TRU fuel fabrication system. TRU fuel contains MA of 1.2 to 5 wt% and its decay heat is estimated a few tens W/kg-HM. As the heat affects fuel quality through oxidation of fuel material and members, it is necessary to remove decay heat. In this work, authors designed concepts of the measures against heat generation at typical equipments using with the thermal hydraulics analysis technique. As a result, it is shown that it is possible to cool fuel materials with specific heat generation up to 20 W/kg-HM enough, though more detailed study is required for comprehensive equipments. (authors)

  20. Influence of district heating water temperatures on the fuel saving and reduction of ecological cost of the heat generation

    SciTech Connect (OSTI)

    Portacha, J.; Smyk, A.; Zielinski, A.; Misiewicz, L.

    1998-07-01

    Results of examinations carried out on the district heating water temperature influence in the cogeneration plant with respect to both the fuel economy and the ecological cost reduction of heat generation for the purposes of heating and hot service water preparation are presented in this paper. The decrease of water return temperature effectively contributes to the increase of fuel savings in all the examined cases. The quantitative savings depend on the outlet water temperature of the cogeneration plant and on the fuel type combusted at the alternative heat generating plant. A mathematical model and a numerical method for calculations of annual cogeneration plant performance, e.g. annual heat and electrical energy produced in cogeneration mode, and the annual fuel consumption, are also discussed. In the discussed mathematical model, the variable operating conditions of cogeneration plant vs. outside temperature and method of control can be determined. The thermal system of cogeneration plant was decomposed into subsystems so as to set up the mathematical model. The determination of subsystem tasks, including a method of convenient aggregation thereof is an essential element of numerical method for calculations of a specific cogeneration plant thermal system under changing conditions. Costs of heat losses in the environment, resulting from the pollutants emission, being formed in the fuel combustion process in the heat sources, were defined. In addition, the environment quantitative and qualitative pollution characteristics were determined both for the heat generation in a cogeneration plant and for an alternative heat-generating plant. Based on the calculations, a profitable decrease of ecological costs is achieved in the cogeneration economy even if compared with the gas-fired heat generating plant. Ecological costs of coal-fired heat generating plant are almost three time higher than those of the comparable cogeneration plant.

  1. Case Study: Fuel Cells Provide Combined Heat and Power at Verizon's Garden

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Central Office | Department of Energy Provide Combined Heat and Power at Verizon's Garden Central Office Case Study: Fuel Cells Provide Combined Heat and Power at Verizon's Garden Central Office This is a case study about Verizons Communications, who installed a 14-MW phosphoric acid fuel cell system at its Central Office in Garden City, New York, in 2005 and is now reaping environmental benefits and demonstrating the viaility of fuel cells in a commerical, critical telecommunications

  2. Mixed waste paper to ethanol fuel. A technology, market, and economic assessment for Washington

    SciTech Connect (OSTI)

    Not Available

    1991-01-01

    The objectives of this study were to evaluate the use of mixed waste paper for the production of ethanol fuels and to review the available conversion technologies, and assess developmental status, current and future cost of production and economics, and the market potential. This report is based on the results of literature reviews, telephone conversations, and interviews. Mixed waste paper samples from residential and commercial recycling programs and pulp mill sludge provided by Weyerhauser were analyzed to determine the potential ethanol yields. The markets for ethanol fuel and the economics of converting paper into ethanol were investigated.

  3. A Global Market in Transition: Local Markets in Jeopardy NASEO-EIA Summer Fuels Conference

    U.S. Energy Information Administration (EIA) Indexed Site

    Keeping Pace With A Rapidly Keeping Pace With A Rapidly Changing Sector: Then And Now Changing Sector: Then And Now David Knapp David Knapp Energy Intelligence Group Energy Intelligence Group 2008 EIA Energy Conference: 2008 EIA Energy Conference: 30 Years of Energy Information & Analysis 30 Years of Energy Information & Analysis Washington Washington -- -- Apr. 7, 2008 Apr. 7, 2008 OUTLINE OUTLINE l l How have petroleum markets changed? How have petroleum markets changed? l l Have data

  4. Marketing the Klamath Falls Geothermal District Heating system

    SciTech Connect (OSTI)

    Rafferty, K.

    1993-06-01

    The new marketing strategy for the Klamath Falls system has concentrated on offering the customer an attractive and easy to understand rate structure, reduced retrofit cost and complexity for his building along with an attractive package of financing and tax credits. Initial retrofit costs and life-cycle cost analysis have been conducted on 22 buildings to date. For some, the retrofit costs are simply too high for the conversion to make sense at current geothermal rates. For many, however, the prospects are good. At this writing, two new customers are now connected and operating with 5 to 8 more buildings committed to connect this construction season after line extensions are completed. This represents nearly a 60% increase in the number of buildings connected to the system and a 40% increase in system revenue.

  5. Transportation Energy Futures Series: Projected Biomass Utilization for Fuels and Power in a Mature Market

    SciTech Connect (OSTI)

    Ruth, M.; Mai, T.; Newes, E.; Aden, A.; Warner, E.; Uriarte, C.; Inman, D.; Simpkins, T.; Argo, A.

    2013-03-01

    The viability of biomass as transportation fuel depends upon the allocation of limited resources for fuel, power, and products. By focusing on mature markets, this report identifies how biomass is projected to be most economically used in the long term and the implications for greenhouse gas (GHG) emissions and petroleum use. In order to better understand competition for biomass between these markets and the potential for biofuel as a market-scale alternative to petroleum-based fuels, this report presents results of a micro-economic analysis conducted using the Biomass Allocation and Supply Equilibrium (BASE) modeling tool. The findings indicate that biofuels can outcompete biopower for feedstocks in mature markets if research and development targets are met. The BASE tool was developed for this project to analyze the impact of multiple biomass demand areas on mature energy markets. The model includes domestic supply curves for lignocellulosic biomass resources, corn for ethanol and butanol production, soybeans for biodiesel, and algae for diesel. This is one of a series of reports produced as a result of the Transportation Energy Futures (TEF) project, a Department of Energy-sponsored multi-agency project initiated to pinpoint underexplored strategies for abating GHGs and reducing petroleum dependence related to transportation.

  6. Transportation Energy Futures Series. Projected Biomass Utilization for Fuels and Power in a Mature Market

    SciTech Connect (OSTI)

    Ruth, M.; Mai, T.; Newes, E.; Aden, A.; Warner, E.; Uriarte, C.; Inman, D.; Simpkins, T.; Argo, A.

    2013-03-01

    The viability of biomass as transportation fuel depends upon the allocation of limited resources for fuel, power, and products. By focusing on mature markets, this report identifies how biomass is projected to be most economically used in the long term and the implications for greenhouse gas (GHG) emissions and petroleum use. In order to better understand competition for biomass between these markets and the potential for biofuel as a market-scale alternative to petroleum-based fuels, this report presents results of a micro-economic analysis conducted using the Biomass Allocation and Supply Equilibrium (BASE) modeling tool. The findings indicate that biofuels can outcompete biopower for feedstocks in mature markets if research and development targets are met. The BASE tool was developed for this project to analyze the impact of multiple biomass demand areas on mature energy markets. The model includes domestic supply curves for lignocellulosic biomass resources, corn for ethanol and butanol production, soybeans for biodiesel, and algae for diesel. This is one of a series of reports produced as a result of the Transportation Energy Futures (TEF) project, a Department of Energy-sponsored multi-agency project initiated to pinpoint underexplored strategies for abating GHGs and reducing petroleum dependence related to transportation.

  7. Decay Heat Calculations for PWR and BWR Assemblies Fueled with Uranium and Plutonium Mixed Oxide Fuel using SCALE

    SciTech Connect (OSTI)

    Ade, Brian J; Gauld, Ian C

    2011-10-01

    In currently operating commercial nuclear power plants (NPP), there are two main types of nuclear fuel, low enriched uranium (LEU) fuel, and mixed-oxide uranium-plutonium (MOX) fuel. The LEU fuel is made of pure uranium dioxide (UO{sub 2} or UOX) and has been the fuel of choice in commercial light water reactors (LWRs) for a number of years. Naturally occurring uranium contains a mixture of different uranium isotopes, primarily, {sup 235}U and {sup 238}U. {sup 235}U is a fissile isotope, and will readily undergo a fission reaction upon interaction with a thermal neutron. {sup 235}U has an isotopic concentration of 0.71% in naturally occurring uranium. For most reactors to maintain a fission chain reaction, the natural isotopic concentration of {sup 235}U must be increased (enriched) to a level greater than 0.71%. Modern nuclear reactor fuel assemblies contain a number of fuel pins potentially having different {sup 235}U enrichments varying from {approx}2.0% to {approx}5% enriched in {sup 235}U. Currently in the United States (US), all commercial nuclear power plants use UO{sub 2} fuel. In the rest of the world, UO{sub 2} fuel is still commonly used, but MOX fuel is also used in a number of reactors. MOX fuel contains a mixture of both UO{sub 2} and PuO{sub 2}. Because the plutonium provides the fissile content of the fuel, the uranium used in MOX is either natural or depleted uranium. PuO{sub 2} is added to effectively replace the fissile content of {sup 235}U so that the level of fissile content is sufficiently high to maintain the chain reaction in an LWR. Both reactor-grade and weapons-grade plutonium contains a number of fissile and non-fissile plutonium isotopes, with the fraction of fissile and non-fissile plutonium isotopes being dependent on the source of the plutonium. While only RG plutonium is currently used in MOX, there is the possibility that WG plutonium from dismantled weapons will be used to make MOX for use in US reactors. Reactor-grade plutonium in MOX fuel is generally obtained from reprocessed irradiated nuclear fuel, whereas weapons-grade plutonium is obtained from decommissioned nuclear weapons material and thus has a different plutonium (and other actinides) concentration. Using MOX fuel instead of UOX fuel has potential impacts on the neutronic performance of the nuclear fuel and the design of the nuclear fuel must take these differences into account. Each of the plutonium sources (RG and WG) has different implications on the neutronic behavior of the fuel because each contains a different blend of plutonium nuclides. The amount of heat and the number of neutrons produced from fission of plutonium nuclides is different from fission of {sup 235}U. These differences in UOX and MOX do not end at discharge of the fuel from the reactor core - the short- and long-term storage of MOX fuel may have different requirements than UOX fuel because of the different discharged fuel decay heat characteristics. The research documented in this report compares MOX and UOX fuel during storage and disposal of the fuel by comparing decay heat rates for typical pressurized water reactor (PWR) and boiling water reactor (BWR) fuel assemblies with and without weapons-grade (WG) and reactor-grade (RG) MOX fuel.

  8. CO2 emissions mitigation and fossil fuel markets: Dynamic and international aspects of climate policies

    SciTech Connect (OSTI)

    Bauer, Nico; Bosetti, Valentina; Hamdi-Cherif, Meriem; Kitous, Alban; McCollum, David; Mejean, Aurelie; Rao, Shilpa; Turton, Hal; Paroussos, Leonidas; Ashina, Shuichi; Calvin, Katherine V.; Wada, Kenichi; Van Vuuren, Detlef

    2015-01-01

    This paper explores a multi-model scenario ensemble to assess the impacts of idealized and non-idealized climate change stabilization policies on fossil fuel markets. Under idealized conditions climate policies significantly reduce coal use in the short- and long-term. Reductions in oil and gas use are much smaller, particularly until 2030, but revenues decrease much more because oil and gas prices are higher and decrease with mitigation. A first deviation from the optimal transition pathway relaxes global emission targets until 2030, in accordance with the Copenhagen pledges and regionally-specific low-carbon technology targets. Fossil fuel markets revert back to the no-policy case: though coal use increases strongest, revenue gains are higher for oil and gas. To balance the carbon budget over the 21st century, the long-term reallocation of fossil fuels is significantly larger - twice and more - than the short-term distortion. This amplifying effect results from coal lock-in and inter-fuel substitution effects. The second deviation from the optimal transition pathway relaxes the global participation assumption. The result here is less clear cut across models, as we find carbon leakage effects ranging from positive to negative because leakage and substitution patterns of coal, oil, and gas differ. In summary, distortions of fossil fuel markets resulting from relaxed short-term global emission targets are more important and less uncertain than the issue of carbon leakage from early mover action.

  9. CO₂ emission mitigation and fossil fuel markets: Dynamic and international aspects of climate policies

    SciTech Connect (OSTI)

    Bauer, Nico; Bosetti, Valentina; Hamdi-Cherif, Meriem; Kitous, Alban; McCollum, David; Mejean, Aurelie; Rao, Shilpa; Turton, Hal; Paroussos, Leonidas; Ashina, Shuichi; Calvin, Katherine; Wada, Kenichi; van Vuuren, Detlef

    2015-01-01

    This paper explores a multi-model scenario ensemble to assess the impacts of idealized and non-idealized climate change stabilization policies on fossil fuel markets. Under idealized conditions climate policies significantly reduce coal use in the short- and long-term. Reductions in oil and gas use are much smaller, particularly until 2030, but revenues decrease much more because oil and gas prices are higher than coal prices. A first deviation from optimal transition pathways is delayed action that relaxes global emission targets until 2030 in accordance with the Copenhagen pledges. Fossil fuel markets revert back to the no-policy case: though coal use increases strongest, revenue gains are higher for oil and gas. To balance the carbon budget over the 21st century, the long-term reallocation of fossil fuels is significantly larger—twice and more—than the short-term distortion. This amplifying effect results from coal lock-in and inter-fuel substitution effects to balance the full-century carbon budget. The second deviation from the optimal transition pathway relaxes the global participation assumption. The result here is less clear-cut across models, as we find carbon leakage effects ranging from positive to negative because trade and substitution patterns of coal, oil, and gas differ across models. In summary, distortions of fossil fuel markets resulting from relaxed short-term global emission targets are more important and less uncertain than the issue of carbon leakage from early mover action.

  10. Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power - Fact

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sheet, 2015 | Department of Energy Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power - Fact Sheet, 2015 Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power - Fact Sheet, 2015 TDA Research Inc., in collaboration with FuelCell Energy, is developing a new, high-capacity sorbent to remove sulfur from anaerobic digester gas. This technology will enable the production of a nearly sulfur-free biogas to replace natural gas in fuel cell power plants while reducing

  11. Development of a High Performance Air Source Heat Pump for the US Market

    SciTech Connect (OSTI)

    Abdelaziz, Omar; Shen, Bo; Gao, Zhiming; Baxter, Van D; Iu, Ipseng

    2011-01-01

    Heat pumps present a significant advantage over conventional residential heating technologies due to higher energy efficiencies and less dependence on imported oil. The US development of heat pumps dates back to the 1930 s with pilot units being commercially available in the 1950 s. Reliable and cost competitive units were available in the US market by the 1960 s. The 1973 oil embargo led to increased interest in heat pumps prompting significant research to improve performance, particularly for cold climate locations. Recent increasing concerns on building energy efficiency and environmental emissions have prompted a new wave of research in heat pump technology with special emphasis on reducing performance degradation at colder outdoor air temperatures. A summary of the advantages and limitations of several performance improvement options sought for the development of high performance air source heat pump systems for cold climate applications is the primary focus of this paper. Some recommendations for a high performance cold climate heat pump system design most suitable for the US market are presented.

  12. Install Waste Heat Recovery Systems for Fuel-Fired Furnaces (English/Chinese) (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2011-10-01

    Chinese translation of ITP fact sheet about installing Waste Heat Recovery Systems for Fuel-Fired Furnaces. For most fuel-fired heating equipment, a large amount of the heat supplied is wasted as exhaust or flue gases. In furnaces, air and fuel are mixed and burned to generate heat, some of which is transferred to the heating device and its load. When the heat transfer reaches its practical limit, the spent combustion gases are removed from the furnace via a flue or stack. At this point, these gases still hold considerable thermal energy. In many systems, this is the greatest single heat loss. The energy efficiency can often be increased by using waste heat gas recovery systems to capture and use some of the energy in the flue gas. For natural gas-based systems, the amount of heat contained in the flue gases as a percentage of the heat input in a heating system can be estimated by using Figure 1. Exhaust gas loss or waste heat depends on flue gas temperature and its mass flow, or in practical terms, excess air resulting from combustion air supply and air leakage into the furnace. The excess air can be estimated by measuring oxygen percentage in the flue gases.

  13. EA-0534: Radioisotope Heat Source Fuel Processing and Fabrication, Los Alamos, New Mexico

    Broader source: Energy.gov [DOE]

    This EA evaluates the environmental impacts of a proposal to operate existing Pu-238 processing facilities at Savannah River Site, and fabricate a limited quantity of Pu-238 fueled heat sources at...

  14. Geek-Up[5.20.2011]: Electricity from Waste Heat, Fuel from Sunlight

    Broader source: Energy.gov [DOE]

    Did you know 50 percent of the energy generated annually from all sources is lost as waste heat? What scientists are doing to take advantage of this opportunity to save money and new developments in harvesting fuel through photosynthesis.

  15. Description of heat flux measurement methods used in hydrocarbon and propellant fuel fires at Sandia.

    SciTech Connect (OSTI)

    Nakos, James Thomas

    2010-12-01

    The purpose of this report is to describe the methods commonly used to measure heat flux in fire applications at Sandia National Laboratories in both hydrocarbon (JP-8 jet fuel, diesel fuel, etc.) and propellant fires. Because these environments are very severe, many commercially available heat flux gauges do not survive the test, so alternative methods had to be developed. Specially built sensors include 'calorimeters' that use a temperature measurement to infer heat flux by use of a model (heat balance on the sensing surface) or by using an inverse heat conduction method. These specialty-built sensors are made rugged so they will survive the environment, so are not optimally designed for ease of use or accuracy. Other methods include radiometers, co-axial thermocouples, directional flame thermometers (DFTs), Sandia 'heat flux gauges', transpiration radiometers, and transverse Seebeck coefficient heat flux gauges. Typical applications are described and pros and cons of each method are listed.

  16. Developing Low-Cost, Highly Efficient Heat Recovery for Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    higher electrical effciency than an ... of hybrid fuel cell systems also make them a suitable power source for urban and ... for material stability, strength, and ...

  17. Mixed-oxide fuel decay heat analysis for BWR LOCA safety evaluation

    SciTech Connect (OSTI)

    Chiang, R. T.

    2013-07-01

    The mixed-oxide (MOX) fuel decay heat behavior is analyzed for Boiling Water Reactor (BWR) Loss of Coolant Accident (LOCA) safety evaluation. The physical reasoning on why the decay heat power fractions of MOX fuel fission product (FP) are significantly lower than the corresponding decay heat power fractions of uranium-oxide (UOX) fuel FP is illustrated. This is primarily due to the following physical phenomena. -The recoverable energies per fission of plutonium (Pu)-239 and Pu-241 are significantly higher than those of uranium (U)-235 and U-238. Consequently, the fission rate required to produce the same amount of power in MOX fuel is significantly lower than that in UOX fuel, which leads to lower subsequent FP generation rate and associated decay heat power in MOX fuel than those in UOX fuel. - The effective FP decay energy per fission of Pu-239 is significantly lower than the corresponding effective FP decay energy per fission of U-235, e.g., Pu-239's 10.63 Mega-electron-Volt (MeV) vs. U-235's 12.81 MeV at the cooling time 0.2 second. This also leads to lower decay heat power in MOX fuel than that in UOX fuel. The FP decay heat is shown to account for more than 90% of the total decay heat immediately after shutdown. The FP decay heat results based on the American National Standard Institute (ANSI)/American Nuclear Society (ANS)-5.1-1979 standard method are shown very close to the corresponding FP decay heat results based on the ANSI/ANS-5.1-2005 standard method. The FP decay heat results based on the ANSI/ANS-5.1-1979 simplified method are shown very close to but mostly slightly lower than the corresponding FP decay heat results based on the ANSI/ANS-5.1-1971 method. The FP decay heat results based on the ANSI/ANS-5.1-1979 simplified method or the ANSI/ANS-5.1-1971 method are shown significantly larger than the corresponding FP decay heat results based on the ANSI/ANS-5.1-1979 standard method or the ANSI/ANS-5.1-2005 standard method. (authors)

  18. Native Village of Teller Addresses Heating Fuel Shortage, Improves Energy Security

    Broader source: Energy.gov [DOE]

    During a site visit to the Native Village of Teller in April 2012, the Office of Indian Energy's Strategic Technical Assistance Response Team helped the community successfully transfer 10,000 gallons of fuel to a bulk fuel facility to secure the community's heating supply for the winter.

  19. A Validation Study of Pin Heat Transfer for MOX Fuel Based on the IFA-597 Experiments

    SciTech Connect (OSTI)

    Phillippe, Aaron M; Clarno, Kevin T; Banfield, James E; Ott, Larry J; Philip, Bobby; Berrill, Mark A; Sampath, Rahul S; Allu, Srikanth; Hamilton, Steven P

    2014-01-01

    Abstract The IFA-597 (Integrated Fuel Assessment) experiments from the International Fuel Performance Experiments (IFPE) database were designed to study the thermal behavior of mixed oxide (MOX) fuel and the effects of an annulus on fission gas release in light-water-reactor fuel. An evaluation of nuclear fuel pin heat transfer in the FRAPCON-3.4 and Exnihilo codes for MOX fuel systems was performed, with a focus on the first 20 time steps ( 6 GWd/MT(iHM)) for explicit comparison between the codes. In addition, sensitivity studies were performed to evaluate the effect of the radial power shape and approximations to the geometry to account for the thermocouple hole, dish, and chamfer. The analysis demonstrated relative agreement for both solid (rod 1) and annular (rod 2) fuel in the experiment, demonstrating the accuracy of the codes and their underlying material models for MOX fuel, while also revealing a small energy loss artifact in how gap conductance is currently handled in Exnihilo for chamfered fuel pellets. The within-pellet power shape was shown to significantly impact the predicted centerline temperatures. This has provided an initial benchmarking of the pin heat transfer capability of Exnihilo for MOX fuel with respect to a well-validated nuclear fuel performance code.

  20. Ground-Source Heat Pumps. Overview of Market Status, Barriers to Adoption, and Options for Overcoming Barriers

    SciTech Connect (OSTI)

    Goetzler, William; Zogg, Robert; Lisle, Heather; Burgos, Javier

    2009-02-03

    February 2009 final report submitted to DOE by Navigant Consulting, Inc. This report summarizes the status of ground-source heat pump (GSHP) technology and market penetration globally, estimates the energy saving potential of GSHPs in the U.S., identifies key market barriers that are inhibiting wider market adoption of GSHPs, and recommends initiatives that can be implemented or facilitated by the DOE to accelerate market adoption.

  1. Technical Potential of Solar Water Heating to Reduce Fossil Fuel Use and Greenhouse Gas Emissions in the United States

    SciTech Connect (OSTI)

    Denholm, P.

    2007-03-01

    Use of solar water heating (SWH) in the United States grew significantly in the late 1970s and early 1980s, as a result of increasing energy prices and generous tax credits. Since 1985, however, expiration of federal tax credits and decreased energy prices have virtually eliminated the U.S. market for SWH. More recently, increases in energy prices, concerns regarding emissions of greenhouse gases, and improvements in SWH systems have created new interest in the potential of this technology. SWH, which uses the sun to heat water directly or via a heat-transfer fluid in a collector, may be particularly important in its ability to reduce natural gas use. Dependence on natural gas as an energy resource in the United States has significantly increased in the past decade, along with increased prices, price volatility, and concerns about sustainability and security of supply. One of the readily deployable technologies available to decrease use of natural gas is solar water heating. This report provides an overview of the technical potential of solar water heating to reduce fossil fuel consumption and associated greenhouse gas emissions in U.S. residential and commercial buildings.

  2. Liquid Metal Bond for Improved Heat Transfer in LWR Fuel Rods

    SciTech Connect (OSTI)

    Donald Olander

    2005-08-24

    A liquid metal (LM) consisting of 1/3 weight fraction each of Pb, Sn, and Bi has been proposed as the bonding substance in the pellet-cladding gap in place of He. The LM bond eliminates the large AT over the pre-closure gap which is characteristic of helium-bonded fuel elements. Because the LM does not wet either UO2 or Zircaloy, simply loading fuel pellets into a cladding tube containing LM at atmospheric pressure leaves unfilled regions (voids) in the bond. The HEATING 7.3 heat transfer code indicates that these void spaces lead to local fuel hot spots.

  3. Fuel and cladding nano-technologies based solutions for long life heat-pipe based reactors

    SciTech Connect (OSTI)

    Popa-Simil, L.

    2012-07-01

    A novel nuclear reactor concept, unifying the fuel pipe with fuel tube functionality has been developed. The structure is a quasi-spherical modular reactor, designed for a very long life. The reactor module unifies the fuel tube with the heat pipe and a graphite beryllium reflector. It also uses a micro-hetero-structure that allows the fission products to be removed in the heat pipe flow and deposited in a getter area in the cold zone of the heat pipe, but outside the neutron flux. The reactor operates as a breed and burn reactor - it contains the fuel pipe with a variable enrichment, starting from the hot-end of the pipe, meant to assure the initial criticality, and reactor start-up followed by area with depleted uranium or thorium that get enriched during the consumption of the first part of the enriched uranium. (authors)

  4. Fuels

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fueling the Next Generation of Vehicle Technology Fueling the Next Generation of Vehicle Technology February 6, 2013 - 11:20am Addthis Professor Jack Brouwer, Associate Director and Chief Technology Officer of the National Fuel Cell Research Center, points out the tri-generation facility that uses biogas from Orange County Sanitation District’s wastewater treatment plant to produce hydrogen, heat and power. | Photo courtesy of the Energy Department. Professor Jack Brouwer, Associate

  5. Use of Integrated Decay Heat Limits to Facilitate Spent Nuclear Fuel Loading to Yucca Mountain

    SciTech Connect (OSTI)

    Li, Jun; Yim, Man-Sung; McNelis, David; Piet, Steven

    2007-07-01

    As an alternative to the use of the linear loading or areal power density (APD) concept, using integrated decay heat limits based on the use of mountain-scale heat transfer analysis is considered to represent the thermal impact from the deposited spent nuclear fuel (SNF) to the Yucca Mountain repository. Two different integrated decay heat limits were derived to represent both the short-term (up to 50 years from the time of repository closure) and the long-term decay heat effect (up to 1500 years from the time of repository closure). The derived limits were found to appropriately represent the drift wall temperature limit (200 deg. C) and the midway between adjacent drifts temperature limit (96 deg. C) as long as used fuel is uniformly loaded into the mountain. These limits can be a useful practical guide to facilitate the loading of used fuel into Yucca Mountain. (authors)

  6. CO₂ emission mitigation and fossil fuel markets: Dynamic and international aspects of climate policies

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bauer, Nico; Bosetti, Valentina; Hamdi-Cherif, Meriem; Kitous, Alban; McCollum, David; Mejean, Aurelie; Rao, Shilpa; Turton, Hal; Paroussos, Leonidas; Ashina, Shuichi; et al

    2015-01-01

    This paper explores a multi-model scenario ensemble to assess the impacts of idealized and non-idealized climate change stabilization policies on fossil fuel markets. Under idealized conditions climate policies significantly reduce coal use in the short- and long-term. Reductions in oil and gas use are much smaller, particularly until 2030, but revenues decrease much more because oil and gas prices are higher than coal prices. A first deviation from optimal transition pathways is delayed action that relaxes global emission targets until 2030 in accordance with the Copenhagen pledges. Fossil fuel markets revert back to the no-policy case: though coal use increasesmore » strongest, revenue gains are higher for oil and gas. To balance the carbon budget over the 21st century, the long-term reallocation of fossil fuels is significantly larger—twice and more—than the short-term distortion. This amplifying effect results from coal lock-in and inter-fuel substitution effects to balance the full-century carbon budget. The second deviation from the optimal transition pathway relaxes the global participation assumption. The result here is less clear-cut across models, as we find carbon leakage effects ranging from positive to negative because trade and substitution patterns of coal, oil, and gas differ across models. In summary, distortions of fossil fuel markets resulting from relaxed short-term global emission targets are more important and less uncertain than the issue of carbon leakage from early mover action.« less

  7. Technical Analysis of Installed Micro-Combined Heat and Power Fuel-Cell System

    SciTech Connect (OSTI)

    Brooks, Kriston P.; Makhmalbaf, Atefe

    2014-10-31

    Combined heat and power fuel cell systems (CHP-FCSs) provide consistent electrical power and hot water with greater efficiency and lower emissions than alternative sources. These systems can be used either as baseload, grid-connected, or as off-the-grid power sources. This report presents a technical analysis of 5 kWe CHP-FCSs installed in different locations in the U.S. At some sites as many as five 5 kWe system is used to provide up to 25kWe of power. Systems in this power range are considered “micro”-CHP-FCS. To better assess performance of micro-CHP-FCS and understand their benefits, the U.S. Department of Energy worked with ClearEdge Power to install fifteen 5-kWe PBI high temperature PEM fuel cells (CE5 models) in the commercial markets of California and Oregon. Pacific Northwest National Laboratory evaluated these systems in terms of their economics, operations, and technical performance. These units were monitored from September 2011 until June 2013. During this time, about 190,000 hours of data were collected and more than 17 billion data points were analyzed. Beginning in July 2013, ten of these systems were gradually replaced with ungraded systems (M5 models) containing phosphoric acid fuel cell technology. The new units were monitored until June 2014 until they went offline because ClearEdge was bought by Doosan at the time and the new manufacturer did not continue to support data collection and maintenance of these units. During these two phases, data was collected at once per second and data analysis techniques were applied to understand behavior of these systems. The results of this analysis indicate that systems installed in the second phase of this demonstration performed much better in terms of availability, consistency in generation, and reliability. The average net electrical power output increased from 4.1 to 4.9 kWe, net heat recovery from 4.7 to 5.4 kWth, and system availability improved from 94% to 95%. The average net system electric efficiency, average net heat recovery efficiency, and overall net efficiency of the system increased respectively from 33% to 36%, from 38% to 41%, and from 71% to 76%. The temperature of water sent to sit however reduced by about 16% from 51⁰C to 43 ⁰C. This was a control strategy and the temperature can be controlled depending on building heat demands. More importantly, the number of shutdowns and maintenance events required to keep the systems running at the manufacturer’s rated performance specifications were substantially reduced by about 76% (for 8 to 10 units running over a one-year period). From July 2012 to June 2013, there were eight CE5 units in operation and a total of 134 scheduled and unscheduled shutdowns took place. From July 2013 to June 2014, between two to ten units were in operation and only 32 shutdowns were reported (all unscheduled). In summary, the number of shutdowns reduced from 10 shutdowns per month on average for eight CE5units to an average of 2.7 shutdowns per month for M5 units (between two to ten units).

  8. Industrial Heat Pumps for Steam and Fuel Savings | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This brief introduces heat-pump technology and its application in industrial processes as part of steam systems. The focus is on the most common applications, with guidelines for ...

  9. Energy Department Invests More than $3 Million to Advance U.S. Competitiveness in the Fuel Cell Market

    Office of Energy Efficiency and Renewable Energy (EERE)

    The Energy Department on April 8 selected Connecticut-based FuelCell Energy for a more than $3 million award for a project that could increase United States competitiveness in the fuel cell market and give businesses more affordable, cleaner power options.

  10. Energy Department Invests More than $3 Million to Advance U.S. Competitiveness in the Fuel Cell Market

    Broader source: Energy.gov [DOE]

    In support of President Obama's all-of-the-above energy strategy, the Energy Department today awarded more than $3 million to Connecticut-based FuelCell Energy for a project that could increase U.S. competitiveness in the fuel cell market and give businesses more affordable, cleaner power options.

  11. BWR spent fuel storage cask performance test. Volume 1. Cask handling experience and decay heat, heat transfer, and shielding data

    SciTech Connect (OSTI)

    McKinnon, M.A.; Doman, J.W.; Tanner, J.E.; Guenther, R.J.; Creer, J.M.; King, C.E.

    1986-02-01

    This report documents a heat transfer and shielding performance test conducted on a Ridihalgh, Eggers and Associates REA 2023 boiling water reactor (BWR) spent fuel storage cask. The testing effort consisted of three parts: pretest preparations, performance testing, and post-test activities. Pretest preparations included conducting cask handling dry runs and characterizing BWR spent fuel assemblies from Nebraska Public Power District's Cooper Nuclear Station. The performance test matrix included 14 runs consisting of two loadings, two cask orientations, and three backfill environments. Post-test activities included calorimetry and axial radiation scans of selected fuel assemblies, in-basin sipping of each assembly, crud collection, video and photographic scans, and decontamination of the cask interior and exterior.

  12. Multi-Function Fuel-Fired Heat Pump - 2013 Peer Review | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Pump - 2013 Peer Review Multi-Function Fuel-Fired Heat Pump - 2013 Peer Review Emerging Technologies Project for the 2013 Building Technologies Office's Program Peer Review PDF icon emrgtech07_vineyard_040213.pdf More Documents & Publications Develop Standard Method of Test for Integrated Heat Pump - 2013 Peer Review Working Fluids Low Global Warming Potential Refrigerants - 2013 Peer Review Buildings Performance Database - 2013 BTO Peer Review

  13. Analysis of H2 storage needs for early market non-motive fuel cell applications.

    SciTech Connect (OSTI)

    Johnson, Terry Alan; Moreno, Marcina; Arienti, Marco; Pratt, Joseph William; Shaw, Leo; Klebanoff, Leonard E.

    2012-03-01

    Hydrogen fuel cells can potentially reduce greenhouse gas emissions and the United States dependence on foreign oil, but issues with hydrogen storage are impeding their widespread use. To help overcome these challenges, this study analyzes opportunities for their near-term deployment in five categories of non-motive equipment: portable power, construction equipment, airport ground support equipment, telecom backup power, and man-portable power and personal electronics. To this end, researchers engaged end users, equipment manufacturers, and technical experts via workshops, interviews, and electronic means, and then compiled these data into meaningful and realistic requirements for hydrogen storage in specific target applications. In addition to developing these requirements, end-user benefits (e.g., low noise and emissions, high efficiency, potentially lower maintenance costs) and concerns (e.g., capital cost, hydrogen availability) of hydrogen fuel cells in these applications were identified. Market data show potential deployments vary with application from hundreds to hundreds of thousands of units.

  14. Geography of Existing and Potential Alternative Fuel Markets in the United States

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Geography of Existing and Potential Alternative Fuel Markets in the United States Caley Johnson and Dylan Hettinger Technical Report NREL/TP-5400-60891 November 2014 NREL is a national laboratory of the U.S. Department of Energy Office of Energy Efficiency & Renewable Energy Operated by the Alliance for Sustainable Energy, LLC This report is available at no cost from the National Renewable Energy Laboratory (NREL) at www.nrel.gov/publications. Contract No. DE-AC36-08GO28308 National

  15. Market Transformation

    SciTech Connect (OSTI)

    2011-02-15

    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  16. Market Transformation

    Fuel Cell Technologies Publication and Product Library (EERE)

    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  17. Voluntary Truck and Bus Fuel-Economy-Program marketing plan. Final technical report, September 29, 1980-January 29, 1982

    SciTech Connect (OSTI)

    1982-01-01

    The aim of the program is to improve the utilization of fuel by commercial trucks and buses by updating and implementing specific approaches for educating and monitoring the trucking industry on methods and means of conserving fuels. The following outlines the marketing plan projects: increase use of program logo by voluntary program members and others; solicit trade publication membership and support; brief Congressional delegations on fuel conservation efforts; increase voluntary program presence before trade groups; increase voluntary program presence at truck and trade shows; create a voluntary program display for use at trade shows and in other areas; review voluntary program graphics; increase voluntary program membership; and produce placemats carrying fuel conservation messages; produce a special edition of Fuel Economy News, emphasizing the driver's involvement in fuel conservation; produce posters carrying voluntary program fuel conservation message. Project objectives, activities, and results for each project are summarized.

  18. Geothermal(Ground-Source)Heat Pumps: Market Status, Barriers to Adoption, and Actions to Overcome Barriers

    SciTech Connect (OSTI)

    Hughes, Patrick

    2008-12-01

    More effective stewardship of our resources contributes to the security, environmental sustainability, and economic well-being of the nation. Buildings present one of the best opportunities to economically reduce energy consumption and limit greenhouse gas emissions. Geothermal heat pumps (GHPs), sometimes called ground-source heat pumps, have been proven capable of producing large reductions in energy use and peak demand in buildings. However, GHPs have received little attention at the policy level as an important component of a national strategy. Have policymakers mistakenly overlooked GHPs, or are GHPs simply unable to make a major contribution to the national goals for various reasons? This brief study was undertaken at DOE's request to address this conundrum. The scope of the study includes determining the status of global GHP markets and the status of the GHP industry and technology in the United States, assembling previous estimates of GHP energy savings potential, identifying key barriers to application of GHPs, and identifying actions that could accelerate market adoption of GHPs. The findings are documented in this report along with conclusions and recommendations.

  19. A Validation Study of Pin Heat Transfer for UO2 Fuel Based on the IFA-432 Experiments

    SciTech Connect (OSTI)

    Phillippe, Aaron M; Clarno, Kevin T; Banfield, James E; Ott, Larry J; Philip, Bobby; Berrill, Mark A; Sampath, Rahul S; Allu, Srikanth; Hamilton, Steven P

    2014-01-01

    The IFA-432 (Integrated Fuel Assessment) experiments from the International Fuel Performance Experiments (IFPE) database were designed to study the effects of gap size, fuel density, and fuel densification on fuel centerline temperature in light-water-reactor fuel. An evaluation of nuclear fuel pin heat transfer in the FRAPCON-3.4 and Exnihilo codes for uranium dioxide (UO$_2$) fuel systems was performed, with a focus on the densification stage (2.2 \\unitfrac{GWd}{MT(UO$_{2}$)}). In addition, sensitivity studies were performed to evaluate the effect of the radial power shape and approximations to the geometry to account for the thermocouple hole. The analysis demonstrated excellent agreement for rods 1, 2, 3, and 5 (varying gap thicknesses and density with traditional fuel), demonstrating the accuracy of the codes and their underlying material models for traditional fuel. For rod 6, which contained unstable fuel that densified an order of magnitude more than traditional, stable fuel, the magnitude of densification was over-predicted and the temperatures were outside of the experimental uncertainty. The radial power shape within the fuel was shown to significantly impact the predicted centerline temperatures, whereas modeling the fuel at the thermocouple location as either annular or solid was relatively negligible. This has provided an initial benchmarking of the pin heat transfer capability of Exnihilo for UO$_2$ fuel with respect to a well-validated nuclear fuel performance code.

  20. Impacts of the Weatherization Assistance Program in fuel-oil heated houses

    SciTech Connect (OSTI)

    Levins, W.P.; Ternes, M.P.

    1994-10-01

    In 1990, the US Department of Energy (DOE) initiated a national evaluation of its lowincome Weatherization Assistance Program. This report, which is one of five parts of that evaluation, evaluates the energy savings and cost-effectiveness of the Program as it had been applied to single-family houses heated primarily by fuel-oil. The study was based upon a representative sample (41 local weatherization agencies, 222 weatherized and 115 control houses) from the nine northeastern states during 1991 and 1992 program years. Dwelling-specific and agency-level data on measures installed, costs, and service delivery procedures were collected from the sampled agencies. Space-heating fuel-oil consumption, indoor temperature, and outdoor temperature were monitored at each house. Dwelling characteristics, air-leakage measurements, space-heating system steady-state efficiency measurements, safety inspections, and occupant questionnaires were also collected or performed at each monitored house. We estimate that the Program weatherized a total of 23,400 single-family fuel-oil heated houses in the nine northeastern states during program years 1991 and 1992. Annual fuel-oil savings were calculated using regression techniques to normalize the savings to standard weather conditions. For the northeast region, annual net fuel-oil savings averaged 160 gallons per house, or 17.7% of pre-weatherization consumption. Although indoor temperatures changed in individual houses following weatherization, there was no average change and no significant difference as compared to the control houses; thus, there was no overall indoor temperature takeback effect influencing fuel-oil savings. The weatherization work was performed cost effectively in these houses from the Program perspective, which included both installation costs and overhead and management costs but did not include non-energy benefits (such as employment and environmental).

  1. Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power to Replace Fossil Fuels, Final Technical Report

    SciTech Connect (OSTI)

    Roberts, William L

    2012-10-31

    The primary objectives of this work can be summed into two major categories. Firstly, the fundamentals of the combustion of glycerol (in both a refined and unrefined form) were to be investigated, with emphasis of the development of a system capable of reliably and repeatedly combusting glycerol as well as an analysis of the emissions produced during glycerol combustion. Focus was placed on quantifying common emissions in comparison to more traditional fuels and this work showed that the burner developed was able to completely combust glycerol within a relatively wide range of operating conditions. Additionally, focus was placed on examining specific emissions in more detail, namely interesting NOx emissions observed in initial trials, acrolein and other volatile organic emissions, and particulate and ash emissions. This work showed that the combustion of crude glycerol could result in significantly reduced NOx emissions as a function of the high fuel bound oxygen content within the glycerol fuel. It also showed that when burned properly, the combustion of crude glycerol did not result in excessive emissions of acrolein or any other VOC compared to the combustion from more traditional fuels. Lastly however, this work has shown that in any practical application in which glycerol is being burned, it will be necessary to explore ash mitigation techniques due to the very high particulate matter concentrations produced during glycerol combustion. These emissions are comparable to unfiltered coal combustion and are directly tied to the biodiesel production method. The second focus of this work was directed to developing a commercialization strategy for the use of glycerol as a fuel replacement. This strategy has identified a 30 month plan for the scaling up of the laboratory scale burner into a pre-pilot scale system. Additionally, financing options were explored and an assessment was made of the economics of replacing a traditional fuel (namely natural gas) with crude glycerol from biodiesel production. This analysis showed that the cost of replacing natural gas with crude glycerol requires a strong function of the market price per unit of energy for the traditional fuel. However, the economics can be improved through the inclusion of a federal tax credit for the use of a renewable fuel. The conclusion of this analysis also shows that the ideal customer for energy replacement via crude glycerol is biodiesel producers who are located in remote regions, where the cost of energy is higher and the cost of crude glycerol is lowest. Lastly, the commercialization strategy analyzed competing technologies, namely traditional natural gas and electric heaters, as well as competing glycerol burners, and concludes with a discussion of the requirements for a pilot demonstration.

  2. Fuel Cell Power Model Elucidates Life-Cycle Costs for Fuel Cell-Based Combined Heat, Hydrogen, and Power (CHHP) Production Systems (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2010-11-01

    This fact sheet describes NREL's accomplishments in accurately modeling costs for fuel cell-based combined heat, hydrogen, and power systems. Work was performed by NREL's Hydrogen Technologies and Systems Center.

  3. Landi-Hartog U. S. A. adjusts to the U. S. market. [Marketing of LPG carburetor systems for using propane as an automotive fuel

    SciTech Connect (OSTI)

    Not Available

    1980-10-01

    Landi-Hartog U.S.A. has adjusted to the U.S. market in providing LPG carburetor systems for passenger cars. Landi-Hartog (LH) had to completely redesign the components on the system to be compatible with U.S. 300-525 cu in. engines. The company has California Air Resources Board approval for 300 cu in. engines and above in dual-fuel service. However, the U.S. market will remain severely restricted unless basic distribution (and the political) changes are made. The U.S. is st

  4. Method and apparatus for real-time measurement of fuel gas compositions and heating values

    DOE Patents [OSTI]

    Zelepouga, Serguei; Pratapas, John M.; Saveliev, Alexei V.; Jangale, Vilas V.

    2016-03-22

    An exemplary embodiment can be an apparatus for real-time, in situ measurement of gas compositions and heating values. The apparatus includes a near infrared sensor for measuring concentrations of hydrocarbons and carbon dioxide, a mid infrared sensor for measuring concentrations of carbon monoxide and a semiconductor based sensor for measuring concentrations of hydrogen gas. A data processor having a computer program for reducing the effects of cross-sensitivities of the sensors to components other than target components of the sensors is also included. Also provided are corresponding or associated methods for real-time, in situ determination of a composition and heating value of a fuel gas.

  5. Do Heat Pump Clothes Dryers Make Sense for the U.S. Market

    SciTech Connect (OSTI)

    Meyers, Steve; Franco, Victor; Lekov, Alex; Thompson, Lisa; Sturges, Andy

    2010-05-14

    Heat pump clothes dryers (HPCDs) can be as much as 50percent more energy-efficient than conventional electric resistance clothes dryers, and therefore have the potential to save substantial amounts of electricity. While not currently available in the U.S., there are manufacturers in Europe and Japan that produce units for those markets. Drawing on analysis conducted for the U.S. Department of Energy's (DOE) current rulemaking on amended standards for clothes dryers, this paper evaluates the cost-effectiveness of HPCDs in American homes, as well as the national impact analysis for different market share scenarios. In order to get an accurate measurement of real energy savings potential, the paper offers a new energy use calculation methodology that takes into account the most current data on clothes washer cycles, clothes dryer usage frequency, remaining moisture content, and load weight per cycle, which is very different from current test procedure values. Using the above methodology along with product cost estimates developed by DOE, the paper presents the results of a life-cycle cost analysis of the adoption of HPCDs in a representative sample of American homes. The results show that HPCDs have positive economic benefits only for households with high clothes dryer usage or for households with high electricity prices and moderately high utilization.

  6. STEO October 2012 - home heating supplies

    U.S. Energy Information Administration (EIA) Indexed Site

    sulfur levels for the first time, the heating oil market is expected to be tighter this winter, according to the U.S. Energy Information Administration's new winter fuels forecast. ...

  7. Study of fuel consumption and cooling system in low heat rejection turbocharged diesel engines

    SciTech Connect (OSTI)

    Taymaz, I.; Gur, M.; Cally, I.; Mimaroglu, A.

    1998-07-01

    In a conventional internal combustion engine, approximately one-third of total fuel input energy is converted to useful work. Since the working gas in a practical engine cycle is not exhausted at ambient temperature, a major part of the energy is lost with the exhaust gases. In addition another major part of energy input is rejected in the form of heat via the cooling system. If the energy normally rejected to the coolant could be recovered instead on the crankshaft as useful work, then a substantial improvement in fuel economy would result. At the same time, the cooling water, antifreeze, thermostat, radiator, water pump, cooling fan, and associated hoses and clamps could be eliminated. A new trend in the field of internal combustion engines is to insulate the heat transfer surfaces such as the combustion chamber, cylinder wall, cylinder head, piston and valves by ceramic insulating materials for the improvement of engine performance and elimination of cooling system. In this study, the effect of insulated heat transfer surfaces on direct injected and turbocharged diesel engine fuel consumption and cooling system were investigated. The research engine was a four-stroke, direct injected, six cylinder, turbocharged and intercooled diesel engine. This engine was tested at different speeds and loads conditions without coating. Then, combustion chamber surfaces, cylinder head, valves and piston crown faces was coated with ceramic materials. Ceramic layers were made of CaZrO{sub 3} and MgZrO{sub 3} and plasma coated onto base of the NiCrAl bond coat. The ceramic coated research engine was tested at the same operation conditions as the standard (without coating) engine. The results indicate a reduction in fuel consumption and heat losses to engine cooling system of the ceramic coated engine.

  8. Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA); Quarter 3 2012 Composite Data Products

    SciTech Connect (OSTI)

    Kurtz, J.; Wipke, K.; Sprik, S.; Ramsden, T.; Ainscough, C.; Saur, G.; Post, M.

    2013-01-01

    This report from the U.S. Department of Energy's National Renewable Energy Laboratory includes early fuel cell market composite data products for the third quarter of 2012 for American Recovery and Reinvestment Act (ARRA) and combined (IAA, DLA, ARRA) deployment projects.

  9. Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA): Quarter 4 2013 Composite Data Products

    SciTech Connect (OSTI)

    Kurtz, J.; Sprik, S.

    2014-06-01

    This report includes the composite data products (CDPs) for early fuel cell market deployments in quarter 4 of 2013. Results are presented for ARRA (projects funded by the American Recovery and Reinvestment Act of 2009 [ARRA]) and Combined (projects funded by DOE Interagency Agreements [IAA], Department of Defense Defense Logistics Agency [DLA], and ARRA).

  10. Evaluation of Gas, Oil and Wood Pellet Fueled Residential Heating System Emissions Characteristics

    SciTech Connect (OSTI)

    McDonald, R.

    2009-12-01

    This study has measured the emissions from a wide range of heating equipment burning different fuels including several liquid fuel options, utility supplied natural gas and wood pellet resources. The major effort was placed on generating a database for the mass emission rate of fine particulates (PM 2.5) for the various fuel types studied. The fine particulates or PM 2.5 (less than 2.5 microns in size) were measured using a dilution tunnel technique following the method described in US EPA CTM-039. The PM 2.5 emission results are expressed in several units for the benefit of scientists, engineers and administrators. The measurements of gaseous emissions of O{sub 2}, CO{sub 2}, CO, NO{sub x} and SO{sub 2} were made using a combustion analyzer based on electrochemical cells These measurements are presented for each of the residential heating systems tested. This analyzer also provides a steady state efficiency based on stack gas and temperature measurements and these values are included in the report. The gaseous results are within the ranges expected from prior emission studies with the enhancement of expanding these measurements to fuels not available to earlier researchers. Based on measured excess air levels and ultimate analysis of the fuel's chemical composition the gaseous emission results are as expected and fall within the range provided for emission factors contained in the US-EPA AP 42, Emission Factors Volume I, Fifth Edition. Since there were no unexpected findings in these gaseous measurements, the bulk of the report is centered on the emissions of fine particulates, or PM 2.5. The fine particulate (PM 2.5) results for the liquid fuel fired heating systems indicate a very strong linear relationship between the fine particulate emissions and the sulfur content of the liquid fuels being studied. This is illustrated by the plot contained in the first figure on the next page which clearly illustrates the linear relationship between the measured mass of fine particulate per unit of energy, expressed as milligrams per Mega-Joule (mg/MJ) versus the different sulfur contents of four different heating fuels. These were tested in a conventional cast iron boiler equipped with a flame retention head burner. The fuels included a typical ASTM No. 2 fuel oil with sulfur below 0.5 percent (1520 average ppm S), an ASTM No. 2 fuel oil with very high sulfur content (5780 ppm S), low sulfur heating oil (322 ppm S) and an ultra low sulfur diesel fuel (11 ppm S). Three additional oil-fired heating system types were also tested with normal heating fuel, low sulfur and ultralow sulfur fuel. They included an oil-fired warm air furnace of conventional design, a high efficiency condensing warm air furnace, a condensing hydronic boiler and the conventional hydronic boiler as discussed above. The linearity in the results was observed with all of the different oil-fired equipment types (as shown in the second figure on the next page). A linear regression of the data resulted in an Rsquared value of 0.99 indicating that a very good linear relationship exits. This means that as sulfur decreases the PM 2.5 emissions are reduced in a linear manner within the sulfur content range tested. At the ultra low sulfur level (15 ppm S) the amount of PM 2.5 had been reduced dramatically to an average of 0.043 mg/MJ. Three different gas-fired heating systems were tested. These included a conventional in-shot induced draft warm air furnace, an atmospheric fired hydronic boiler and a high efficiency hydronic boiler. The particulate (PM 2.5) measured ranged from 0.011 to 0.036 mg/MJ. depending on the raw material source used in their manufacture. All three stoves tested were fueled with premium (low ash) wood pellets obtained in a single batch to provide for uniformity in the test fuel. Unlike the oil and gas fired systems, the wood pellet stoves had measurable amounts of particulates sized above the 2.5-micron size that defines fine particulates (less than 2.5 microns). The fine particulate emissions rates ranged from 22 to 30 mg/ MJ with an average value

  11. Impacts of the Weatherization Assistance Program in Fuel-Oil Heated Houses

    SciTech Connect (OSTI)

    Levins, W.P.

    1994-01-01

    In 1990, the U.S. Department of Energy (DOE) initiated a national evaluation of its low-income Weatherization Assistance Program. This report, which is one of five parts of that evaluation, evaluates the energy savings and cost-effectiveness of the Program as it had been applied to single-family houses heated primarily by fuel-oil. The study was based upon a representative sample (41 local weatherization agencies, 222 weatherized and 115 control houses) from the nine northeastern states during 1991 and 1992 program years. Dwelling-specific and agency-level data on measures installed, costs, and service delivery procedures were collected from the sampled agencies. Space-heating fuel-oil consumption, indoor temperature, and outdoor temperature were monitored at each house. Dwelling characteristics, air-leakage measurements, space-heating system steady-state efficiency measurements, safety inspections, and occupant questionnaires were also collected or performed at each monitored house. We estimate that the Program weatherized a total of 23,400 single-family fuel-oil heated houses in the nine northeastern states during program years 1991 and 1992. Annual fuel-oil savings were calculated using regression techniques to normalize the savings to standard weather conditions. For the northeast region, annual net fuel-oil savings averaged 160 gallons per house, or 17.7% of pre-weatherization consumption. Although indoor temperatures changed in individual houses following weatherization, there was no average change and no significant difference as compared to the control houses; thus, there was no overall indoor temperature takeback effect influencing fuel-oil savings. The weatherization work was performed cost effectively in these houses from the Program perspective, which included both installation costs and overhead and management costs but did not include non-energy benefits (such as employment and environmental). Total average costs were $1819 per house ($1192 for installation labor and materials, and $627 for overhead and management), and the benefit-to-cost ratio was 1.48. A general trend toward higher-than-average fuel-oil savings was observed in houses with high pre-weatherization fuel-oil consumption. Program savings could likely be increased by targeting higher energy consumers for weatherization, although equity issues would have to be considered. Weatherization measures associated with higher-than-average savings were use of a blower door for air-sealing, attic and wall insulation, and replacement space-heating systems. Space-heating system tune-ups were not particularly effective at improving the steady-state efficiency of systems, although other benefits such as improved seasonal efficiency, and system safety and reliability may have resulted. The Program should investigate methods of improving the selection and/or application of space-heating system tune-ups and actively promote improved tune-up procedures that have been developed as a primary technology transfer activity. Houses were more air-tight following weatherization, but still leakier than what is achievable. Additional technology transfer effort is recommended to increase the use of blower doors considering that only half the weatherized houses used a blower door during air sealing. A guidebook developed by a committee of experts and covering a full range of blower-door topics might be a useful technology transfer and training document. Weatherization appeared to make occupants feel better about their house and house environment.

  12. Final Project Closeout Report for Sprint Hydrogen Fuel Cell (HFC) Deployment Project in California, Gulf Coast and Eastern Seaboard Markets

    SciTech Connect (OSTI)

    Kenny, Kevin; Bradley, Dwayne

    2015-09-01

    Sprint is one of the telecommunications industry leaders in the deployment of hydrogen fuel cell (HFC) systems to provide backup power for their mission critical wireless network facilities. With several hundred fuel cells commissioned in California, states in the gulf coast region, and along the upper eastern seaboard. A strong incentive for advancing the integration of fuel cells into the Sprint network came through the award of a Department of Energy (DOE) grant focused on Market Transformation activities for project (EE0000486). This grant was funded by the 2009 American Recovery and Reinvestment Act (ARRA). The funding provided by DOE ($7.295M) was allocated to support the installation of 260 new HFC systems, equipped with an on-site refillable Medium Pressure Hydrogen Storage Solution (MPHSS), as well as for the conversion of 21 low pressure hydrogen systems to the MPHSS, in hopes of reducing barriers to market acceptance.

  13. Electrochemical Potential (ECP) of Clean Heated Fuel Cladding Material and Structural SS under BWR Operating Conditions

    SciTech Connect (OSTI)

    Pop, Mike G.; Bell, Merl; Kilian, Renate; Dorsch, Thomas; Christian, Mueller

    2007-07-01

    To preliminarily monitor the relative effect of advanced water chemistry measures on SS structural material and fuel cladding in BWR environments a number of experiments were performed using laboratory equipment (recirculation loop, autoclave with heated electrodes, reference electrodes, etc.). The simulation of the plant condition was done without impurities or crud deposit contribution (clean surfaces). Subsequent testing, performed during 2007 and not yet cleared for release, is considering the effect of combined complex BWR chemistries and crud deposition. The heated Zircaloy fuel cladding tubing was prepared to simulate heat transfer by internal heating at levels existing in BWR (70 W/cm{sup 2}). For comparison purposes additional type SS347 electrode and unheated zirconium was used. A platinum electrode was used to measure the redox potential of the electrolyte. A high temperature Ag/AgCl electrode was used as a reference electrode. The assembly was installed in a recirculation 1 liter autoclave. Present report presents corrosion potential measurements performed under the following BWR water chemistry conditions (at 288 deg. C fluid exit temperature, 86 bar with surface temperature of Zirconium hot finger at 296 deg. C) - normal (inert) water conditions, - hydrogen injection in three steps from 0.68 ppm to 1.6 ppm, - oxygen injection in three steps from 2.4 ppm to 10 ppm - -methanol 2 ppm and oxygen 2 ppm in a close loop (without methanol refreshing) (authors)

  14. Development of a coal-fueled Internal Manifold Heat Exchanger (IMHEX reg sign ) molten carbonate fuel cell

    SciTech Connect (OSTI)

    Not Available

    1991-09-01

    The design of a CGMCFC electric generation plant that will provide a cost of eletricity (COE) which is lower than that of current electric generation technologies and which is competitive with other long-range electric generating systems is presented. This effort is based upon the Internal Manifold Heat Exchanger (IMHEX) technology as developed by the Institute of Gas Technology (IGT). The project was executed by selecting economic and performance objectives for alternative plant arrangements while considering process constraints identified during IMHEX fuel cell development activities at ICT. The four major subsystems of a coal-based MCFC power plant are coal gasification, gas purification, fuel cell power generation and the bottoming cycle. The design and method of operation of each subsystem can be varied, and, depending upon design choices, can have major impact on both the design of other subsystems and the resulting cost of electricity. The challenge of this project was to select, from a range of design parameters, those operating conditions that result in a preferred plant design. Computer modelling was thus used to perform sensitivity analyses of as many system variables as program resources and schedules would permit. In any systems analysis, it is imperative that the evaluation methodology be verifiable and comparable. The TAG Class I develops comparable (if imprecise) data on performance and costs for the alternative cases being studied. It identifies, from a range of options, those which merit more exacting scrutiny to be undertaken at the second level, TAG class II analysis.

  15. Carbonaceous material for production of hydrogen from low heating value fuel gases

    DOE Patents [OSTI]

    Koutsoukos, Elias P.

    1989-01-01

    A process for the catalytic production of hydrogen, from a wide variety of low heating value fuel gases containing carbon monoxide, comprises circulating a carbonaceous material between two reactors--a carbon deposition reactor and a steaming reactor. In the carbon deposition reactor, carbon monoxide is removed from a fuel gas and is deposited on the carbonaceous material as an active carbon. In the steaming reactor, the reactive carbon reacts with steam to give hydrogen and carbon dioxide. The carbonaceous material contains a metal component comprising from about 75% to about 95% cobalt, from about 5% to about 15% iron, and up to about 10% chromium, and is effective in suppressing the production of methane in the steaming reactor.

  16. Consumer Convenience and the Availability of Retail Stations as a Market Barrier for Alternative Fuel Vehicles: Preprint

    SciTech Connect (OSTI)

    Melaina, M.; Bremson, J.; Solo, K.

    2013-01-01

    The availability of retail stations can be a significant barrier to the adoption of alternative fuel light-duty vehicles in household markets. This is especially the case during early market growth when retail stations are likely to be sparse and when vehicles are dedicated in the sense that they can only be fuelled with a new alternative fuel. For some bi-fuel vehicles, which can also fuel with conventional gasoline or diesel, limited availability will not necessarily limit vehicle sales but can limit fuel use. The impact of limited availability on vehicle purchase decisions is largely a function of geographic coverage and consumer perception. In this paper we review previous attempts to quantify the value of availability and present results from two studies that rely upon distinct methodologies. The first study relies upon stated preference data from a discrete choice survey and the second relies upon a station clustering algorithm and a rational actor value of time framework. Results from the two studies provide an estimate of the discrepancy between stated preference cost penalties and a lower bound on potential revealed cost penalties.

  17. Vehicle Technologies Office Merit Review 2014: Alternative Fuel Market Development Program- Forwarding Wisconsin’s Fuel Choice

    Broader source: Energy.gov [DOE]

    Presentation given by Wisconsin Department of Administration at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about...

  18. Handbook for Small-Scale Densified Biomass Fuel (Pellets) Manufacturing for Local Markets.

    SciTech Connect (OSTI)

    Folk, Richard L.; Govett, Robert L.

    1992-07-01

    Wood pellet manufacturing in the Intermountain West is a recently founded and rapidly expanding energy industry for small-scale producers. Within a three-year period, the total number of manufacturers in the region has increased from seven to twelve (Folk et al., 1988). Small-scale industry development is evolving because a supply of raw materials from small and some medium-sized primary and secondary wood processors that has been largely unused. For the residue producer considering pellet fuel manufacturing, the wastewood generated from primary products often carries a cost associated with residue disposal when methods at-e stockpiling, landfilling or incinerating. Regional processors use these methods for a variety of reasons, including the relatively small amounts of residue produced, residue form, mixed residue types, high transportation costs and lack of a local market, convenience and absence of regulation. Direct costs associated with residue disposal include the expenses required to own and operate residue handling equipment, costs for operating and maintaining a combustor and tipping fees charged to accept wood waste at public landfills. Economic and social costs related to environmental concerns may also be incurred to include local air and water quality degradation from open-air combustion and leachate movement into streams and drinking water.

  19. Tiger Teams Provide Coalitions Technical and Market Assistance. Clean Cities Alternative Fuel Information Series, Tiger Teams Technical Assistance Fact Sheet.

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Clean Cities Technical Assistance Teams (Tiger Teams) were formed in 2001 to work directly with Clean Cities coordinators, stakeholders, and partners to tackle difficult technical and market challenges that might otherwise stall alternative fuel vehicle (AFV) implementation projects. The Tiger Team project, managed by the National Renewable Energy Laboratory (NREL), was established by the U.S. Department of Energy (DOE) to provide technical expertise to the 80 Clean Cities coalitions operating

  20. Fuel Cell Power Model Version 2: Startup Guide, System Designs, and Case Studies. Modeling Electricity, Heat, and Hydrogen Generation from Fuel Cell-Based Distributed Energy Systems

    SciTech Connect (OSTI)

    Steward, D.; Penev, M.; Saur, G.; Becker, W.; Zuboy, J.

    2013-06-01

    This guide helps users get started with the U.S. Department of Energy/National Renewable Energy Laboratory Fuel Cell Power (FCPower) Model Version 2, which is a Microsoft Excel workbook that analyzes the technical and economic aspects of high-temperature fuel cell-based distributed energy systems with the aim of providing consistent, transparent, comparable results. This type of energy system would provide onsite-generated heat and electricity to large end users such as hospitals and office complexes. The hydrogen produced could be used for fueling vehicles or stored for later conversion to electricity.

  1. MODELING HEAT TRANSFER IN SPENT FUEL TRANSFER CASK NEUTRON SHIELDS A CHALLENGING PROBLEM IN NATURAL CONVECTION

    SciTech Connect (OSTI)

    Fort, James A.; Cuta, Judith M.; Bajwa, C.; Baglietto, E.

    2010-07-18

    In the United States, commercial spent nuclear fuel is typically moved from spent fuel pools to outdoor dry storage pads within a transfer cask system that provides radiation shielding to protect personnel and the surrounding environment. The transfer casks are cylindrical steel enclosures with integral gamma and neutron radiation shields. Since the transfer cask system must be passively cooled, decay heat removal from spent nuclear fuel canister is limited by the rate of heat transfer through the cask components, and natural convection from the transfer cask surface. The primary mode of heat transfer within the transfer cask system is conduction, but some cask designs incorporate a liquid neutron shield tank surrounding the transfer cask structural shell. In these systems, accurate prediction of natural convection within the neutron shield tank is an important part of assessing the overall thermal performance of the transfer cask system. The large-scale geometry of the neutron shield tank, which is typically an annulus approximately 2 meters in diameter but only 10-15 cm in thickness, and the relatively small scale velocities (typically less than 5 cm/s) represent a wide range of spatial and temporal scales that contribute to making this a challenging problem for computational fluid dynamics (CFD) modeling. Relevant experimental data at these scales are not available in the literature, but some recent modeling studies offer insights into numerical issues and solutions; however, the geometries in these studies, and for the experimental data in the literature at smaller scales, all have large annular gaps that are not prototypic of the transfer cask neutron shield. This paper proposes that there may be reliable CFD approaches to the transfer cask problem, specifically coupled steady-state solvers or unsteady simulations; however, both of these solutions take significant computational effort. Segregated (uncoupled) steady state solvers that were tested did not accurately capture the flow field and heat transfer distribution in this application. Mesh resolution, turbulence modeling, and the tradeoff between steady state and transient solutions are addressed. Because of the critical nature of this application, the need for new experiments at representative scales is clearly demonstrated.

  2. Waste Classification based on Waste Form Heat Generation in Advanced Nuclear Fuel Cycles Using the Fuel-Cycle Integration and Tradeoffs (FIT) Model

    SciTech Connect (OSTI)

    Denia Djokic; Steven J. Piet; Layne F. Pincock; Nick R. Soelberg

    2013-02-01

    This study explores the impact of wastes generated from potential future fuel cycles and the issues presented by classifying these under current classification criteria, and discusses the possibility of a comprehensive and consistent characteristics-based classification framework based on new waste streams created from advanced fuel cycles. A static mass flow model, Fuel-Cycle Integration and Tradeoffs (FIT), was used to calculate the composition of waste streams resulting from different nuclear fuel cycle choices. This analysis focuses on the impact of waste form heat load on waste classification practices, although classifying by metrics of radiotoxicity, mass, and volume is also possible. The value of separation of heat-generating fission products and actinides in different fuel cycles is discussed. It was shown that the benefits of reducing the short-term fission-product heat load of waste destined for geologic disposal are neglected under the current source-based radioactive waste classification system , and that it is useful to classify waste streams based on how favorable the impact of interim storage is in increasing repository capacity.

  3. Waste Classification based on Waste Form Heat Generation in Advanced Nuclear Fuel Cycles Using the Fuel-Cycle Integration and Tradeoffs (FIT) Model - 13413

    SciTech Connect (OSTI)

    Djokic, Denia [Department of Nuclear Engineering, University of California - Berkeley, 4149 Etcheverry Hall, Berkeley, CA 94720-1730 (United States)] [Department of Nuclear Engineering, University of California - Berkeley, 4149 Etcheverry Hall, Berkeley, CA 94720-1730 (United States); Piet, Steven J.; Pincock, Layne F.; Soelberg, Nick R. [Idaho National Laboratory - INL, 2525 North Fremont Avenue, Idaho Falls, ID 83415 (United States)] [Idaho National Laboratory - INL, 2525 North Fremont Avenue, Idaho Falls, ID 83415 (United States)

    2013-07-01

    This study explores the impact of wastes generated from potential future fuel cycles and the issues presented by classifying these under current classification criteria, and discusses the possibility of a comprehensive and consistent characteristics-based classification framework based on new waste streams created from advanced fuel cycles. A static mass flow model, Fuel-Cycle Integration and Tradeoffs (FIT), was used to calculate the composition of waste streams resulting from different nuclear fuel cycle choices. This analysis focuses on the impact of waste form heat load on waste classification practices, although classifying by metrics of radiotoxicity, mass, and volume is also possible. The value of separation of heat-generating fission products and actinides in different fuel cycles is discussed. It was shown that the benefits of reducing the short-term fission-product heat load of waste destined for geologic disposal are neglected under the current source-based radioactive waste classification system, and that it is useful to classify waste streams based on how favorable the impact of interim storage is in increasing repository capacity. (authors)

  4. Energy Department Announces $6 Million to Accelerate Alternative Fuel Vehicle Market Growth

    Broader source: Energy.gov [DOE]

    The Energy Department announced today $6 million for 11 projects aimed at improving potential buyers’ experiences with alternative fuel and plug-in electric vehicles, supporting training, and integrating alternative fuels into emergency planning.

  5. New Report Describes Joint Opportunities for Natural Gas and Hydrogen Fuel Cell Vehicle Markets

    Broader source: Energy.gov [DOE]

    Sandia National Laboratories, supported by the DOE’s Vehicle Technologies and Fuel Cell Technologies Offices, recently released the workshop report “Transitioning the Transportation Sector: Exploring the Intersection of Hydrogen Fuel Cell and Natural Gas Vehicles.” Held in September 2014, the workshop considered common opportunities and challenges in expanding the use of hydrogen and natural gas as transportation fuels.

  6. Co-flow anode/cathode supply heat exchanger for a solid-oxide fuel cell assembly

    DOE Patents [OSTI]

    Haltiner, Jr., Karl J.; Kelly, Sean M.

    2005-11-22

    In a solid-oxide fuel cell assembly, a co-flow heat exchanger is provided in the flow paths of the reformate gas and the cathode air ahead of the fuel cell stack, the reformate gas being on one side of the exchanger and the cathode air being on the other. The reformate gas is at a substantially higher temperature than is desired in the stack, and the cathode gas is substantially cooler than desired. In the co-flow heat exchanger, the temperatures of the reformate and cathode streams converge to nearly the same temperature at the outlet of the exchanger. Preferably, the heat exchanger is formed within an integrated component manifold (ICM) for a solid-oxide fuel cell assembly.

  7. A High-Temperature Fuel Cell to Provide On-Site Process Reducing Gas, Clean Power, and Heat

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ultra-Efficient Combined Heat, Hydrogen, and Power System A High-Temperature Fuel Cell to Provide On-Site Process Reducing Gas, Clean Power, and Heat Introduction In order for metal products to have desired properties, most metal is thermally processed at a high temperature one or more times under a controlled atmosphere. Many different thermal operations are used including oxide reduction, annealing, brazing, sintering, and carburizing. A mixture of hydrogen and nitrogen gas often provides a

  8. Examination of frit vent from Sixty-Watt Heat Source simulant fueled clad vent set

    SciTech Connect (OSTI)

    Ulrich, G.B.

    1995-11-01

    The flow rate and the metallurgical condition of a frit vent from a simulant-fueled clad vent set (CVS) that had been hot isostatically pressed (HIP) for the Sixty-Watt Heat Source program were evaluated. The flow rate form the defueled vent cup subassembly was reduced approximately 25% from the original flow rate. No obstructions were found to account for the reduced flow rate. Measurements indicate that the frit vent powder thickness was reduced about 30%. Most likely, the powder was compressed during the HIP operation, which increased the density of the powder layer and thus reduced the flow rate of the assembly. All other observed manufacturing attributes appeared to be normal, but the vent hole activation technique needs further refinement before it is used in applications requiring maximum CVS integrity.

  9. Outline for a multi-cell nuclear thermionic fuel element that may be pretested with electric heat

    SciTech Connect (OSTI)

    Wilson, V.C.

    1997-01-01

    A nuclear thermionic converter electrical generating system is proposed in which the nuclear fuel is clad in tungsten (W) and transmits heat to a tungsten emitter by radiation. The tungsten clad is a single unit, containing a continuous fuel stack with an unfueled section extending through one end of the reactor. The emitters are electrically insulated from the heat source; therefore, several converters may be connected by short leads to produce more voltage per fuel element and to reduce the power losses in the leads. A fast reactor design was chosen; consequently, tungsten may be used for the fuel cladding and the emitters without a significant reactivity penalty due to neutron capture by tungsten epithermal resonances. The ability to use all-tungsten emitters may permit high emitter temperatures. Calculations indicate that at an emitter temperature of 2150 K and current density of 10A/cm{sup 2}, a 36 cm long thermionic fuel element (TFE) with 9 converters in series should produce 4500W{sub e} at 9.2 V and 15.7{percent} efficiency. One major advantage of this approach, relative to typical multicell designs is that the system can be tested by electrical heaters in the fuel cavity before loading fuel. {copyright} {ital 1997 American Institute of Physics.}

  10. Outline for a multi-cell nuclear thermionic fuel element that may be pretested with electric heat

    SciTech Connect (OSTI)

    Wilson, Volney C.

    1997-01-10

    A nuclear thermionic converter electrical generating system is proposed in which the nuclear fuel is clad in tungsten (W) and transmits heat to a tungsten emitter by radiation. The tungsten clad is a single unit, containing a continuous fuel stack with an unfueled section extending through one end of the reactor. The emitters are electrically insulated from the heat source; therefore, several converters may be connected by short leads to produce more voltage per fuel element and to reduce the power losses in the leads. A fast reactor design was chosen; consequently, tungsten may be used for the fuel cladding and the emitters without a significant reactivity penalty due to neutron capture by tungsten epithermal resonances. The ability to use all-tungsten emitters may permit high emitter temperatures. Calculations indicate that at an emitter temperature of 2150 K and current density of 10 A/cm{sup 2}, a 36 cm long thermionic fuel element (TFE) with 9 converters in series should produce 4500 W{sub e} at 9.2 V and 15.7% efficiency. One major advantage of this approach, relative to typical multicell designs is that the system can be tested by electrical heaters in the fuel cavity before loading fuel.

  11. Mississippi State University Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center

    SciTech Connect (OSTI)

    Mago, Pedro; Newell, LeLe

    2014-01-31

    Between 2008 and 2014, the U.S. Department of Energy funded the MSU Micro-CHP and Bio-Fuel Center located at Mississippi State University. The overall objective of this project was to enable micro-CHP (micro-combined heat and power) utilization, to facilitate and promote the use of CHP systems and to educate architects, engineers, and agricultural producers and scientists on the benefits of CHP systems. Therefore, the work of the Center focused on the three areas: CHP system modeling and optimization, outreach, and research. In general, the results obtained from this project demonstrated that CHP systems are attractive because they can provide energy, environmental, and economic benefits. Some of these benefits include the potential to reduce operational cost, carbon dioxide emissions, primary energy consumption, and power reliability during electric grid disruptions. The knowledge disseminated in numerous journal and conference papers from the outcomes of this project is beneficial to engineers, architects, agricultural producers, scientists and the public in general who are interested in CHP technology and applications. In addition, more than 48 graduate students and 23 undergraduate students, benefited from the training and research performed in the MSU Micro-CHP and Bio-Fuel Center.

  12. Heavy-Duty Trucks Poised to Accelerate Growth of American Alternative Transportation Fuels Market

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Background Since 1988, federal and state legislation has mandated the adoption of alternative transportation fuels, primarily because of environmental and energy security concerns. Recently, however, much of the alternative fuels activity has shifted. With the electoral revolution of 1992, Congress is rethinking environmental regulation and cutting federal appro- priations for alternative fueled vehi- cles (AFVs). The U.S. Enviromental Protection Agency (EPA) may delay implementation of

  13. Vehicle Technologies Office Merit Review 2014: Advancing Alternative Fuel Markets in Florida

    Broader source: Energy.gov [DOE]

    Presentation given by University of Central Florida at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about advancing...

  14. Vehicle Technologies Office Merit Review 2014: Advancing Alternative Fuel Markets Adoption and Growth

    Broader source: Energy.gov [DOE]

    Presentation given by Greater Washington Region Clean Cities Coalition at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting...

  15. Applications of high-temperature solar heat to the production of selected fuels and chemicals

    SciTech Connect (OSTI)

    Beall, S.E. Jr.; Bamberger, C.E.; Goeller, H.A.

    1981-07-01

    An attempt is made to judge whether solar heat in the 500 K to 2500 K temperature range might be economical for some important fuel- and chemical-production processes. Previous work in related areas is reviewed and the chemicals aluminum oxide (and bauxite), calcium sulfate (and gypsum), and calcium oxide (lime) chosen for detailed study. In addition to reviewing the energy needs of the more common bulk chemicals, several innovative processes requiring heat in the 1500 to 2500 K range were investigated. Hydrogen production by several thermochemical means, carbon monoxide production by thermochemical and direct thermal dissociation, and nitrogen fixation by direct thermal reaction of nitrogen and oxygen in air were considered. The engineering feasibility of the processes is discussed. The problem of matching the conventional and innovative processes to a high-temperature solar supply is studied. Some solar-thermal power plants of current designs are examined and several advanced concepts of highly concentrating systems are considered for very high-temperature applications. Conclusions and recommendations are presented.

  16. Micro Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center, Mississippi State University

    SciTech Connect (OSTI)

    Louay Chamra

    2008-09-26

    Initially, most micro-CHP systems will likely be designed as constant-power output or base-load systems. This implies that at some point the power requirement will not be met, or that the requirement will be exceeded. Realistically, both cases will occur within a 24-hour period. For example, in the United States, the base electrical load for the average home is approximately 2 kW while the peak electrical demand is slightly over 4 kW. If a 3 kWe micro- CHP system were installed in this situation, part of the time more energy will be provided than could be used and for a portion of the time more energy will be required than could be provided. Jalalzadeh-Azar [6] investigated this situation and presented a comparison of electrical- and thermal-load-following CHP systems. In his investigation he included in a parametric analysis addressing the influence of the subsystem efficiencies on the total primary energy consumption as well as an economic analysis of these systems. He found that an increase in the efficiencies of the on-site power generation and electrical equipment reduced the total monthly import of electricity. A methodology for calculating performance characteristics of different micro-CHP system components will be introduced in this article. Thermodynamic cycles are used to model each individual prime mover. The prime movers modeled in this article are a spark-ignition internal combustion engine (Otto cycle) and a diesel engine (Diesel cycle). Calculations for heat exchanger, absorption chiller, and boiler modeling are also presented. The individual component models are then linked together to calculate total system performance values. Performance characteristics that will be observed for each system include maximum fuel flow rate, total monthly fuel consumption, and system energy (electrical, thermal, and total) efficiencies. Also, whether or not both the required electrical and thermal loads can sufficiently be accounted for within the system specifications is observed. Case study data for various micro-CHP system configurations have been discussed and compared. Comparisons are made of the different prime mover/fuel combinations. Also, micro- CHP monthly energy cost results are compared for each system configuration to conventional monthly utility costs for equivalent monthly building power, heating, and cooling requirements.

  17. Consumer Convenience and the Availability of Retail Stations as a Market Barrier for Alternative Fuel Vehicles: Preprint

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. Contract No. DE-AC36-08GO28308 Consumer Convenience and the Availability of Retail Stations as a Market Barrier for Alternative Fuel Vehicles Preprint M. Melaina National Renewable Energy Laboratory J. Bremson University of California Davis K. Solo Lexidyne, LLC Presented at the 31st USAEE/IAEE North American Conference Austin, Texas November 4-7, 2012 Conference Paper NREL/CP-5600-56898

  18. Performance of AGR-1 High-Temperature Reactor Fuel During Post-Irradiation Heating Tests

    SciTech Connect (OSTI)

    Morris, Robert Noel; Baldwin, Charles A; Hunn, John D; Demkowicz, Paul; Reber, Edward

    2014-01-01

    The fission product retention of irradiated low-enriched uranium oxide/uranium carbide TRISO fuel compacts from the AGR-1 experiment has been evaluated at temperatures of 1600 1800 C during post-irradiation safety tests. Fourteen compacts (a total of ~58,000 particles) with a burnup ranging from 13.4 to 19.1% FIMA have been tested using dedicated furnace systems at Idaho National Laboratory and Oak Ridge National Laboratory. The release of fission products 110mAg, 134Cs, 137Cs, 154Eu, 155Eu, 90Sr, and 85Kr was monitored while heating the fuel specimens in flowing helium. The behavior of silver, europium, and strontium appears to be dominated by inventory that was originally released through intact SiC coating layers during irradiation, but was retained in the compact at the end of irradiation and subsequently released during the safety tests. However, at a test temperature of 1800 C, the data suggest that release of these elements through intact coatings may become significant after ~100 h. Cesium was very well retained by intact SiC layers, with a fractional release <5 10-6 after 300 h at 1600 C or 100 h at 1800 C. However, it was rapidly released from individual particles if the SiC layer failed, and therefore the overall cesium release fraction was dominated by the SiC defect and failure fractions in the fuel compacts. No complete TRISO coating layer failures were observed after 300 h at 1600 or 1700 C, and 85Kr release was very low during the tests (particles with breached SiC, but intact outer pyrocarbon, retained most of their krypton). Krypton release from TRISO failures was only observed after ~210 h at 1800 C in one compact. Post-safety-test examination of fuel compacts and particles has focused on identifying specific particles from each compact with notable fission product release and detailed analysis of the coating layers to understand particle behavior.

  19. Market Transformation Fact Sheet

    Broader source: Energy.gov [DOE]

    This fact sheet describes the Fuel Cell Technologies Office's Market Transformation strategies and activities, which are aimed at accelerating early market adoption and advancing pre-competitive technologies.

  20. Market Transformation Fact Sheet

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Adoption of fuel cells in emerging markets expands the growth of green jobs, with new opportunities in manufacturing, fuel cell maintenance and support systems, and domestic ...

  1. Vehicle Technologies Office Merit Review 2014: Southeast Regional Alternative Fuels Market Initiatives Program

    Broader source: Energy.gov [DOE]

    Presentation given by Center for Transportation and the Environment, Inc. at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting...

  2. Transportation Fuel Market Stood at 2,332.57 MTOE in 2013 and...

    Open Energy Info (EERE)

    gas (GHG) emissions from vehicles powered by crude oil-based fuels and depleting oil reserves have compelled governments of different countries to switch to eco-friendly and...

  3. Energy Dept. Reports: U.S. Fuel Cell Market Production and Deployment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... For example, San Diego has installed 2.4 megawatts of fuel cells and is using purified biogas from the Point Loma wastewater treatment plant to generate clean electricity for the ...

  4. High efficiency, quasi-instantaneous steam expansion device utilizing fossil or nuclear fuel as the heat source

    SciTech Connect (OSTI)

    Claudio Filippone, Ph.D.

    1999-06-01

    Thermal-hydraulic analysis of a specially designed steam expansion device (heat cavity) was performed to prove the feasibility of steam expansions at elevated rates for power generation with higher efficiency. The steam expansion process inside the heat cavity greatly depends on the gap within which the steam expands and accelerates. This system can be seen as a miniaturized boiler integrated inside the expander where steam (or the proper fluid) is generated almost instantaneously prior to its expansion in the work-producing unit. Relatively cold water is pulsed inside the heat cavity, where the heat transferred causes the water to flash to steam, thereby increasing its specific volume by a large factor. The gap inside the heat cavity forms a special nozzle-shaped system in which the fluid expands rapidly, accelerating toward the system outlet. The expansion phenomenon is the cause of ever-increasing fluid speed inside the cavity system, eliminating the need for moving parts (pumps, valves, etc.). In fact, the subsequent velocity induced by the sudden fluid expansion causes turbulent conditions, forcing accelerating Reynolds and Nusselt numbers which, in turn, increase the convective heat transfer coefficient. When the combustion of fossil fuels constitutes the heat source, the heat cavity concept can be applied directly inside the stator of conventional turbines, thereby greatly increasing the overall system efficiency.

  5. Industrial Heat Pumps for Steam and Fuel Savings: A BestPractices...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The purpose of this Steam Technical Brief is to introduce heat-pump technology and its ... A heat pump is a device that can increase the temperature of a waste-heat source to a ...

  6. Consolidated Electric Cooperative- Heat Pump and Water Heating Rebates

    Broader source: Energy.gov [DOE]

    Consolidated Electric Cooperative provides rebates to residential customers who install electric water heaters, dual-fuel heating system or geothermal heat pumps. A dual-fuel heating systems...

  7. Load Preheating Using Flue Gases from a Fuel-Fired Heating System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Would the heat loss be considerable? 4. What type of ... Will an auxiliary heating system be needed? Resources See ... will mean a stronger economy, a cleaner environment, ...

  8. Feasibility study for a 10 MM GPY fuel ethanol plant, Brady Hot Springs, Nevada. Volume II. Geothermal resource, agricultural feedstock, markets and economic viability

    SciTech Connect (OSTI)

    Not Available

    1980-09-01

    The issues of the geothermal resource at Brady's Hot Springs are dealt with: the prospective supply of feedstocks to the ethanol plant, the markets for the spent grain by-products of the plant, the storage, handling and transshipment requirements for the feedstocks and by-products from a rail siding facility at Fernley, the probable market for fuel ethanol in the region, and an assessment of the economic viability of the entire undertaking.

  9. The Technical Potential of Solar Water Heating to Reduce Fossil Fuel Use and Greenhouse Gas Emissions in the United States

    SciTech Connect (OSTI)

    2009-01-18

    Use of solar water heating (SWH) in the United States grew significantly in the late 1970s and early 1980s, as a result of increasing energy prices and generous tax credits. Since 1985, however, expiration of federal tax credits and decreased energy prices have virtually eliminated the U.S. market for SWH. More recently, increases in energy prices, concerns regarding emissions of greenhouse gases, and improvements in SWH systems have created new interest in the potential of this technology. SWH,

  10. Fuel Cell Project Selected for First Ever Technology-to-Market SBIR Award

    Broader source: Energy.gov [DOE]

    EERE recently announced the selection of 40 small businesses for new Small Business Innovation Research (SBIR) awards that total nearly $6.3 million, including a first-of-its-kind award under a new EERE SBIR technology-to-market topic.

  11. Fuel Cells for Supermarkets: Cleaner Energy with Fuel Cell Combined...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for Supermarkets: Cleaner Energy with Fuel Cell Combined Heat and Power Systems Fuel Cells for Supermarkets: Cleaner Energy with Fuel Cell Combined Heat and Power Systems Presented ...

  12. Assessment of costs and benefits of flexible and alternative fuel use in the U.S. transportation sector. Technical report fourteen: Market potential and impacts of alternative fuel use in light-duty vehicles -- A 2000/2010 analysis

    SciTech Connect (OSTI)

    1996-01-01

    In this report, estimates are provided of the potential, by 2010, to displace conventional light-duty vehicle motor fuels with alternative fuels--compressed natural gas (CNG), liquefied petroleum gas (LPG), methanol from natural gas, ethanol from grain and from cellulosic feedstocks, and electricity--and with replacement fuels such as oxygenates added to gasoline. The 2010 estimates include the motor fuel displacement resulting both from government programs (including the Clean Air Act and EPACT) and from potential market forces. This report also provides an estimate of motor fuel displacement by replacement and alterative fuels in the year 2000. However, in contrast to the 2010 estimates, the year 2000 estimate is restricted to an accounting of the effects of existing programs and regulations. 27 figs., 108 tabs.

  13. Market assessment for active solar heating and cooling products. Category B: a survey of decision-makers in the HVAC marketplace. Final report

    SciTech Connect (OSTI)

    1980-09-01

    A comprehensive evaluation of the market for solar heating and cooling products for new and retrofit markets is reported. The emphasis is on the analysis of solar knowledge among HVAC decision makers and a comprehensive evaluation of their solar attitudes and behavior. The data from each of the following sectors are described and analyzed: residential consumers, organizational and manufacturing buildings, HVAC engineers and architects, builders/developers, and commercial/institutional segments. (MHR)

  14. Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power

    SciTech Connect (OSTI)

    2009-11-01

    TDA Research Inc., in collaboration with FuelCell Energy, will develop a new, high-capacity sorbent to remove sulfur from anaerobic digester gas. This technology will enable the production of a nearly sulfur-free biogas to replace natural gas in fuel cell power plants while reducing greenhouse gas emissions from fossil fuels.

  15. Geothermal direct heat use: market potential/penetration analysis for Federal Region IX (Arizona, California, Hawaii, Nevada)

    SciTech Connect (OSTI)

    Powell, W.; Tang, K.

    1980-05-01

    A preliminary study was made of the potential for geothermal direct heat use in Arizona, California, Hawaii, and Nevada (Federal Region IX). The analysis for each state was performed by a different team, located in that state. For each state, the study team was asked to: (1) define the resource, based on the latest available data; (2) assess the potential market growth for geothermal energy; and (3) estimate the market penetration, projected to 2020. Each of the four states of interest in this study is unique in its own way. Rather than impose the same assumptions as to growth rates, capture rates, etc. on all of the study teams, each team was asked to use the most appropriate set of assumptions for its state. The results, therefore, should reflect the currently accepted views within each state. The four state reports comprise the main portion of this document. A brief regional overview section was prepared by the Jet Propulsion Laboratory, following completion of the state reports.

  16. fuel

    National Nuclear Security Administration (NNSA)

    4%2A en Cheaper catalyst may lower fuel costs for hydrogen-powered cars http:www.nnsa.energy.govblogcheaper-catalyst-may-lower-fuel-costs-hydrogen-powered-cars

  17. fuel

    National Nuclear Security Administration (NNSA)

    4%2A en Cheaper catalyst may lower fuel costs for hydrogen-powered cars http:nnsa.energy.govblogcheaper-catalyst-may-lower-fuel-costs-hydrogen-powered-cars

  18. PROCEEDINGS OF THE 2003 NATIONAL OILHEAT RESEARCH ALLIANCE TECHNOLOGY SYMPOSIUM, HELD AT THE 2003 NEW ENGLAND FUEL INSTITUTE CONVENTION AND 30TH NORTH AMERICAN HEATING AND ENERGY EXPOSITION, HYNES CONVENTION CENTER, PRUDENTIAL CENTER, BOSTON, MASSACHUSETTS, JUNE 9 - 10, 2003.

    SciTech Connect (OSTI)

    MCDONALD,R.J.

    2003-06-09

    This meeting is the sixteenth oilheat industry technology meeting held since 1984 and the third since the National Oilheat Research Alliance (NORA) was formed. This year's symposium is a very important part of the effort in technology transfer, which is supported by the Oilheat Research Fuel Flexibility Program under the United States Department of Energy, Distributed Energy and Electricity Reliability Program (DEER). The foremost reason for the conference is to provide a platform for the exchange of information and perspectives among international researchers, engineers, manufacturers, service technicians, and marketers of oil-fired space-conditioning equipment. The conference provides a conduit by which information and ideas can be exchanged to examine present technologies, as well as helping to develop the future course for oil heating advancement. These conferences also serve as a stage for unifying government representatives, researchers, fuel oil marketers, and other members of the oil-heat industry in addressing technology advancements in this important energy use sector. The specific objectives of the conference are to: (1) Identify and evaluate the current state-of-the-art and recommend new initiatives for higher efficiency, a cleaner environment, and to satisfy consumer needs cost effectively, reliably, and safely; (2) Foster cooperative interactions among federal and industrial representatives for the common goal of sustained economic growth and energy security via energy conservation.

  19. Steam Technical Brief: Industrial Heat Pumps for Steam and Fuel Savings

    SciTech Connect (OSTI)

    2010-06-25

    The purpose of this Steam Techcial Brief is to introduce heat-pump technology and its applicaiton in industrial processes.

  20. Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power...

    Office of Scientific and Technical Information (OSTI)

    Additionally, financing options were explored and an assessment was made of the economics of replacing a traditional fuel (namely natural gas) with crude glycerol from biodiesel ...

  1. In-Cylinder Mechanisms of PCI Heat-Release Rate Control by Fuel...

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications Heavy-Duty Low-Temperature and Diesel Combustion & Heavy-Duty ... (RCCI) Combustion in a Light-Duty Engine High Efficiency Fuel Reactivity ...

  2. Energy Saving Absorption Heat Pump Water Heater - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Building Energy Efficiency Building Energy Efficiency Find More Like This Return to Search Energy Saving Absorption Heat Pump Water Heater Oak Ridge National Laboratory Contact ORNL About This Technology Technology Marketing SummaryORNL's new absorption heat pump and water heater technology offers substantial energy savings and can reduce the use of fossil fuels by buildings. While conventional heat pump water heater designs are limited to using toxic ammonia water systems, this system uses heat

  3. Effects of Zircaloy oxidation and steam dissociation on PWR core heat-up under conditions simulating uncovered fuel rods

    SciTech Connect (OSTI)

    Viskanta, R.; Mohanty, A.K.

    1986-04-01

    The studies described in this report identify the regimes of slow transients in a partially uncovered core of a PWR. The threshold height and onset time for oxidation of the cladding of a fuel rod have been evaluated. The effects of oxidation in increasing the decay heat load, component temperature, reduction of cladding thickness and generation of hydrogen have been estimated. The condition for steam starvation has been determined. At high uncovered core heights, typically say 2.8 m for a geometry simulating the TMI-2 type of reactor, the solid and coolant temperatures can reach the limits of steam dissociation. The effects of radiation heat exchange between cladding and coolant, Zircaloy oxidation, steam dissociation, gap conductance between fuel and cladding and system pressure on the heatup of fuel rods have been investigated. The time for uncovering a certain core height is taken as the independent parameter. It is seen that if the uncovering process is allowed to continue beyond 9 minutes corresponding to an uncovered height of 1.9 m, onset of cladding oxidation can be a reality. These values provide a guideline for the response time of the emergency core cooling systems. 10 refs., 22 figs.

  4. Multi-Function Fuel-Fired Heat Pump - 2013 Peer Review | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Develop Standard Method of Test for Integrated Heat Pump - 2013 Peer Review Working Fluids Low Global Warming Potential Refrigerants - 2013 Peer Review Buildings Performance ...

  5. Automotive Fuel Efficiency Improvement via Exhaust Gas Waste Heat Conversion to Electricity

    Broader source: Energy.gov [DOE]

    Working to expand the usage of thermoelectric technology beyond seat heating and cooling and in doing so reduce CO2 emissions and conserve energy.

  6. Using Heat and Chemistry to Make Products, Fuels, and Power: Thermochemical Conversion

    SciTech Connect (OSTI)

    2010-09-01

    Information about the Biomass Program's collaborative projects exploring thermochemical conversion processes that use heat and chemistry to convert biomass into a liquid or gaseous intermediate.

  7. Low Temperature Heat Release Behavior of Conventional and Alternative Fuels in a Motored Engine

    Broader source: Energy.gov [DOE]

    Presentation given at DEER 2006, August 20-24, 2006, Detroit, Michigan. Sponsored by the U.S. DOE's EERE FreedomCar and Fuel Partnership and 21st Century Truck Programs.

  8. Case Study: Fuel Cells Provide Combined Heat and Power at Verizon's Garden City Central Office

    Fuel Cell Technologies Publication and Product Library (EERE)

    This case study describes how Verizon's Central Office in Garden City, NY, installed a 1.4-MW phosphoric acid fuel cell system as an alternative solution to bolster electric reliability, optimize the

  9. High Temperature Fuel Cell Tri-Generation of Power, Heat & H2 from Biogas

    Broader source: Energy.gov [DOE]

    Success story about using waste water treatment gas for hydrogen production at UC Irvine. Presented by Jack Brouwer, UC Irvine, at the NREL/DOE Biogas and Fuel Cells Workshop held June 11-13, 2012, in Golden, Colorado.

  10. Modeling Cladding-Coolant Heat Transfer of High-Burnup Fuel During...

    Office of Scientific and Technical Information (OSTI)

    the fuel performance code FRAPTRAN 1.2. The minimum stable film boiling temperature, affected by the subcooling and the clad oxidation, is modeled by a modified Henry correlation. ...

  11. Airlines & Aviation Alternative Fuels: Our Drive to Be Early...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market Adopters Airlines & Aviation Alternative Fuels: Our Drive to Be Early Market Adopters Plenary III: Early Market ...

  12. Fuel Cells in Telecommunications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cells Simply Powerful Fuel Cells in Telecommunications J. Blanchard December 2011 - ReliOn Overview Markets Backup, grid supplement, and off grid power systems for critical ...

  13. Development of a coal-fueled Internal Manifold Heat Exchanger (IMHEX{reg_sign}) molten carbonate fuel cell. Volumes 1--6, Final report

    SciTech Connect (OSTI)

    Not Available

    1991-09-01

    The design of a CGMCFC electric generation plant that will provide a cost of eletricity (COE) which is lower than that of current electric generation technologies and which is competitive with other long-range electric generating systems is presented. This effort is based upon the Internal Manifold Heat Exchanger (IMHEX) technology as developed by the Institute of Gas Technology (IGT). The project was executed by selecting economic and performance objectives for alternative plant arrangements while considering process constraints identified during IMHEX fuel cell development activities at ICT. The four major subsystems of a coal-based MCFC power plant are coal gasification, gas purification, fuel cell power generation and the bottoming cycle. The design and method of operation of each subsystem can be varied, and, depending upon design choices, can have major impact on both the design of other subsystems and the resulting cost of electricity. The challenge of this project was to select, from a range of design parameters, those operating conditions that result in a preferred plant design. Computer modelling was thus used to perform sensitivity analyses of as many system variables as program resources and schedules would permit. In any systems analysis, it is imperative that the evaluation methodology be verifiable and comparable. The TAG Class I develops comparable (if imprecise) data on performance and costs for the alternative cases being studied. It identifies, from a range of options, those which merit more exacting scrutiny to be undertaken at the second level, TAG class II analysis.

  14. Fuel pin

    DOE Patents [OSTI]

    Christiansen, David W. (Kennewick, WA); Karnesky, Richard A. (Richland, WA); Leggett, Robert D. (Richland, WA); Baker, Ronald B. (Richland, WA)

    1989-01-01

    A fuel pin for a liquid metal nuclear reactor is provided. The fuel pin includes a generally cylindrical cladding member with metallic fuel material disposed therein. At least a portion of the fuel material extends radially outwardly to the inner diameter of the cladding member to promote efficient transfer of heat to the reactor coolant system. The fuel material defines at least one void space therein to facilitate swelling of the fuel material during fission.

  15. Fuel pin

    DOE Patents [OSTI]

    Christiansen, D.W.; Karnesky, R.A.; Leggett, R.D.; Baker, R.B.

    1987-11-24

    A fuel pin for a liquid metal nuclear reactor is provided. The fuel pin includes a generally cylindrical cladding member with metallic fuel material disposed therein. At least a portion of the fuel material extends radially outwardly to the inner diameter of the cladding member to promote efficient transfer of heat to the reactor coolant system. The fuel material defines at least one void space therein to facilitate swelling of the fuel material during fission.

  16. Case Study: Fuel Cells Provide Combined Heat and Power at Verizon's Garden City Central Office

    SciTech Connect (OSTI)

    2010-12-01

    This case study describes how Verizon's Central Office in Garden City, NY, installed a 1.4-MW phosphoric acid fuel cell system as an alternative solution to bolster electric reliability, optimize the company's energy use, and reduce costs in an environmentally responsible manner.

  17. 2010 Manufacturing Readiness Assessment Update to the 2008 Report for Fuel Cell Stacks and Systems for the Backup Power and Materials Handling Equipment Markets

    SciTech Connect (OSTI)

    Wheeler, D.; Ulsh, M.

    2012-08-01

    In 2008, the National Renewable Energy Laboratory (NREL), under contract to the US Department of Energy (DOE), conducted a manufacturing readiness assessment (MRA) of fuel cell systems and fuel cell stacks for back-up power and material handling applications (MHE). To facilitate the MRA, manufacturing readiness levels (MRL) were defined that were based on the Technology Readiness Levels previously established by the US Department of Energy (DOE). NREL assessed the extensive existing hierarchy of MRLs developed by Department of Defense (DoD) and other Federal entities, and developed a MRL scale adapted to the needs of the Fuel Cell Technologies Program (FCTP) and to the status of the fuel cell industry. The MRL ranking of a fuel cell manufacturing facility increases as the manufacturing capability transitions from laboratory prototype development through Low Rate Initial Production to Full Rate Production. DOE can use MRLs to address the economic and institutional risks associated with a ramp-up in polymer electrolyte membrane (PEM) fuel cell production. In 2010, NREL updated this assessment, including additional manufacturers, an assessment of market developments since the original report, and a comparison of MRLs between 2008 and 2010.

  18. List of Heat recovery Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heat Solar Thermal Electric Solar Thermal Process Heat Solar Water Heat Energy Storage Nuclear Wind Heat recovery Fuel Cells using Renewable Fuels No Agricultural Energy Efficiency...

  19. A 2-D Test Problem for CFD Modeling Heat Transfer in Spent Fuel Transfer Cask Neutron Shields

    SciTech Connect (OSTI)

    Zigh, Ghani; Solis, Jorge; Fort, James A.

    2011-01-14

    In the United States, commercial spent nuclear fuel is typically moved from spent fuel pools to outdoor dry storage pads within a transfer cask system that provides radiation shielding to protect personnel and the surrounding environment. The transfer casks are cylindrical steel enclosures with integral gamma and neutron radiation shields. Since the transfer cask system must be passively cooled, decay heat removal from spent nuclear fuel canister is limited by the rate of heat transfer through the cask components, and natural convection from the transfer cask surface. The primary mode of heat transfer within the transfer cask system is conduction, but some cask designs incorporate a liquid neutron shield tank surrounding the transfer cask structural shell. In these systems, accurate prediction of natural convection within the neutron shield tank is an important part of assessing the overall thermal performance of the transfer cask system. The large-scale geometry of the neutron shield tank, which is typically an annulus approximately 2 meters in diameter but only 5-10 cm in thickness, and the relatively small scale velocities (typically less than 5 cm/s) represent a wide range of spatial and temporal scales that contribute to making this a challenging problem for computational fluid dynamics (CFD) modeling. Relevant experimental data at these scales are not available in the literature, but some recent modeling studies offer insights into numerical issues and solutions; however, the geometries in these studies, and for the experimental data in the literature at smaller scales, all have large annular gaps that are not prototypic of the transfer cask neutron shield. This paper presents results for a simple 2-D problem that is an effective numerical analog for the neutron shield application. Because it is 2-D, solutions can be obtained relatively quickly allowing a comparison and assessment of sensitivity to model parameter changes. Turbulence models are considered as well as the tradeoff between steady state and transient solutions. Solutions are compared for two commercial CFD codes, FLUENT and STAR-CCM+. The results can be used to provide input to the CFD Best Practices for this application. Following study results for the 2-D test problem, a comparison of simulation results is provided for a high Rayleigh number experiment with large annular gap. Because the geometry of this validation is significantly different from the neutron shield, and due to the critical nature of this application, the argument is made for new experiments at representative scales

  20. Design of an Online Fission Gas Monitoring System for Post-irradiation Examination Heating Tests of Coated Fuel Particles for High-Temperature Gas-Cooled Reactors

    SciTech Connect (OSTI)

    Dawn Scates

    2010-10-01

    A new Fission Gas Monitoring System (FGMS) has been designed at the Idaho National Laboratory (INL) for use of monitoring online fission gas-released during fuel heating tests. The FGMS will be used with the Fuel Accident Condition Simulator (FACS) at the Hot Fuels Examination Facility (HFEF) located at the Materials and Fuels Complex (MFC) within the INL campus. Preselected Advanced Gas Reactor (AGR) TRISO (Tri-isotropic) fuel compacts will undergo testing to assess the fission product retention characteristics under high temperature accident conditions. The FACS furnace will heat the fuel to temperatures up to 2,000C in a helium atmosphere. Released fission products such as Kr and Xe isotopes will be transported downstream to the FGMS where they will accumulate in cryogenically cooledcollection traps and monitored with High Purity Germanium (HPGe) detectors during the heating process. Special INL developed software will be used to monitor the accumulated fission products and will report data in near real-time. These data will then be reported in a form that can be readily available to the INL reporting database. This paper describes the details of the FGMS design, the control and acqusition software, system calibration, and the expected performance of the FGMS. Preliminary online data may be available for presentation at the High Temperature Reactor (HTR) conference.

  1. Evaluation of Aqueous and Powder Processing Techniques for Production of Pu-238-Fueled General Purpose Heat Sources

    SciTech Connect (OSTI)

    Not Available

    2008-06-01

    This report evaluates alternative processes that could be used to produce Pu-238 fueled General Purpose Heat Sources (GPHS) for radioisotope thermoelectric generators (RTG). Fabricating GPHSs with the current process has remained essentially unchanged since its development in the 1970s. Meanwhile, 30 years of technological advancements have been made in the fields of chemistry, manufacturing, ceramics, and control systems. At the Department of Energy’s request, alternate manufacturing methods were compared to current methods to determine if alternative fabrication processes could reduce the hazards, especially the production of respirable fines, while producing an equivalent GPHS product. An expert committee performed the evaluation with input from four national laboratories experienced in Pu-238 handling.

  2. Liquid Fuels Market Module

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    product import and export curves, biodiesel import supply curves, and advanced ethanol import supply curves from Brazil. The nine LFMM regions and importexport curves are...

  3. Novel Sorbent to Clean Biogas for Fuel Cell Combined Heat and Power Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Gökhan O. Alptekin TDA Research, Inc. Wheat Ridge, CO U.S. DOE Advanced Manufacturing Office Peer Review Meeting Washington, D.C. May 6-7, 2014 This presentation does not contain any proprietary, confidential, or otherwise restricted information. Project Objective  The objective is to develop a low-cost, high-capacity expendable sorbent to remove both sulfur species in biogas to ppb levels, making its use possible in a fuel cell CHP unit  The high concentrations of sulfur species in the

  4. What We've Learned from 2.5 Years of Early Market Fuel Cell Operation (Presentation)

    SciTech Connect (OSTI)

    Kurtz, J.; Sprik, S.; Ramsden, T.; Saur, G.; Ainscough, C.

    2013-02-01

    This presentation describes the results of NREL technology assessments for two early market full cell applications, backup power and material handling equipment.

  5. EA-1887: Renewable Fuel Heat Plant Improvements at the National Renewable Energy Laboratory, Golden, Colorado (DOE/EA-1573-S1)

    Broader source: Energy.gov [DOE]

    Draft Supplemental Environmental Assessment This EA will evaluate the environmental impacts of a proposal to make improvements to the Renewable Fuel Heat Plant including construction and operation of a wood chip storage silo and the associated material handling conveyances and utilization of regional wood sources.

  6. Proceedings of the joint contractors meeting: FE/EE Advanced Turbine Systems conference FE fuel cells and coal-fired heat engines conference

    SciTech Connect (OSTI)

    Geiling, D.W.

    1993-08-01

    The joint contractors meeting: FE/EE Advanced Turbine Systems conference FEE fuel cells and coal-fired heat engines conference; was sponsored by the US Department of Energy Office of Fossil Energy and held at the Morgantown Energy Technology Center, P.O. Box 880, Morgantown, West Virginia 26507-0880, August 3--5, 1993. Individual papers have been entered separately.

  7. Stationary Fuel Cell System Composite Data Products: Data through...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Equipment, Waste Heat Recovery Costs, ... Fuel Cell CHP Fuel Cell Electric Gas Turbine Internal Combustion ... Equipment, Waste Heat Recovery Costs, ...

  8. Vehicle Technologies Office Merit Review 2014: Removing Barriers, Implementing Policies and Advancing Alternative Fuels Markets in New England

    Broader source: Energy.gov [DOE]

    Presentation given by Greater Portland Council of Governments at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about...

  9. Absorption Heat Pump Water Heater

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Absorption Heat Pump Water Heater Kyle Gluesenkamp Building Equipment Group, ETSD ... tested in early April An absorption heat pump transfers heat to the water from fuel and ...

  10. DAVID Fuel Cell Components SL | Open Energy Information

    Open Energy Info (EERE)

    manufacture and marketing of components and devices for PEM fuel cells, direct methanol fuel cells (DMFC) and fuel reformers. References: DAVID Fuel Cell Components SL1...

  11. Self-reported Impacts of LED Lighting Technology Compared to Fuel-based Lighting on Night Market Business Prosperity in Kenya

    SciTech Connect (OSTI)

    Johnstone, Peter; Jacobson, Arne; Mills, Evan; Mumbi, Maina

    2009-02-11

    The notion of"productive use" is often invoked in discussions about whether new technologies improve productivity or otherwise enhance commerce in developing-country contexts. It an elusive concept,especially when quantitative measures are sought. Improved and more energy efficient illumination systems for off-gridapplication--the focus of the Lumina Project--provide a case in which a significant productivity benefit can be imagined, given the importance of light to the successful performance of many tasks, and the very low quality of baseline illumination provided by flame-based source. This Research Note summarizes self-reported quantitative and qualitative impacts of switching to LED lighting technology on the prosperity of night-market business owners and operators. The information was gathered in the context of our 2008 market testing field work in Kenya?s Rift Valley Province, which was performed in the towns of Maai Mahiu and Karagita by Arne Jacobson, Kristen Radecsky, Peter Johnstone, Maina Mumbi, and others. Maai Mahiu is a crossroads town; provision of services to travelers and freight carriers is a primary income source for the residents. In contrast, the primary income for Karagita's residents is from work in the large, factory style flower farms on the eastern shores of Lake Naivasha that specialize in producing cut flowers for export to the European market. According to residents, both towns had populations of 6,000 to 8,000 people in June 2008. We focused on quantifying the economics of fuel-based and LED lighting technology in the context of business use by night market vendors and shop keepers. Our research activities with the business owners and operators included baseline measurement of their fuel-based lighting use, an initial survey, offering for sale data logger equipped rechargeable LED lamps, monitoring the adoption of the LED lamps, and a follow-up survey.

  12. State Heating Oil & Propane Program. Final report 1997/98 heating season

    SciTech Connect (OSTI)

    Hunton, G.

    1998-06-01

    The following is a summary report of the New Hampshire Governor`s Office of Energy and Community Services (ECS) participation in the State Heating Oil and Propane Program (SHOPP) for the 1997/98 heating season. SHOPP is a cooperative effort, linking energy offices in East Coast and Midwest states, with the Department of Energy (DOE), Energy Information Administration (EIA) for the purpose of collecting retail price data for heating oil and propane. The program is funded by the participating state with a matching grant from DOE. SHOPP was initiated in response to congressional inquires into supply difficulties and price spikes of heating oil and propane associated with the winter of 1989/90. This is important to New Hampshire because heating oil controls over 55% of the residential heating market statewide. Propane controls 10% of the heating market statewide and is widely used for water heating and cooking in areas of the state where natural gas is not available. Lower installation cost, convenience, lower operating costs compared to electricity, and its perception as a clean heating fuel have all worked to increase the popularity of propane in New Hampshire and should continue to do so in the future. Any disruption in supply of these heating fuels to New Hampshire could cause prices to skyrocket and leave many residents in the cold.

  13. Biofuels Market Opportunities | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Market Opportunities Biofuels Market Opportunities Breakout Session 2C-Fostering Technology Adoption II: Expanding the Pathway to Market Biofuels Market Opportunities John Eichberger, Vice President Government Relations, National Association of Convenience Stores PDF icon eichberger_biomass_2014.pdf More Documents & Publications End Use and Fuel Certification Fuels of the Future: Accelerating the Co-Optimization of Fuels and Engines Flexible Fuel Vehicles: Providing a Renewable Fuel

  14. Hydrogen Fuel for Material Handling

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CLASS 3 Forklift Value to the MHE Market z Trend has been toward electric - Indoor air quality issues z Early adopter of fuel cell technology technology - Fleet market - ...

  15. A Total Cost of Ownership Model for Low Temperature PEM Fuel Cells in Combined Heat and Power and Backup Power Applications

    SciTech Connect (OSTI)

    University of California, Berkeley; Wei, Max; Lipman, Timothy; Mayyas, Ahmad; Chien, Joshua; Chan, Shuk Han; Gosselin, David; Breunig, Hanna; Stadler, Michael; McKone, Thomas; Beattie, Paul; Chong, Patricia; Colella, Whitney; James, Brian

    2014-06-23

    A total cost of ownership model is described for low temperature proton exchange membrane stationary fuel cell systems for combined heat and power (CHP) applications from 1-250kW and backup power applications from 1-50kW. System designs and functional specifications for these two applications were developed across the range of system power levels. Bottom-up cost estimates were made for balance of plant costs, and detailed direct cost estimates for key fuel cell stack components were derived using design-for-manufacturing-and-assembly techniques. The development of high throughput, automated processes achieving high yield are projected to reduce the cost for fuel cell stacks to the $300/kW level at an annual production volume of 100 MW. Several promising combinations of building types and geographical location in the U.S. were identified for installation of fuel cell CHP systems based on the LBNL modelling tool DER CAM. Life-cycle modelling and externality assessment were done for hotels and hospitals. Reduced electricity demand charges, heating credits and carbon credits can reduce the effective cost of electricity ($/kWhe) by 26-44percent in locations such as Minneapolis, where high carbon intensity electricity from the grid is displaces by a fuel cell system operating on reformate fuel. This project extends the scope of existing cost studies to include externalities and ancillary financial benefits and thus provides a more comprehensive picture of fuel cell system benefits, consistent with a policy and incentive environment that increasingly values these ancillary benefits. The project provides a critical, new modelling capacity and should aid a broad range of policy makers in assessing the integrated costs and benefits of fuel cell systems versus other distributed generation technologies.

  16. One Market Plaza

    SciTech Connect (OSTI)

    2010-04-01

    This is a combined heat and power (CHP) project profile on a 1.5 MW CHP system at One Market Plaza in San Francisco, California.

  17. Fuel Cells on Bio-Gas (Presentation)

    SciTech Connect (OSTI)

    Remick, R. J.

    2009-03-04

    The conclusions of this presentation are: (1) Fuel cells operating on bio-gas offer a pathway to renewable electricity generation; (2) With federal incentives of $3,500/kW or 30% of the project costs, reasonable payback periods of less than five years can be achieved; (3) Tri-generation of electricity, heat, and hydrogen offers an alternative route to solving the H{sub 2} infrastructure problem facing fuel cell vehicle deployment; and (4) DOE will be promoting bio-gas fuel cells in the future under its Market Transformation Programs.

  18. Geothermal Energy Market Study on the Atlantic Coastal Plain: Technical Feasibility of use of Eastern Geothermal Energy in Vacuum Distillation of Ethanol Fuel

    SciTech Connect (OSTI)

    1981-04-01

    The DOE is studying availability, economics, and uses of geothermal energy. These studies are being conducted to assure maximum cost-effective use of geothermal resources. The DOE is also aiding development of a viable ethanol fuel industry. One important point of the ethanol program is to encourage use of non-fossil fuels, such as geothermal energy, as process heat to manufacture ethanol. Geothermal waters available in the eastern US tend to be lower in temperature (180 F or less) than those available in the western states (above 250 F). Technically feasible use of eastern geothermal energy for ethanol process heat requires use of technology that lowers ethanol process temperature requirements. Vacuum (subatmospheric) distillation is one such technology. This study, then, addresses technical feasibility of use of geothermal energy to provide process heat to ethanol distillation units operated at vacuum pressures. They conducted this study by performing energy balances on conventional and vacuum ethanol processes of ten million gallons per year size. Energy and temperature requirements for these processes were obtained from the literature or were estimated (for process units or technologies not covered in available literature). Data on available temperature and energy of eastern geothermal resources was obtained from the literature. These data were compared to ethanol process requirements, assuming a 150 F geothermal resource temperature. Conventional ethanol processes require temperatures of 221 F for mash cooking to 240 F for stripping. Fermentation, conducted at 90 F, is exothermic and requires no process heat. All temperature requirements except those for fermentation exceed assumed geothermal temperatures of 150 F. They assumed a 130 millimeter distillation pressure for the vacuum process. It requires temperatures of 221 F for mash cooking and 140 F for distillation. Data indicate lower energy requirements for the vacuum ethanol process (30 million BTUs per hour) than for the conventional process (36 million BTUs per hour). Lower energy requirements result from improved process energy recovery. Data examined in this study indicate feasible use of eastern geothermal heated waters (150 F) to provide process heat for vacuum (130 mm Hg) ethanol distillation units. Data indicate additional heat sources are needed to raise geothermal temperatures to the 200 F level required by mash cooking. Data also indicate potential savings in overall process energy use through use of vacuum distillation technology. Further study is needed to confirm conclusions reached during this study. Additional work includes obtaining energy use data from vacuum ethanol distillation units currently operating in the 130 millimeter pressure range; economic analysis of different vacuum pressures to select an optimum; and operation of a pilot geothermally heated vacuum column to produce confirmatory process data.

  19. Hydrogen and Fuel Cell Activities

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Activities Mr. Pete Devlin U.S. Department of Energy Fuel Cell Technologies Program Market Transformation Manager Stationary Fuel Cell Applications First National Bank of Omaha...

  20. Optimizal design and control strategies for novel Combined Heat and Power (CHP) fuel cell systems. Part II of II, case study results.

    SciTech Connect (OSTI)

    Colella, Whitney G.

    2010-04-01

    Innovative energy system optimization models are deployed to evaluate novel fuel cell system (FCS) operating strategies, not typically pursued by commercial industry. Most FCS today are installed according to a 'business-as-usual' approach: (1) stand-alone (unconnected to district heating networks and low-voltage electricity distribution lines), (2) not load following (not producing output equivalent to the instantaneous electrical or thermal demand of surrounding buildings), (3) employing a fairly fixed heat-to-power ratio (producing heat and electricity in a relatively constant ratio to each other), and (4) producing only electricity and no recoverable heat. By contrast, models discussed here consider novel approaches as well. Novel approaches include (1) networking (connecting FCSs to electrical and/or thermal networks), (2) load following (having FCSs produce only the instantaneous electricity or heat demanded by surrounding buildings), (3) employing a variable heat-to-power ratio (such that FCS can vary the ratio of heat and electricity they produce), (4) co-generation (combining the production of electricity and recoverable heat), (5) permutations of these together, and (6) permutations of these combined with more 'business-as-usual' approaches.

  1. Optimal design and control strategies for novel combined heat and power (CHP) fuel cell systems. Part II of II, case study results.

    SciTech Connect (OSTI)

    Colella, Whitney G.

    2010-06-01

    Innovative energy system optimization models are deployed to evaluate novel fuel cell system (FCS) operating strategies, not typically pursued by commercial industry. Most FCS today are installed according to a 'business-as-usual' approach: (1) stand-alone (unconnected to district heating networks and low-voltage electricity distribution lines), (2) not load following (not producing output equivalent to the instantaneous electrical or thermal demand of surrounding buildings), (3) employing a fairly fixed heat-to-power ratio (producing heat and electricity in a relatively constant ratio to each other), and (4) producing only electricity and no recoverable heat. By contrast, models discussed here consider novel approaches as well. Novel approaches include (1) networking (connecting FCSs to electrical and/or thermal networks), (2) load following (having FCSs produce only the instantaneous electricity or heat demanded by surrounding buildings), (3) employing a variable heat-to-power ratio (such that FCS can vary the ratio of heat and electricity they produce), (4) co-generation (combining the production of electricity and recoverable heat), (5) permutations of these together, and (6) permutations of these combined with more 'business-as-usual' approaches. The detailed assumptions and methods behind these models are described in Part I of this article pair.

  2. Assessment of the Current Level of Automation in the Manufacture of Fuel Cell Systems for Combined Heat and Power Applications

    SciTech Connect (OSTI)

    Ulsh, M.; Wheeler, D.; Protopappas, P.

    2011-08-01

    The U.S. Department of Energy (DOE) is interested in supporting manufacturing research and development (R&D) for fuel cell systems in the 10-1,000 kilowatt (kW) power range relevant to stationary and distributed combined heat and power applications, with the intent to reduce manufacturing costs and increase production throughput. To assist in future decision-making, DOE requested that the National Renewable Energy Laboratory (NREL) provide a baseline understanding of the current levels of adoption of automation in manufacturing processes and flow, as well as of continuous processes. NREL identified and visited or interviewed key manufacturers, universities, and laboratories relevant to the study using a standard questionnaire. The questionnaire covered the current level of vertical integration, the importance of quality control developments for automation, the current level of automation and source of automation design, critical balance of plant issues, potential for continuous cell manufacturing, key manufacturing steps or processes that would benefit from DOE support for manufacturing R&D, the potential for cell or stack design changes to support automation, and the relationship between production volume and decisions on automation.

  3. Characterization and Quantification of Electronic and Ionic Ohmic Overpotential and Heat Generation in a Solid Oxide Fuel Cell Anode

    SciTech Connect (OSTI)

    Grew, Kyle N.; Izzo, John R.; Chiu, Wilson K.S.

    2011-08-16

    The development of a solid oxide fuel cell (SOFC) with a higher efficiency and power density requires an improved understanding and treatment of the irreversibilities. Losses due to the electronic and ionic resistances, which are also known as ohmic losses in the form of Joule heating, can hinder the SOFC's performance. Ohmic losses can result from the bulk material resistivities as well as the complexities introduced by the cell's microstructure. In this work, two-dimensional (2D), electronic and ionic transport models are used to develop a method of quantification of the ohmic losses within the SOFC anode microstructure. This quantification is completed as a function of properties determined from a detailed microstructure characterization, namely, the tortuosity of the electronic and ionic phases, phase volume fraction, contiguity, and mean free path. A direct modeling approach at the level of the pore-scale microstructure is achieved through the use of a representative volume element (RVE) method. The correlation of these ohmic losses with the quantification of the SOFC anode microstructure are examined. It is found with this analysis that the contributions of the SOFC anode microstructure on ohmic losses can be correlated with the volume fraction, contiguity, and mean free path.

  4. Characterization and Quantification of Electronic and Ionic Ohmic Overpotential and Heat Generation in a Solid Oxide Fuel Cell Anode

    SciTech Connect (OSTI)

    Grew, Kyle N.; Izzo, Jr., John R.; Chiu, W. K. S.

    2011-01-01

    The development of a solid oxide fuel cell (SOFC) with a higher efficiency and power density requires an improved understanding and treatment of the irreversibilities. Losses due to the electronic and ionic resistances, which are also known as ohmic losses in the form of Joule heating, can hinder the SOFCs performance. Ohmic losses can result from the bulk material resistivities as well as the complexities introduced by the cells microstructure. In this work, two-dimensional (2D), electronic and ionic transport models are used to develop a method of quantification of the ohmic losses within the SOFC anode microstructure. This quantification is completed as a function of properties determined from a detailed microstructure characterization, namely, the tortuosity of the electronic and ionic phases, phase volume fraction, contiguity, and mean free path. A direct modeling approach at the level of the pore-scale microstructure is achieved through the use of a representative volume element (RVE) method. The correlation of these ohmic losses with the quantification of the SOFC anode microstructure are examined. It is found with this analysis that the contributions of the SOFC anode microstructure on ohmic losses can be correlated with the volume fraction, contiguity, and mean free path.

  5. Evaluating temperature and fuel stratification for heat-release rate control in a reactivity-controlled compression-ignition engine using optical diagnostics and chemical kinetics modeling

    SciTech Connect (OSTI)

    Musculus, Mark P. B.; Kokjohn, Sage L.; Reitz, Rolf D.

    2015-04-23

    We investigated the combustion process in a dual-fuel, reactivity-controlled compression-ignition (RCCI) engine using a combination of optical diagnostics and chemical kinetics modeling to explain the role of equivalence ratio, temperature, and fuel reactivity stratification for heat-release rate control. An optically accessible engine is operated in the RCCI combustion mode using gasoline primary reference fuels (PRF). A well-mixed charge of iso-octane (PRF = 100) is created by injecting fuel into the engine cylinder during the intake stroke using a gasoline-type direct injector. Later in the cycle, n-heptane (PRF = 0) is delivered through a centrally mounted diesel-type common-rail injector. This injection strategy generates stratification in equivalence ratio, fuel blend, and temperature. The first part of this study uses a high-speed camera to image the injection events and record high-temperature combustion chemiluminescence. Moreover, the chemiluminescence imaging showed that, at the operating condition studied in the present work, mixtures in the squish region ignite first, and the reaction zone proceeds inward toward the center of the combustion chamber. The second part of this study investigates the charge preparation of the RCCI strategy using planar laser-induced fluorescence (PLIF) of a fuel tracer under non-reacting conditions to quantify fuel concentration distributions prior to ignition. The fuel-tracer PLIF data show that the combustion event proceeds down gradients in the n-heptane distribution. The third part of the study uses chemical kinetics modeling over a range of mixtures spanning the distributions observed from the fuel-tracer fluorescence imaging to isolate the roles of temperature, equivalence ratio, and PRF number stratification. The simulations predict that PRF number stratification is the dominant factor controlling the ignition location and growth rate of the reaction zone. Equivalence ratio has a smaller, but still significant, influence. Lastly, temperature stratification had a negligible influence due to the NTC behavior of the PRF mixtures.

  6. DOE Hydrogen and Fuel Cell Overview: 2011 Hydrogen Infrastructure...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Fuel Cell Overview: 2011 Hydrogen Infrastructure Market Readiness Workshop DOE Hydrogen and Fuel Cell Overview: 2011 Hydrogen Infrastructure Market Readiness Workshop ...

  7. Refuse-derived fuels in US Air Force heating and power systems. Final report, June 1982-February 1985

    SciTech Connect (OSTI)

    Joensen, A.W.

    1986-01-01

    This investigation was conducted to document and review all data associated with densified refuse-derived fuel (dRDF)--its preparation and properties, storage and handling, boiler cofiring efficiency and environmental emissions, potential boiler metal wastage, and any other experiences associated with the use of this fuel. The results of this investigation provide the basis for the development of an optimum dRDF fuel specification. These results identify performance characteristics and operating problems of the existing dRDF fuel pellet and contain an economic feasibility assessment of using this fuel.

  8. Market Analyses | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat & Power Deployment » Market Analyses Market Analyses Need information on the market potential for combined heat and power (CHP) in the U.S.? These assessments and analyses cover a wide range of markets including commercial and institutional buildings and facilities, district energy, and industrial sites. The market potential for CHP at federal sites and in selected states/regions is also examined. Commercial CHP and Bioenergy Systems for Landfills and Wastewater Treatment

  9. Vehicle Fuel Economy Improvement through Thermoelectric Waste...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Economy Improvement through Thermoelectric Waste Heat Recovery Vehicle Fuel Economy Improvement through Thermoelectric Waste Heat Recovery 2005 Diesel Engine Emissions ...

  10. Fuel Cell Technologies Program Multi-Year Research, Development...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel cells provide power and heat cleanly and efficiently, using diverse domestic fuels, including hydrogen produced from renewable resources and biomass-based fuels. Fuel ...

  11. Well-to-Wheels Greenhouse Gas Emissions Analysis of High-Octane Fuels with Various Market Shares and Ethanol Blending Levels

    SciTech Connect (OSTI)

    Han, Jeongwoo; Elgowainy, Amgad; Wang, Michael; Divita, Vincent

    2015-07-14

    In this study, we evaluated the impacts of producing HOF with a RON of 100, using a range of ethanol blending levels (E10, E25, and E40), vehicle efficiency gains, and HOF market penetration scenarios (3.4% to 70%), on WTW petroleum use and GHG emissions. In particular, we conducted LP modeling of petroleum refineries to examine the impacts of different HOF production scenarios on petroleum refining energy use and GHG emissions. We compared two cases of HOF vehicle fuel economy gains of 5% and 10% in terms of MPGGE to baseline regular gasoline vehicles. We incorporated three key factors in GREET — (1) refining energy intensities of gasoline components for the various ethanol blending options and market shares, (2) vehicle efficiency gains, and (3) upstream energy use and emissions associated with the production of different crude types and ethanol — to compare the WTW GHG emissions of various HOF/vehicle scenarios with the business-as-usual baseline regular gasoline (87 AKI E10) pathway.

  12. Fuel Cell Technologies Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... UTC Power, the fuel cell division of engineering conglomerate United Technologies, ... Examples of CHP Deployments The Food Industry is an emerging market for ...

  13. Fuel Cell Animation- Fuel Cell Stack (Text Version)

    Broader source: Energy.gov [DOE]

    This text version of the fuel cell animation demonstrates how a fuel cell uses hydrogen to produce electricity, with only water and heat as byproducts.

  14. Fuel Cell Animation- Fuel Cell Components (Text Version)

    Broader source: Energy.gov [DOE]

    This text version of the fuel cell animation demonstrates how a fuel cell uses hydrogen to produce electricity, with only water and heat as byproducts.

  15. List of Fuel Cells using Renewable Fuels Incentives | Open Energy...

    Open Energy Info (EERE)

    using Renewable Fuels Geothermal Electric Photovoltaics Renewable Fuels Solar Water Heat Natural Gas Hydroelectric energy Small Hydroelectric Yes Alternative Energy Conservation...

  16. Fuel from wastewater : harnessing a potential energy source in Canada through the co-location of algae biofuel production to sources of effluent, heat and CO2.

    SciTech Connect (OSTI)

    Passell, Howard David; Whalen, Jake; Pienkos, Philip P.; O'Leary, Stephen J.; Roach, Jesse Dillon; Moreland, Barbara D.; Klise, Geoffrey Taylor

    2010-12-01

    Sandia National Laboratories is collaborating with the National Research Council (NRC) Canada and the National Renewable Energy Laboratory (NREL) to develop a decision-support model that will evaluate the tradeoffs associated with high-latitude algae biofuel production co-located with wastewater, CO2, and waste heat. This project helps Canada meet its goal of diversifying fuel sources with algae-based biofuels. The biofuel production will provide a wide range of benefits including wastewater treatment, CO2 reuse and reduction of demand for fossil-based fuels. The higher energy density in algae-based fuels gives them an advantage over crop-based biofuels as the 'production' footprint required is much less, resulting in less water consumed and little, if any conversion of agricultural land from food to fuel production. Besides being a potential source for liquid fuel, algae have the potential to be used to generate electricity through the burning of dried biomass, or anaerobically digested to generate methane for electricity production. Co-locating algae production with waste streams may be crucial for making algae an economically valuable fuel source, and will certainly improve its overall ecological sustainability. The modeling process will address these questions, and others that are important to the use of water for energy production: What are the locations where all resources are co-located, and what volumes of algal biomass and oil can be produced there? In locations where co-location does not occur, what resources should be transported, and how far, while maintaining economic viability? This work is being funded through the U.S. Department of Energy (DOE) Biomass Program Office of Energy Efficiency and Renewable Energy, and is part of a larger collaborative effort that includes sampling, strain isolation, strain characterization and cultivation being performed by the NREL and Canada's NRC. Results from the NREL / NRC collaboration including specific productivities of selected algal strains will eventually be incorporated into this model.

  17. MARKET BASED APPROACHES

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... fuel availability have been studied in CNG context but not well proven in the free market. ... technology development * Initial very low volume sales regime cannot be modeled except in ...

  18. Coal markets squeeze producers

    SciTech Connect (OSTI)

    Ryan, M.

    2005-12-01

    Supply/demand fundamentals seem poised to keep prices of competing fossil fuels high, which could cushion coal prices, but increased mining and transportation costs may squeeze producer profits. Are markets ready for more volatility?

  19. Evaluating temperature and fuel stratification for heat-release rate control in a reactivity-controlled compression-ignition engine using optical diagnostics and chemical kinetics modeling

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Musculus, Mark P. B.; Kokjohn, Sage L.; Reitz, Rolf D.

    2015-04-23

    We investigated the combustion process in a dual-fuel, reactivity-controlled compression-ignition (RCCI) engine using a combination of optical diagnostics and chemical kinetics modeling to explain the role of equivalence ratio, temperature, and fuel reactivity stratification for heat-release rate control. An optically accessible engine is operated in the RCCI combustion mode using gasoline primary reference fuels (PRF). A well-mixed charge of iso-octane (PRF = 100) is created by injecting fuel into the engine cylinder during the intake stroke using a gasoline-type direct injector. Later in the cycle, n-heptane (PRF = 0) is delivered through a centrally mounted diesel-type common-rail injector. This injectionmore » strategy generates stratification in equivalence ratio, fuel blend, and temperature. The first part of this study uses a high-speed camera to image the injection events and record high-temperature combustion chemiluminescence. Moreover, the chemiluminescence imaging showed that, at the operating condition studied in the present work, mixtures in the squish region ignite first, and the reaction zone proceeds inward toward the center of the combustion chamber. The second part of this study investigates the charge preparation of the RCCI strategy using planar laser-induced fluorescence (PLIF) of a fuel tracer under non-reacting conditions to quantify fuel concentration distributions prior to ignition. The fuel-tracer PLIF data show that the combustion event proceeds down gradients in the n-heptane distribution. The third part of the study uses chemical kinetics modeling over a range of mixtures spanning the distributions observed from the fuel-tracer fluorescence imaging to isolate the roles of temperature, equivalence ratio, and PRF number stratification. The simulations predict that PRF number stratification is the dominant factor controlling the ignition location and growth rate of the reaction zone. Equivalence ratio has a smaller, but still significant, influence. Lastly, temperature stratification had a negligible influence due to the NTC behavior of the PRF mixtures.« less

  20. Technology and Manufacturing Readiness of Early Market Motive and Non-Motive Hydrogen Storage Technologies for Fuel Cell Applications

    SciTech Connect (OSTI)

    Ronnebro, Ewa

    2012-06-16

    PNNL’s objective in this report is to provide DOE with a technology and manufacturing readiness assessment to identify hydrogen storage technologies’ maturity levels for early market motive and non-motive applications and to provide a path forward toward commercialization. PNNL’s Technology Readiness Assessment (TRA) is based on a combination of Technology Readiness Level (TRL) and Manufacturing Readiness Level (MRL) designations that enable evaluation of hydrogen storage technologies in varying levels of development. This approach provides a logical methodology and roadmap to enable the identification of hydrogen storage technologies, their advantages/disadvantages, gaps and R&D needs on an unbiased and transparent scale that is easily communicated to interagency partners. The TRA report documents the process used to conduct the TRA, reports the TRL and MRL for each assessed technology and provides recommendations based on the findings.

  1. End Use and Fuel Certification | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Market Opportunities High Octane Fuels Can Make Better Use of Renewable Transportation Fuels Making Better Use of Ethanol as a Transportation Fuel With "Renewable Super ...

  2. Renewable Fuel Standards Program Update | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Standards Program Update Renewable Fuel Standards Program Update Paul Argyropoulos, ... May 6, 2010 EISA 2007: Focus on Renewable Fuels Standard Program Market Drivers ...

  3. Liquid Fuel from Heat-Loving Microorganisms: H2-Dependent Conversion of CO2 to Liquid Electrofuels by Extremely Thermophilic Archaea

    SciTech Connect (OSTI)

    2010-07-01

    Electrofuels Project: NC State is working with the University of Georgia to create Electrofuels from primitive organisms called extremophiles that evolved before photosynthetic organisms and live in extreme, hot water environments with temperatures ranging from 167-212 degrees Fahrenheit The team is genetically engineering these microorganisms so they can use hydrogen to turn carbon dioxide directly into alcohol-based fuels. High temperatures are required to distill the biofuels from the water where the organisms live, but the heat-tolerant organisms will continue to thrive even as the biofuels are being distilledmaking the fuel-production process more efficient. The microorganisms dont require light, so they can be grown anywhereinside a dark reactor or even in an underground facility.

  4. Save Energy Now in Your Process Heating Systems; Industrial Technologi...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fossil fuels and biomass; electric systems; and heat ... improve your plant's bottom line. * Many improvements ... Heat Losses Heat Losses Heat Transfer Advanced Materials ...

  5. Method for producing bio-fuel that integrates heat from carbon-carbon bond-forming reactions to drive biomass gasification reactions

    DOE Patents [OSTI]

    Cortright, Randy D.; Dumesic, James A.

    2013-04-02

    A low-temperature catalytic process for converting biomass (preferably glycerol recovered from the fabrication of bio-diesel) to synthesis gas (i.e., H.sub.2/CO gas mixture) in an endothermic gasification reaction is described. The synthesis gas is used in exothermic carbon-carbon bond-forming reactions, such as Fischer-Tropsch, methanol, or dimethylether syntheses. The heat from the exothermic carbon-carbon bond-forming reaction is integrated with the endothermic gasification reaction, thus providing an energy-efficient route for producing fuels and chemicals from renewable biomass resources.

  6. Method for producing bio-fuel that integrates heat from carbon-carbon bond-forming reactions to drive biomass gasification reactions

    DOE Patents [OSTI]

    Cortright, Randy D.; Dumesic, James A.

    2012-04-10

    A low-temperature catalytic process for converting biomass (preferably glycerol recovered from the fabrication of bio-diesel) to synthesis gas (i.e., H.sub.2/CO gas mixture) in an endothermic gasification reaction is described. The synthesis gas is used in exothermic carbon-carbon bond-forming reactions, such as Fischer-Tropsch, methanol, or dimethylether syntheses. The heat from the exothermic carbon-carbon bond-forming reaction is integrated with the endothermic gasification reaction, thus providing an energy-efficient route for producing fuels and chemicals from renewable biomass resources.

  7. Method for producing bio-fuel that integrates heat from carbon-carbon bond-forming reactions to drive biomass gasification reactions

    DOE Patents [OSTI]

    Cortright, Randy D.; Dumesic, James A.

    2011-01-18

    A low-temperature catalytic process for converting biomass (preferably glycerol recovered from the fabrication of bio-diesel) to synthesis gas (i.e., H.sub.2/CO gas mixture) in an endothermic gasification reaction is described. The synthesis gas is used in exothermic carbon-carbon bond-forming reactions, such as Fischer-Tropsch, methanol, or dimethylether syntheses. The heat from the exothermic carbon-carbon bond-forming reaction is integrated with the endothermic gasification reaction, thus providing an energy-efficient route for producing fuels and chemicals from renewable biomass resources.

  8. Energy & Financial Markets: What Drives Crude Oil Prices? - Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration & Financial Markets - U.S. Energy Information Administration (EIA) U.S. Energy Information Administration - EIA - Independent Statistics and Analysis Sources & Uses Petroleum & Other Liquids Crude oil, gasoline, heating oil, diesel, propane, and other liquids including biofuels and natural gas liquids. Natural Gas Exploration and reserves, storage, imports and exports, production, prices, sales. Electricity Sales, revenue and prices, power plants, fuel

  9. Heating Oil and Propane Update

    Gasoline and Diesel Fuel Update (EIA)

    Maps of states participating in Winter Fuels Survey Residential propane PADD map Residential heating oil PADD map...

  10. AgriFuel Company | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Name: AgriFuel Company Place: Cranford, New Jersey Sector: Biofuels Product: AgriFuel produces and markets biofuels refined from waste vegetable oil,...

  11. Hydrogen and Fuel Cells Program Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    commercialization of hydrogen and fuel cell technologies: * Early markets such as ... Updated Program Plan May 2011 Hydrogen and Fuel Cells Key Goals 2 from renewables or low ...

  12. Alternative Fuels Data Center: Maps and Data

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Fuels & Infrastructure All Categories Fuels & Infrastructure Fuel Trends Emissions Alternative Fueling Stations Idle Reduction Transportation Infrastructure Biofuels Production Clean Cities Petroleum Use Reduction Vehicles Program Vehicles AFVs and HEVs Fuel Consumption and Efficiency Vehicle Market Driving Patterns Laws & Incentives Regulated Fleets State & Alt Fuel Providers Federal Fleets OR Go Sort by: Category Most Recent Most Popular 54 results Fuel Trends -

  13. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Infrastructure Incentives Study The Georgia Joint Alternative Fuels Infrastructure Study Committee will evaluate how providing market incentives for AFV fueling infrastructure may lead to AFV market deployment. The Committee will provide a report of its recommendations and proposed legislation by December 1, 2016. (Reference Senate Resolution 1038, 20

  14. Fuel processor for fuel cell power system

    DOE Patents [OSTI]

    Vanderborgh, Nicholas E.; Springer, Thomas E.; Huff, James R.

    1987-01-01

    A catalytic organic fuel processing apparatus, which can be used in a fuel cell power system, contains within a housing a catalyst chamber, a variable speed fan, and a combustion chamber. Vaporized organic fuel is circulated by the fan past the combustion chamber with which it is in indirect heat exchange relationship. The heated vaporized organic fuel enters a catalyst bed where it is converted into a desired product such as hydrogen needed to power the fuel cell. During periods of high demand, air is injected upstream of the combustion chamber and organic fuel injection means to burn with some of the organic fuel on the outside of the combustion chamber, and thus be in direct heat exchange relation with the organic fuel going into the catalyst bed.

  15. Market Transformation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Market Transformation Market Transformation Significant research and development progress has paved the way for fuel cells to enter today's commercial marketplace for a variety of applications, including specialty vehicles and stationary and portable power. The growing number of commercial products, in combination with the federal and state financial incentives available now, are instrumental in supporting the role that fuel cells play in our nation's energy portfolio. Through its market

  16. Residential heating oil price

    U.S. Energy Information Administration (EIA) Indexed Site

    residential heating fuel survey by the U.S. Energy Information Administration. Heating oil prices in the New England region fell to 2.84 per gallon, down 5.4 cents from last week

  17. Low Temperature Heat Release Behavior of Conventional and Alternative...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Low Temperature Heat Release Behavior of Conventional and Alternative Fuels in a Motored Engine Low Temperature Heat Release Behavior of Conventional and Alternative Fuels in a ...

  18. FUEL ROD CLUSTERS

    DOE Patents [OSTI]

    Schultz, A.B.

    1959-08-01

    A cluster of nuclear fuel rods and a tubular casing therefor through which a coolant flows in heat-exchange contact with the fuel rods is described. The fuel rcds are held in the casing by virtue of the compressive force exerted between longitudinal ribs of the fuel rcds and internal ribs of the casing or the internal surfaces thereof.

  19. Market Implications of Synergism Between Low Drag Area and Electric...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Implications of Synergism Between Low Drag Area and Electric Drive Fuel Savings Market Implications of Synergism Between Low Drag Area and Electric Drive Fuel Savings Presented at ...

  20. fuels | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liquid Fuels Gasoline & Diesel Volatile fuel costs and a desire for energy independence have revived interest in another market for coal gasification technology: the production of liquid transportation fuels, chiefly gasoline and diesel fuel. For the United States, routes to synthesis of liquid fuels from coal add substantial diversity in fuel supply capability, a large capacity for fuels production considering the great extent of domestic coal reserves, and increased energy security that

  1. Potential Applications for Nuclear Energy besides Electricity Generation: AREVA Global Perspective of HTR Potential Market

    SciTech Connect (OSTI)

    Soutworth, Finis; Gauthier, Jean-Claude; Lecomte, Michel; Carre, Franck

    2007-07-01

    Energy supply is increasingly showing up as a major issue for electricity supply, transportation, settlement, and process heat industrial supply including hydrogen production. Nuclear power is part of the solution. For electricity supply, as exemplified in Finland and France, the EPR brings an immediate answer; HTR could bring another solution in some specific cases. For other supply, mostly heat, the HTR brings a solution inaccessible to conventional nuclear power plants for very high or even high temperature. As fossil fuels costs increase and efforts to avoid generation of Greenhouse gases are implemented, a market for nuclear generated process heat will develop. Following active developments in the 80's, HTR have been put on the back burner up to 5 years ago. Light water reactors are widely dominating the nuclear production field today. However, interest in the HTR technology was renewed in the past few years. Several commercial projects are actively promoted, most of them aiming at electricity production. ANTARES is today AREVA's response to the cogeneration market. It distinguishes itself from other concepts with its indirect cycle design powering a combined cycle power plant. Several reasons support this design choice, one of the most important of which is the design flexibility to adapt readily to combined heat and power applications. From the start, AREVA made the choice of such flexibility with the belief that the HTR market is not so much in competition with LWR in the sole electricity market but in the specific added value market of cogeneration and process heat. In view of the volatility of the costs of fossil fuels, AREVA's choice brings to the large industrial heat applications the fuel cost predictability of nuclear fuel with the efficiency of a high temperature heat source free of greenhouse gases emissions. The ANTARES module produces 600 MWth which can be split into the required process heat, the remaining power drives an adapted prorated electric plant. Depending on the process heat temperature and power needs, up to 80 % of the nuclear heat is converted into useful power. An important feature of the design is the standardization of the heat source, as independent as possible of the process heat application. This should expedite licensing. The essential conditions for success include: 1. Timely adapted licensing process and regulations, codes and standards for such application and design; 2. An industry oriented R and D program to meet the technological challenges making the best use of the international collaboration. Gen IV could be the vector; 3. Identification of an end user (or a consortium of) willing to fund a FOAK. (authors)

  2. Optimal design and control strategies for novel combined heat and power (CHP) fuel cell systems. Part I of II, datum design conditions and approach.

    SciTech Connect (OSTI)

    Colella, Whitney G.

    2010-06-01

    Energy network optimization (ENO) models identify new strategies for designing, installing, and controlling stationary combined heat and power (CHP) fuel cell systems (FCSs) with the goals of (1) minimizing electricity and heating costs for building owners and (2) reducing emissions of the primary greenhouse gas (GHG) - carbon dioxide (CO{sub 2}). A goal of this work is to employ relatively inexpensive simulation studies to discover more financially and environmentally effective approaches for installing CHP FCSs. ENO models quantify the impact of different choices made by power generation operators, FCS manufacturers, building owners, and governments with respect to two primary goals - energy cost savings for building owners and CO{sub 2} emission reductions. These types of models are crucial for identifying cost and CO{sub 2} optima for particular installations. Optimal strategies change with varying economic and environmental conditions, FCS performance, the characteristics of building demand for electricity and heat, and many other factors. ENO models evaluate both 'business-as-usual' and novel FCS operating strategies. For the scenarios examined here, relative to a base case of no FCSs installed, model results indicate that novel strategies could reduce building energy costs by 25% and CO{sub 2} emissions by 80%. Part I of II articles discusses model assumptions and methodology. Part II of II articles illustrates model results for a university campus town and generalizes these results for diverse communities.

  3. 1985 fuel supply seminar: proceedings

    SciTech Connect (OSTI)

    Prast, W.G.

    1986-09-01

    The major topics were utility fuel demand uncertainty (featuring uncertainty in electricity demand growth prospects), fuel forecasts and assumptions, residual fuel oil and natural gas markets, coal in environmental planning, coal market conditions and implications for procurement, and Canadian energy purchases. Individual papers are processed separately for the data bases. (PSB)

  4. Fuel oil and kerosene sales 1994

    SciTech Connect (OSTI)

    1995-09-27

    This publication contains the 1994 survey results of the ``Annual Fuel Oil and Kerosene Sales Report`` (Form EIA-821). This is the sixth year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA)for reference year 1988 and the Petroleum Marketing Monthly (PMM) for reference years 1984 through 1987. The 1994 edition marks the 11th annual presentation of the results of the ongoing ``Annual Fuel Oil and Kerosene Sales Report`` survey. Distillate and residual fuel oil sales continued to move in opposite directions during 1994. Distillate sales rose for the third year in a row, due to a growing economy. Residual fuel oil sales, on the other hand, declined for the sixth year in a row, due to competitive natural gas prices, and a warmer heating season than in 1993. Distillate fuel oil sales increased 4.4 percent while residual fuel oil sales declined 1.6 percent. Kerosene sales decreased 1.4 percent in 1994.

  5. Assessment of the Current Level of Automation in the Manufacture of Fuel Cell Systems for Combined Heat and Power Applications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Silica Aerogel (Technical Report) | SciTech Connect Assessment of Methods to Consolidate Iodine-Loaded Silver-Functionalized Silica Aerogel Citation Details In-Document Search Title: Assessment of Methods to Consolidate Iodine-Loaded Silver-Functionalized Silica Aerogel The U.S. Department of Energy is currently investigating alternative sorbents for the removal and immobilization of radioiodine from the gas streams in a nuclear fuel reprocessing plant. One of these new sorbents,

  6. Table 46. Refiner No. 2 Distillate, Diesel Fuel, and Fuel Oil...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Petroleum Marketing Annual 1999 295 Table 46. Refiner No. 2 Distillate, Diesel Fuel, and Fuel Oil Volumes by PAD District and State (Thousand Gallons per Day) - Continued...

  7. Technical Information Exchange on Pyrolysis Oil: Potential for a Renewab;e Heating Oil Substation Fuel in New England

    Broader source: Energy.gov [DOE]

    This report summarizes the results of an information exchange sponsored by the DOE/EERE Bioenergy Technologies Office in Manchester, New Hampshire, on May 9-10, 2012. The participand identifies top challenges regarding feedstocks and production, logistics and compatibility, and operational issues, then prioritized next steps for expanding use of pyrolysis oil as a replacement for home heating oil in the Northeast

  8. Michigan residential No. 2 fuel oil and propane price survey for the 1990/91 heating season. Final report

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    This report summarizes the results of a survey of home heating oil and propane prices over the 1990/1991 heating season in Michigan. The survey was conducted under a cooperative agreement between the State of Michigan, Michigan Public Service Commission and the US Department of Energy (DOE), Energy Information Administration (EIA), and was funded by a grant from EIA. From October 1990 through May 1991, participating dealers/distributions were called and asked for their current residential retail prices of No. 2 home heating oil and propane. This information was then transmitted to the EIA, bi-monthly using an electronic reporting system called Petroleum Data Reporting Option (PEDRO). The survey was conducted using a sample provided by EIA of home heating oil and propane retailers which supply Michigan households. These retailers were contacted the first and third Mondays of each month. The sample was designed to account for distributors with different sales volumes, geographic distributions and sources of primary supply. It should be noted that this simple is different from the sample used in prior year surveys.

  9. Michigan residential No. 2 fuel oil and propane price survey for the 1990/91 heating season

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    This report summarizes the results of a survey of home heating oil and propane prices over the 1990/1991 heating season in Michigan. The survey was conducted under a cooperative agreement between the State of Michigan, Michigan Public Service Commission and the US Department of Energy (DOE), Energy Information Administration (EIA), and was funded by a grant from EIA. From October 1990 through May 1991, participating dealers/distributions were called and asked for their current residential retail prices of No. 2 home heating oil and propane. This information was then transmitted to the EIA, bi-monthly using an electronic reporting system called Petroleum Data Reporting Option (PEDRO). The survey was conducted using a sample provided by EIA of home heating oil and propane retailers which supply Michigan households. These retailers were contacted the first and third Mondays of each month. The sample was designed to account for distributors with different sales volumes, geographic distributions and sources of primary supply. It should be noted that this simple is different from the sample used in prior year surveys.

  10. SOLAR HEATING OF TANK BOTTOMS Application of Solar Heating to Asphaltic and Parrafinic Oils Reducing Fuel Costs and Greenhouse Gases Due to Use of Natural Gas and Propane

    SciTech Connect (OSTI)

    Eugene A. Fritzler

    2005-09-01

    The sale of crude oil requires that the crude meet product specifications for BS&W, temperature, pour point and API gravity. The physical characteristics of the crude such as pour point and viscosity effect the efficient loading, transport, and unloading of the crude oil. In many cases, the crude oil has either a very high paraffin content or asphalt content which will require either hot oiling or the addition of diluents to the crude oil to reduce the viscosity and the pour point of the oil allowing the crude oil to be readily loaded on to the transport. Marginal wells are significantly impacted by the cost of preheating the oil to an appropriate temperature to allow for ease of transport. Highly paraffinic and asphaltic oils exist throughout the D-J basin and generally require pretreatment during cold months prior to sales. The current study addresses the use of solar energy to heat tank bottoms and improves the overall efficiency and operational reliability of stripper wells.

  11. Fuel Cell Systems for Portable, Backup, and UPS Applications | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy for Portable, Backup, and UPS Applications Fuel Cell Systems for Portable, Backup, and UPS Applications This presentation by Eric Simkins of the U.S. Fuel Cell Council was given at the Fuel Cell Meeting in April 2007. PDF icon fuel_cell_mtng_simpkins.pdf More Documents & Publications 2008 Fuel Cell Technologies Market Report 2008 Fuel Cell Technologies Market Report 2010 Fuel Cell Technologies Market Report

  12. Table 8.6a Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Total (All Sectors), 1989-2011 (Sum of Tables 8.6b and 8.6c)

    U.S. Energy Information Administration (EIA) Indexed Site

    a Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Total (All Sectors), 1989-2011 (Sum of Tables 8.6b and 8.6c) Year Coal 1 Petroleum Natural Gas 6 Other Gases 7 Biomass Other 10 Distillate Fuel Oil 2 Residual Fuel Oil 3 Other Liquids 4 Petroleum Coke 5 Total 5 Wood 8 Waste 9 Short Tons Barrels Short Tons Barrels Thousand Cubic Feet Billion Btu Billion Btu Billion Btu 1989 16,509,639 1,410,151 16,356,550 353,000 247,409 19,356,746

  13. Table 8.6b Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Electric Power Sector, 1989-2011 (Subset of Table 8.6a)

    U.S. Energy Information Administration (EIA) Indexed Site

    b Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Electric Power Sector, 1989-2011 (Subset of Table 8.6a) Year Coal 1 Petroleum Natural Gas 6 Other Gases 7 Biomass Other 10 Distillate Fuel Oil 2 Residual Fuel Oil 3 Other Liquids 4 Petroleum Coke 5 Total 5 Wood 8 Waste 9 Short Tons Barrels Short Tons Barrels Thousand Cubic Feet Billion Btu Billion Btu Billion Btu 1989 638,798 119,640 1,471,031 762 – 1,591,433 81,669,945 2,804 24,182 5,687

  14. Table 8.6c Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Commercial and Industrial Sectors, 1989-2011 (Subset of Table 8.6a)

    U.S. Energy Information Administration (EIA) Indexed Site

    c Estimated Consumption of Combustible Fuels for Useful Thermal Output at Combined-Heat-and-Power Plants: Commercial and Industrial Sectors, 1989-2011 (Subset of Table 8.6a) Year Coal 1 Petroleum Natural Gas 6 Other Gases 7 Biomass Other 10 Distillate Fuel Oil 2 Residual Fuel Oil 3 Other Liquids 4 Petroleum Coke 5 Total 5 Wood 8 Waste 9 Short Tons Barrels Short Tons Barrels Thousand Cubic Feet Billion Btu Billion Btu Billion Btu Commercial Sector 11<//td> 1989 711,212 202,091 600,653 – –

  15. Northeastern Summer Electricity Market Alert

    Reports and Publications (EIA)

    2013-01-01

    The National Weather Service declared an excessive-heat warning for much of the Mid-Atlantic and northeastern United States, including major electric markets covering Philadelphia, Boston, Washington, D.C., and New York City. This report highlights the wholesale electricity market activity occurring in response to the higher-than-normal electricity demand caused by the heat wave.

  16. Check Heat Transfer Surfaces | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Transfer Surfaces Check Heat Transfer Surfaces This tip sheet discusses the importance of checking heat transfer surfaces in process heating systems. PROCESS HEAT TIP SHEET #4 PDF icon Check Heat Transfer Surfaces (September 2005) More Documents & Publications Improving Process Heating System Performance: A Sourcebook for Industry, Second Edition Check Burner Air to Fuel Ratios Process Heating Assessment and Survey Tool (PHAST) Introduction

  17. Replace Fossil Fuels, Final Technical Report Roberts, William...

    Office of Scientific and Technical Information (OSTI)

    Crude Glycerol as Cost-Effective Fuel for Combined Heat and Power to Replace Fossil Fuels, Final Technical Report Roberts, William L 09 BIOMASS FUELS biofuels, glycerin, glycerol,...

  18. Underground Storage Tanks: New Fuels and Compatibility

    Broader source: Energy.gov [DOE]

    Breakout Session 1C—Fostering Technology Adoption I: Building the Market for Renewables with High Octane Fuels Underground Storage Tanks: New Fuels and Compatibility Ryan Haerer, Program Analyst, Alternative Fuels, Office of Underground Storage Tanks, Environmental Protection Agency

  19. Proceedings of the 1998 oil heat technology conference

    SciTech Connect (OSTI)

    McDonald, R.J.

    1998-04-01

    The 1998 Oil Heat Technology Conference was held on April 7--8 at Brookhaven National Laboratory (BNL) under sponsorship by the US Department of Energy, Office of Building Technologies, State and Community Programs (DOE/BTS). The meeting was held in cooperation with the Petroleum Marketers Association of America (PMAA). Fourteen technical presentations was made during the two-day program, all related to oil-heat technology and equipment, these will cover a range of research, developmental, and demonstration activities being conducted within the United States and Canada, including: integrated oil heat appliance system development in Canada; a miniature heat-actuated air conditioner for distributed space conditioning; high-flow fan atomized oil burner (HFAB) development; progress in the development of self tuning oil burners; application of HFAB technology to the development of a 500 watt; thermophotovoltaic (TPV) power system; field tests of the Heat Wise Pioneer oil burner and Insight Technologies AFQI; expanded use of residential oil burners to reduce ambient ozone and particulate levels by conversion of electric heated homes to oilheat; PMAA`s Oil Heat Technician`s Manual (third edition); direct venting concept development; evolution of the chimney; combating fuel related problems; the effects of red dye and metal contamination on fuel oil stability; new standard for above ground and basement residential fuel oil storage; plastic and steel composite secondary contained tanks; and money left on the table: an economic analysis of tank cleaning.

  20. Carbonate fuel cell system with thermally integrated gasification

    DOE Patents [OSTI]

    Steinfeld, George; Meyers, Steven J.; Lee, Arthur

    1996-01-01

    A fuel cell system employing a gasifier for generating fuel gas for the fuel cell of the fuel cell system and in which heat for the gasifier is derived from the anode exhaust gas of the fuel cell.

  1. Treatment of Fuel Process Wastewater Using Fuel Cells - Energy Innovation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Portal Hydrogen and Fuel Cell Hydrogen and Fuel Cell Find More Like This Return to Search Treatment of Fuel Process Wastewater Using Fuel Cells Oak Ridge National Laboratory Contact ORNL About This Technology Technology Marketing SummaryORNL researchers invented a method using microbial fuel cells for cleansing fuel processing water of hydrocarbon by-products and metal salts. This cost efficient method can be used on-site, so that water does not need to be transported to a treatment

  2. Qualification of Alternative Fuels

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Qualification of Alternative Fuels May 8, 2012 Pyrolysis Oil Workshop Thomas Butcher Sustainable Energy Technologies Department Applications Baseline - Residential and Light Commercial Pressure-atomized burners with 100-150 psi fuel pressure, no fuel heating; Cyclic operation - to 12,000 cycles per year; Fuel filtration to 90 microns or finer; Storage for periods of 1 year, possibly longer; Storage temperature varied; Visible range flame detection for safety; Nitrile seal materials common; Fuels

  3. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Alternative Fuel and Special Fuel Definitions The definition of alternative fuel includes liquefied petroleum gas (propane). Special fuel is defined as all combustible gases and liquids that are suitable for powering an internal combustion engine or motor or are used exclusively for heating, industrial, or farm purposes. Special fuels include biodiesel, blended biodiesel, and natural gas products, including liquefied and compressed natural gas. (Reference Indiana Code 6-6-2.5-1 and 6-6-2.5-22

  4. Energy System and Thermoeconomic Analysis of Combined Heat and Power High Temperature Proton Exchange Membrane Fuel Cell Systems for Light Commercial Buildings

    SciTech Connect (OSTI)

    Colella, Whitney G.; Pilli, Siva Prasad

    2015-06-01

    The United States (U.S.) Department of Energy (DOE)s Pacific Northwest National Laboratory (PNNL) is spearheading a program with industry to deploy and independently monitor five kilowatt-electric (kWe) combined heat and power (CHP) fuel cell systems (FCSs) in light commercial buildings. This publication discusses results from PNNLs research efforts to independently evaluate manufacturer-stated engineering, economic, and environmental performance of these CHP FCSs at installation sites. The analysis was done by developing parameters for economic comparison of CHP installations. Key thermodynamic terms are first defined, followed by an economic analysis using both a standard accounting approach and a management accounting approach. Key economic and environmental performance parameters are evaluated, including (1) the average per unit cost of the CHP FCSs per unit of power, (2) the average per unit cost of the CHP FCSs per unit of energy, (3) the change in greenhouse gas (GHG) and air pollution emissions with a switch from conventional power plants and furnaces to CHP FCSs; (4) the change in GHG mitigation costs from the switch; and (5) the change in human health costs related to air pollution. From the power perspective, the average per unit cost per unit of electrical power is estimated to span a range from $1519,000/ kilowatt-electric (kWe) (depending on site-specific changes in installation, fuel, and other costs), while the average per unit cost of electrical and heat recovery power varies between $7,000 and $9,000/kW. From the energy perspective, the average per unit cost per unit of electrical energy ranges from $0.38 to $0.46/kilowatt-hour-electric (kWhe), while the average per unit cost per unit of electrical and heat recovery energy varies from $0.18 to $0.23/kWh. These values are calculated from engineering and economic performance data provided by the manufacturer (not independently measured data). The GHG emissions were estimated to decrease by one-third by shifting from a conventional energy system to a CHP FCS system. The GHG mitigation costs were also proportional to the changes in the GHG gas emissions. Human health costs were estimated to decrease significantly with a switch from a conventional system to a CHP FCS system.

  5. Thulium-170 heat source

    DOE Patents [OSTI]

    Walter, Carl E.; Van Konynenburg, Richard; VanSant, James H.

    1992-01-01

    An isotopic heat source is formed using stacks of thin individual layers of a refractory isotopic fuel, preferably thulium oxide, alternating with layers of a low atomic weight diluent, preferably graphite. The graphite serves several functions: to act as a moderator during neutron irradiation, to minimize bremsstrahlung radiation, and to facilitate heat transfer. The fuel stacks are inserted into a heat block, which is encased in a sealed, insulated and shielded structural container. Heat pipes are inserted in the heat block and contain a working fluid. The heat pipe working fluid transfers heat from the heat block to a heat exchanger for power conversion. Single phase gas pressure controls the flow of the working fluid for maximum heat exchange and to provide passive cooling.

  6. Highlights from U.S. Department of Energy's Fuel Cell Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Market Change and Effects of the Recovery Act Fuel Cell Program DOE Hydrogen and Fuel Cells Program Record, Record 13008: Industry Deployed Fuel Cell Powered Lift Trucks...

  7. List of Geothermal Heat Pumps Incentives | Open Energy Information

    Open Energy Info (EERE)

    using Renewable Fuels Geothermal Electric Ground Source Heat Pumps Hydroelectric energy Hydrogen Landfill Gas Methanol Passive Solar Space Heat Photovoltaics Solar Space Heat...

  8. State heating oil and propane program. Final report, 1996--1997

    SciTech Connect (OSTI)

    Hunton, G.

    1997-08-01

    The following is a summary report of the New Hampshire Governor`s Office of Energy and Community Services (ECS) participation in the State Heating Oil and Propane Program (SHOPP) for the 1996-97 heating season. SHOPP is a cooperative effort, linking energy offices in East Coast and Midwest states, with the Department of Energy (DOE), Energy Information Administration (EIA) for the purpose of collecting retail price data for heating oil and propane. The program funded by the participating state with a matching grant from DOE. SHOPP was initiated in response to congressional inquires into supply difficulties and price spikes of heating oil and propane associated with the winter of 1989/90. This is important to New Hampshire because heating oil controls over 55% of the residential heating market statewide. Propane controls 10% of the heating market statewide and is widely used in rural areas where Natural GAs is not available. Lower installation cost, convenience, lower operating costs compared to electricity and its perception as a clean heating fuel has increased the popularity of propane in New Hampshire and should continue to do so in the future. Any disruption in supply of these heating fuels to New Hampshire could cause prices to skyrocket and leave many residents in the cold.

  9. Bayonet heat exchangers in heat-assisted Stirling heat pump

    SciTech Connect (OSTI)

    Yagyu, S.; Fukuyama, Y.; Morikawa, T.; Isshiki, N.; Satoh, I.; Corey, J.; Fellows, C.

    1998-07-01

    The Multi-Temperature Heat Supply System is a research project creating a city energy system with lower environmental load. This system consists of a gas-fueled internal combustion engine and a heat-assisted Stirling heat pump utilizing shaft power and thermal power in a combination of several cylinders. The heat pump is mainly driven by engine shaft power and is partially assisted by thermal power from engine exhaust heat source. Since this heat pump is operated by proportioning the two energy sources to match the characteristics of the driving engine, the system is expected to produce cooling and heating water at high COP. This paper describes heat exchanger development in the project to develop a heat-assisted Stirling heat pump. The heat pump employs the Bayonet type heat exchangers (BHX Type I) for supplying cold and hot water and (BHX Type II) for absorbing exhaust heat from the driving engine. The heat exchanger design concepts are presented and their heat transfer and flow loss characteristics in oscillating gas flow are investigated. The main concern in the BHX Type I is an improvement of gas side heat transfer and the spirally finned tubes were applied to gas side of the heat exchanger. For the BHX Type II, internal heat transfer characteristics are the main concern. Shell-and-tube type heat exchangers are widely used in Stirling machines. However, since brazing is applied to the many tubes for their manufacturing processes, it is very difficult to change flow passages to optimize heat transfer and loss characteristics once they have been made. The challenge was to enhance heat transfer on the gas side to make a highly efficient heat exchanger with fewer parts. It is shown that the Bayonet type heat exchanger can have good performance comparable to conventional heat exchangers.

  10. Fuel Cell Animation- Chemical Process (Text Version)

    Broader source: Energy.gov [DOE]

    This text version of the fuel cell animation demonstrates how a fuel cell uses hydrogen to produce electricity, with only water and heat as byproducts.

  11. Forever Fuels Ltd | Open Energy Information

    Open Energy Info (EERE)

    Forever Fuels Ltd Place: Maidenhead, United Kingdom Zip: SL6 8RT Product: Forever Fuels specialises in the distribution and supply of wood pellets for sustainable heating systems....

  12. Process Heating Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Locate a Qualified Specialist in your area who can help optimize plant efficiency. Process Heating Tip Sheets Check Burner Air to Fuel Ratios Check Heat Transfer Surfaces Furnace ...

  13. Electric Resistance Heating | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    about 30% of the fuel's energy into electricity. Because of electricity generation and transmission losses, electric heat is often more expensive than heat produced in homes or...

  14. Manufacturing Readiness Assessment for Fuel Cell Stacks and Systems for the Back-up Power and Material Handling Equipment Emerging Markets (Revised)

    SciTech Connect (OSTI)

    Wheeler, D.; Ulsh, M.

    2010-02-01

    This report details NREL's activity to address the need to understand the current status and associated risk levels of the polymer electrolyte membrane (PEM) fuel cell industry.

  15. STEO October 2012 - home heating use

    U.S. Energy Information Administration (EIA) Indexed Site

    most common primary heating fuel, is expected to be up 14 percent this winter, according to the U.S. Energy Information ... While prices for the major heating fuels will be mostly flat ...

  16. HEAT TRANSFER MEANS

    DOE Patents [OSTI]

    Fraas, A.P.; Wislicenus, G.F.

    1961-07-11

    A heat exchanger is adapted to unifomly cool a spherical surface. Equations for the design of a spherical heat exchanger hav~g tubes with a uniform center-to-center spining are given. The heat exchanger is illustrated in connection with a liquid-fueled reactor.

  17. Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Marketing Annual 1998 Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane, and Residual Fuel Oil by PAD District and State (Thousand Gallons per Day) -...

  18. Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane...

    U.S. Energy Information Administration (EIA) Indexed Site

    Marketing Annual 1995 Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane, and Residual Fuel Oil by PAD District and State (Thousand Gallons per Day) -...

  19. Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane...

    Gasoline and Diesel Fuel Update (EIA)

    Marketing Annual 1999 Table 49. Prime Supplier Sales Volumes of Aviation Fuels, Propane, and Residual Fuel Oil by PAD District and State (Thousand Gallons per Day) -...

  20. Alternative Fuels Used in Transportation: Science Projects in...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    are making their ways to the market. These alternative fuels include such things as propane, natural gas, electric hybrids, hydrogen fuel cells, and biodiesel. Students will...

  1. Alternative Fuels Used in Transportation (5 Activities)

    K-12 Energy Lesson Plans and Activities Web site (EERE)

    Gasoline is the most commonly used fuel for transportation; however, there are multiple alternative fuels that are making their way to the market. These alternative fuels include propane, natural gas, electric hybrids, hydrogen fuel cells, and bio-diesel. Students will probably have heard of some of these alternative fuels, but they may not understand how and why they are better then ordinary gasoline.

  2. Alternative Fuels Data Center: Maps and Data

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Clean Cities All Categories Fuels & Infrastructure Fuel Trends Emissions Alternative Fueling Stations Idle Reduction Transportation Infrastructure Biofuels Production Clean Cities Petroleum Use Reduction Vehicles Program Vehicles AFVs and HEVs Fuel Consumption and Efficiency Vehicle Market Driving Patterns Laws & Incentives Regulated Fleets State & Alt Fuel Providers Federal Fleets OR Go Sort by: Category Most Recent Most Popular 9 results Petroleum Use Reduction -

  3. Alternative Fuels Data Center: Maps and Data

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Petroleum Use Reduction All Categories Fuels & Infrastructure Fuel Trends Emissions Alternative Fueling Stations Idle Reduction Transportation Infrastructure Biofuels Production Clean Cities Petroleum Use Reduction Vehicles Program Vehicles AFVs and HEVs Fuel Consumption and Efficiency Vehicle Market Driving Patterns Laws & Incentives Regulated Fleets State & Alt Fuel Providers Federal Fleets OR Go Sort by: Category Most Recent Most Popular 5 results

  4. NREL: Hydrogen and Fuel Cells Research - Hydrogen Fueling Infrastructure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Analysis Fueling Infrastructure Analysis As the market grows for hydrogen fuel cell electric vehicles, so does the need for a comprehensive hydrogen fueling infrastructure. NREL's technology validation team is analyzing the availability and performance of existing hydrogen fueling stations, benchmarking the current status, and providing feedback related to capacity, utilization, station build time, maintenance, fueling, and geographic coverage. Overview Composite Data Products Publications

  5. Major Fuels","Electricity","Natural Gas","Fuel Oil","District...

    U.S. Energy Information Administration (EIA) Indexed Site

    (million square feet)","Total of Major Fuels","Electricity","Natural Gas","Fuel Oil","District Heat" "All Buildings ...",4657,67338,81552,66424,10...

  6. Major Fuels","Electricity",,"Natural Gas","Fuel Oil","District

    U.S. Energy Information Administration (EIA) Indexed Site

    of Buildings (thousand)","Floorspace (million square feet)","Sum of Major Fuels","Electricity",,"Natural Gas","Fuel Oil","District Heat" ,,,,"Primary","Site" "All Buildings...

  7. Biomass Derivatives Competitive with Heating Oil Costs.

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biomass Derivatives Competitive with Heating Oil Costs Transportation fuel Heat or electricity * Data are from literature, except heating oil is adjusted from 2011 winter average * Fuel costs vary widely based on feedstock, location, and technology option * Retail pellet costs are based on current prices in NE (~$243/ton) * Densifying biomass for heating (e.g. pyrolysis oil or pellets) can be a cost- competitive feedstock for residential heating system * These are not "drop-in" fuels

  8. Fuel flexible fuel injector

    DOE Patents [OSTI]

    Tuthill, Richard S; Davis, Dustin W; Dai, Zhongtao

    2015-02-03

    A disclosed fuel injector provides mixing of fuel with airflow by surrounding a swirled fuel flow with first and second swirled airflows that ensures mixing prior to or upon entering the combustion chamber. Fuel tubes produce a central fuel flow along with a central airflow through a plurality of openings to generate the high velocity fuel/air mixture along the axis of the fuel injector in addition to the swirled fuel/air mixture.

  9. Miniature ceramic fuel cell

    DOE Patents [OSTI]

    Lessing, Paul A.; Zuppero, Anthony C.

    1997-06-24

    A miniature power source assembly capable of providing portable electricity is provided. A preferred embodiment of the power source assembly employing a fuel tank, fuel pump and control, air pump, heat management system, power chamber, power conditioning and power storage. The power chamber utilizes a ceramic fuel cell to produce the electricity. Incoming hydro carbon fuel is automatically reformed within the power chamber. Electrochemical combustion of hydrogen then produces electricity.

  10. FUEL ROD ASSEMBLY

    DOE Patents [OSTI]

    Hutter, E.

    1959-09-01

    A cluster of nuclear fuel rods aod a tubular casing through which a coolant flows in heat-change contact with the ruel rods are described. The casting is of trefoil section and carries the fuel rods, each of which has two fin engaging the serrated fins of the other two fuel rods, whereby the fuel rods are held in the casing and are interlocked against relative longitudinal movement.

  11. Guide to Geothermal Heat Pumps

    SciTech Connect (OSTI)

    2011-02-01

    Geothermal heat pumps, also known as ground source heat pumps, geoexchange, water-source, earth-coupled, and earth energy heat pumps, take advantage of this resource and represent one of the most efficient and durable options on the market to heat and cool your home.

  12. Proposed premium diesel fuel spec elicits calls for tougher, better defined parameters

    SciTech Connect (OSTI)

    Peckham, J.

    1998-01-01

    The debate over the definition of premium diesel fuel - what it is and what it should be - is heating up in industry circles. A number of automotive associations, additive makers and standards-setting organizations have jumped into the fray, and the fight is likely to turn volcanic when it comes down to deciding exactly what will constitute a premium diesel and how its properties will be measured. This story details some recent developments in and responses to the ongoing conflict. The Engine Manufacturers Association (EMA), representing 33 international diesel engine makers, recently launched a survey of U.S. diesel fuel marketers to see which ones will offer a fuel meeting EMA`s revised {open_quotes}FQP-1A{close_quotes} premium diesel fuel recommendations. Following the survey, EMA intends to publicize which companies offer such a fuel. The EMA premium fuel specifications are much tougher than the US standard ASTM D 975 fuel and tougher than the newly proposed {open_quotes}premium{close_quotes} diesel fuel from the National Conference of Weights & Measures (NCWM) task force. Earlier this year, Amoco became the first (and so far only) US refiner to offer a fuel meeting all the FQP specifications, but only in certain Midwest markets.

  13. Coal Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    Coal Markets | Archive Coal Markets Weekly production Dollars per short ton Dollars per mmbtu Average weekly coal commodity spot prices dollars per short ton Week ending Week ago ...

  14. Marketing Resources

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Expand Utility Resources News & Events Expand News & Events Skip navigation links Marketing Resources Marketing Portal Reports, Publications, and Research Utility Toolkit...

  15. Residential heating oil prices increase

    U.S. Energy Information Administration (EIA) Indexed Site

    That's down 2.6 cents from a year ago, based on the residential heating fuel survey by the U.S. Energy Information Administration. The price for heating oil in the New England ...

  16. Residential heating oil prices available

    U.S. Energy Information Administration (EIA) Indexed Site

    That's down 32.7 cents from a year ago, based on the U.S. Energy Information Administration's weekly residential heating fuel price survey. Heating oil prices in the New England ...

  17. Residential heating oil prices decline

    U.S. Energy Information Administration (EIA) Indexed Site

    That's down 4.5 cents from a week ago, based on the residential heating fuel survey by the U.S. Energy Information Administration. Heating oil prices in the New England region are ...

  18. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Clean Energy Advisory Commission The South Carolina Clean Energy Industry Manufacturing Market Development Advisory Commission (Commission) will assist with the development of clean energy technologies, materials, and products, including advanced vehicle, alternative transportation fuel, battery manufacturing, and hydrogen fuel cell industries. The Commission provided a preliminary report in 2014 with a description and analysis of the existing clean energy manufacturing industry, job development

  19. NREL: Transportation Research - Alternative Fuels Characterization

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alternative Fuels Characterization Find out about other biomass research projects at NREL. NREL alternative fuels projects help overcome technical barriers and expand markets for renewable, biodegradable vehicle fuels. These liquid fuels include higher-level ethanol blends, butanol, biodiesel, renewable diesel, other biomass-derived fuels, and natural gas. By studying the fuel chemistry as well as combustion and emissions impacts of alternative fuels, NREL helps improve engine efficiency, reduce

  20. Fuel Cells for Critical Communications Backup Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6, 2008 APCO Annual Conference and Expo 2 2 Fuel cells use hydrogen to create electricity, with only water and heat as byproducts Fuel Cell Overview * An individual fuel cell ...

  1. Fuel Cells and Renewable Portfolio Standards | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cells Technology Validation Manufacturing Safety, Codes & Standards Education Market Transformation Systems Analysis Information Resources Financial Opportunities News Events

  2. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    E85 Fueling Infrastructure Grants The Illinois Department of Commerce and Economic Opportunity's (Department) Renewable Fuels Development Program is partnered with the Illinois Corn Marketing Board to fund new E85 fueling infrastructure at retail gasoline stations. The American Lung Association of Illinois-Iowa administers grants of up to $15,000 for a blender pump installation, $10,000 for a new E85 dispenser installation, and $7,500 to convert existing stations to dispense E85. The maximum

  3. 2012 Vehicle Technologies Market Report

    SciTech Connect (OSTI)

    Davis, Stacy Cagle; Diegel, Susan W; Boundy, Robert Gary

    2013-03-01

    The Oak Ridge National Laboratory s Center for Transportation Analysis developed and published the first Vehicle Technologies Market Report in 2008. Three editions of the report have been published since that time. This 2012 report details the major trends in U.S. light vehicle and medium/heavy truck markets as well as the underlying trends that caused them. The opening section on Energy and Economics discusses the role of transportation energy and vehicle markets on a national scale. The following section examines light-duty vehicle use, markets, manufacture, and supply chains. The discussion of medium and heavy trucks offers information on truck sales and fuel use. The technology section offers information on alternative fuel vehicles and infrastructure, and the policy section concludes with information on recent, current, and near-future Federal policies like the Corporate Average Fuel Economy standards.

  4. Petroleum marketing annual 1994

    SciTech Connect (OSTI)

    1995-08-24

    The Petroleum Marketing Annual (PMA) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysis, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the fob and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Annual. For this production, all estimates have been recalculated since their earlier publication in the Petroleum Marketing Monthly (PMM). These calculations made use of additional data and corrections that were received after the PMM publication date.

  5. Sandia-Univ. of Rochester Win Funding to Demonstrate Fuel Magnetizatio...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia-Univ. of Rochester Win Funding to Demonstrate Fuel Magnetization and Laser Heating ... Sandia-Univ. of Rochester Win Funding to Demonstrate Fuel Magnetization and Laser Heating ...

  6. Active microchannel heat exchanger

    DOE Patents [OSTI]

    Tonkovich, Anna Lee Y. [Pasco, WA; Roberts, Gary L. [West Richland, WA; Call, Charles J. [Pasco, WA; Wegeng, Robert S. [Richland, WA; Wang, Yong [Richland, WA

    2001-01-01

    The present invention is an active microchannel heat exchanger with an active heat source and with microchannel architecture. The microchannel heat exchanger has (a) an exothermic reaction chamber; (b) an exhaust chamber; and (c) a heat exchanger chamber in thermal contact with the exhaust chamber, wherein (d) heat from the exothermic reaction chamber is convected by an exothermic reaction exhaust through the exhaust chamber and by conduction through a containment wall to the working fluid in the heat exchanger chamber thereby raising a temperature of the working fluid. The invention is particularly useful as a liquid fuel vaporizer and/or a steam generator for fuel cell power systems, and as a heat source for sustaining endothermic chemical reactions and initiating exothermic reactions.

  7. Fuel Cell Basics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewable Energy » Hydrogen & Fuel Cells » Fuel Cell Basics Fuel Cell Basics August 14, 2013 - 2:09pm Addthis Text Version Photo of two hydrogen fuel cells. Fuel cells can provide heat and electricity for buildings and electrical power for vehicles and electronic devices. HOW FUEL CELLS WORK Fuel cells work like batteries, but they do not run down or need recharging. They produce electricity and heat as long as fuel is supplied. A fuel cell consists of two electrodes-a negative electrode

  8. Fuel Cells & Alternative Fuels | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    This text version of the fuel cell animation demonstrates how a fuel cell uses hydrogen to produce electricity, with only water and heat as byproducts. Fuel cell shown with its inputs and outputs. Hydrogen input on left, oxygen input on right, water and heat outputs on the back, with an electrical circuit going around the top. A fuel cell is a device that uses hydrogen (or hydrogen-rich fuel) and oxygen to create electricity. Fuel cells are more energy-efficient than combustion engines and the

  9. Residential Wood Heating Fuel Exemption

    Broader source: Energy.gov [DOE]

    The New York Department of Taxation and Finance publishes a variety of sales tax reports detailing local tax rates and exemptions, including those for residential energy services. The residential...

  10. Natural gas marketing and transportation

    SciTech Connect (OSTI)

    Not Available

    1991-01-01

    This book covers: Overview of the natural gas industry; Federal regulation of marketing and transportation; State regulation of transportation; Fundamentals of gas marketing contracts; Gas marketing options and strategies; End user agreements; Transportation on interstate pipelines; Administration of natural gas contracts; Structuring transactions with the nonconventional source fuels credit; Take-or-pay wars- a cautionary analysis for the future; Antitrust pitfalls in the natural gas industry; Producer imbalances; Natural gas futures for the complete novice; State non-utility regulation of production, transportation and marketing; Natural gas processing agreements and Disproportionate sales, gas balancing, and accounting to royalty owners.

  11. Development of Fuel-Flexible Combustion Systems Utilizing Opportunity Fuels

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    in Gas Turbines - Fact Sheet, May 2014 | Department of Energy Fuel-Flexible Combustion Systems Utilizing Opportunity Fuels in Gas Turbines - Fact Sheet, May 2014 Development of Fuel-Flexible Combustion Systems Utilizing Opportunity Fuels in Gas Turbines - Fact Sheet, May 2014 GE Global Research developed and tested new fuel-flexible gas turbine nozzle technology concepts that will enable end users to efficiently generate power and heat from industrial off-gases and gasified industrial,

  12. A Total Cost of Ownership Model for Low Temperature PEM Fuel Cells in Combined Heat and Power and Backup Power Applications

    Broader source: Energy.gov [DOE]

    This report prepared by the Lawrence Berkeley National Laboratory describes a total cost of ownership model for emerging applications in stationary fuel cell systems.

  13. Petroleum marketing monthly

    SciTech Connect (OSTI)

    1995-11-01

    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data.

  14. INTEGRATED GASIFICATION COMBINED CYCLE PROJECT 2 MW FUEL CELL DEMONSTRATION

    SciTech Connect (OSTI)

    FuelCell Energy

    2005-05-16

    With about 50% of power generation in the United States derived from coal and projections indicating that coal will continue to be the primary fuel for power generation in the next two decades, the Department of Energy (DOE) Clean Coal Technology Demonstration Program (CCTDP) has been conducted since 1985 to develop innovative, environmentally friendly processes for the world energy market place. The 2 MW Fuel Cell Demonstration was part of the Kentucky Pioneer Energy (KPE) Integrated Gasification Combined Cycle (IGCC) project selected by DOE under Round Five of the Clean Coal Technology Demonstration Program. The participant in the CCTDP V Project was Kentucky Pioneer Energy for the IGCC plant. FuelCell Energy, Inc. (FCE), under subcontract to KPE, was responsible for the design, construction and operation of the 2 MW fuel cell power plant. Duke Fluor Daniel provided engineering design and procurement support for the balance-of-plant skids. Colt Engineering Corporation provided engineering design, fabrication and procurement of the syngas processing skids. Jacobs Applied Technology provided the fabrication of the fuel cell module vessels. Wabash River Energy Ltd (WREL) provided the test site. The 2 MW fuel cell power plant utilizes FuelCell Energy's Direct Fuel Cell (DFC) technology, which is based on the internally reforming carbonate fuel cell. This plant is capable of operating on coal-derived syngas as well as natural gas. Prior testing (1992) of a subscale 20 kW carbonate fuel cell stack at the Louisiana Gasification Technology Inc. (LGTI) site using the Dow/Destec gasification plant indicated that operation on coal derived gas provided normal performance and stable operation. Duke Fluor Daniel and FuelCell Energy developed a commercial plant design for the 2 MW fuel cell. The plant was designed to be modular, factory assembled and truck shippable to the site. Five balance-of-plant skids incorporating fuel processing, anode gas oxidation, heat recovery, water treatment/instrument air, and power conditioning/controls were built and shipped to the site. The two fuel cell modules, each rated at 1 MW on natural gas, were fabricated by FuelCell Energy in its Torrington, CT manufacturing facility. The fuel cell modules were conditioned and tested at FuelCell Energy in Danbury and shipped to the site. Installation of the power plant and connection to all required utilities and syngas was completed. Pre-operation checkout of the entire power plant was conducted and the plant was ready to operate in July 2004. However, fuel gas (natural gas or syngas) was not available at the WREL site due to technical difficulties with the gasifier and other issues. The fuel cell power plant was therefore not operated, and subsequently removed by October of 2005. The WREL fuel cell site was restored to the satisfaction of WREL. FuelCell Energy continues to market carbonate fuel cells for natural gas and digester gas applications. A fuel cell/turbine hybrid is being developed and tested that provides higher efficiency with potential to reach the DOE goal of 60% HHV on coal gas. A system study was conducted for a 40 MW direct fuel cell/turbine hybrid (DFC/T) with potential for future coal gas applications. In addition, FCE is developing Solid Oxide Fuel Cell (SOFC) power plants with Versa Power Systems (VPS) as part of the Solid State Energy Conversion Alliance (SECA) program and has an on-going program for co-production of hydrogen. Future development in these technologies can lead to future coal gas fuel cell applications.

  15. PROCEEDINGS OF THE 1998 OIL HEAT TECHNOLOGY CONFERENCE

    SciTech Connect (OSTI)

    MCDONALD,R.J.

    1998-04-01

    The 1998 Oil Heat Technology Conference will be held on April 7--8 at Brookhaven National Laboratory (BNL) under sponsorship by the US Department of Energy, Office of Building Technologies, State and Community Programs (DOE/BTS). The meeting will be held in cooperation with the Petroleum Marketers Association of America (PMAA). The 1998 Oil Heat Technology Conference, will be the twelfth since 1984, is an important technology transfer activity and is supported by the ongoing Combustion Equipment Technology (Oilheat R and D) program at BNL. The reason for the conference is to provide a forum for the exchange of information and perspectives among international researchers, engineers, manufacturers and marketers of oil-fired space-conditioning equipment. They will provide a channel by which information and ideas can be exchanged to examine present technologies, as well as helping to develop the future course for oil heating advancement. These conferences also serve as a stage for unifying government representatives, researchers, fuel oil marketers, and other members of the oil-heat industry in addressing technology advancements in this important energy use sector. The specific objectives of the Conference are to: (1) Identify and evaluate the current state-of-the-art and recommend new initiatives for higher efficiency, a cleaner environment, and to satisfy consumer needs cost-effectively, reliably, and safely; and (2) Foster cooperative interactions among federal and industrial representatives for the common goal of sustained economic growth and energy security via energy conservation.

  16. Fuel Cell and Battery Electric Vehicles Compared

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... EV 300 miles compared to a fuel cell EV traveling 300 miles In effect, the increased ... city cars for niche markets, the underlying benefits of the fuel cell have not changed. ...

  17. Solid Oxide Fuel Cells FAQs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FAQs faq-header-big.jpg SOLID OXIDE FUEL CELLS - BASICS Q: What is a fuel cell? A: A fuel cell is a power generation device that converts the chemical energy of a fuel and oxidant directly into electrical energy, with heat and water as byproducts. Since fuel cells produce electricity through an electrochemical reaction and not through a combustion process, they are inherently more efficient and environmentally friendly than conventional electric power generation processes. Q: What are the

  18. Market Transformation

    SciTech Connect (OSTI)

    Not Available

    2008-09-01

    Summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market transformation subprogram.

  19. Steam reforming of fuel to hydrogen in fuel cell

    DOE Patents [OSTI]

    Young, J.E.; Fraioli, A.V.

    1983-07-13

    A fuel cell is described capable of utilizing a hydrocarbon such as methane as fuel and having an internal dual catalyst system within the anode zone, the dual catalyst system including an anode catalyst supporting and in heat conducting relationship with a reforming catalyst with heat for the reforming reaction being supplied by the reaction at the anode catalyst.

  20. Steam reforming of fuel to hydrogen in fuel cells

    DOE Patents [OSTI]

    Fraioli, Anthony V.; Young, John E.

    1984-01-01

    A fuel cell capable of utilizing a hydrocarbon such as methane as fuel and having an internal dual catalyst system within the anode zone, the dual catalyst system including an anode catalyst supporting and in heat conducting relationship with a reforming catalyst with heat for the reforming reaction being supplied by the reaction at the anode catalyst.

  1. List of Renewable Fuels Incentives | Open Energy Information

    Open Energy Info (EERE)

    using Renewable Fuels Geothermal Electric Photovoltaics Renewable Fuels Solar Water Heat Natural Gas Hydroelectric energy Small Hydroelectric Yes Alternative Energy Personal...

  2. List of Renewable Transportation Fuels Incentives | Open Energy...

    Open Energy Info (EERE)

    Wind Biomass Renewable Transportation Fuels Fuel Cells Ground Source Heat Pumps Ethanol Methanol Biodiesel No Community Energy Project Grants (Michigan) State Grant Program...

  3. State of Maine residential heating oil survey 2001-02 season summary [SHOPP

    SciTech Connect (OSTI)

    Elder, Betsy

    2002-05-22

    This, as the title implies, is a summary report of the price trends for heating oil, propane and kerosene heating fuels for the heating season.

  4. Proceedings: 1987 fuel supply seminar

    SciTech Connect (OSTI)

    Prast, W.G.

    1988-08-01

    The seventh annual EPRI Fuel Supply Seminar was held in Baltimore, Maryland, from October 6 to 8, 1987. The major emphasis of the meeting was on identifying fuel market risks and planning concerns in order to cope with inherent uncertainties and make informed fuel supply decisions. Sessions dealt with the natural gas markets including the prospects for continued availability of gas as a boiler fuel, the relationship of gas and oil prices and the relevance of different regulatory issues. Other sessions addressed the political dimensions of world oil supply and the role of oil inventories in price dynamics, the interaction of world trade cycles, interest rates and currency fluctuations on utility fuel planning, and the role of strategic fuel planning in various utilities. The changing coal transportation market was the subject of several presentations, concluding with a review of utility experiences in integrating coal transportation and coal supply procurement. Presentations were made by various specialists including EPRI research contractors reporting on the results of ongoing research, speakers drawn from the utility, coal and natural gas industries, and independent consultants. The principal purpose of the seminar continues to be to provide utility fuel planners and fuel procurement managers with data and insights into the structure, operations and uncertainties of the fuel markets, thereby supporting their development of flexible fuel strategies and contributing to integrated utility decision making. Selected papers have been processed separately for inclusion in the energy data base.

  5. Petroleum marketing monthly

    SciTech Connect (OSTI)

    1996-02-01

    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  6. Petroleum marketing monthly

    SciTech Connect (OSTI)

    1996-07-01

    Petroleum Marketing Monthly (PPM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o. b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  7. Petroleum marketing monthly

    SciTech Connect (OSTI)

    1995-08-01

    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  8. Fuel Cells | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cells Fuel Cells A fuel cell uses the chemical energy of hydrogen or another fuel to cleanly and efficiently produce electricity. If hydrogen is the fuel, electricity, water, and heat are the only products. Fuel cells are unique in terms of the variety of their potential applications; they can provide power for systems as large as a utility power station and as small as a laptop computer. Why Study Fuel Cells Fuel cells can be used in a wide range of applications, including transportation,

  9. Process Heating Assessment and Survey Tool | Department of Energy

    Energy Savers [EERE]

    methods to improve thermal efficiency of heating equipment. This tool helps industrial users survey process heating equipment that consumes fuel, steam, or electricity,...

  10. Use Feedwater Economizers for Waste Heat Recovery, Energy Tips...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Use Feedwater Economizers for Waste Heat Recovery A feedwater economizer reduces steam boiler fuel requirements by transferring heat from the fue gas to incoming feedwater. Boiler ...

  11. Ultra Efficient Combined Heat, Hydrogen, and Power System - Presentati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ultra Efficient Combined Heat, Hydrogen, and Power System - Presentation by FuelCell Energy, June 2011 Ultra Efficient Combined Heat, Hydrogen, and Power System - Presentation by ...

  12. Thermoelectric Waste Heat Recovery Program for Passenger Vehicles...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Waste Heat Recovery Program for Passenger Vehicles Thermoelectric Waste Heat Recovery Program for Passenger Vehicles 2012 DOE Hydrogen and Fuel Cells Program and Vehicle ...

  13. Using Waste Heat for External Processes; Industrial Technologies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Using Waste Heat for External Processes The temperature of exhaust gases from fuel-fired industrial processes depends mainly on the process temperature and the waste heat recovery ...

  14. Waste to Energy Market | OpenEI Community

    Open Energy Info (EERE)

    to energy market is fueled by reduced GHG emission from landfills, rising concern towards energy security, growing regulatory support as well as incentives, and tax increment on...

  15. Waste to Energy: Escalating Energy Concerns to Push Global Market...

    Open Energy Info (EERE)

    to energy market is fueled by reduced GHG emission from landfills, rising concern towards energy security, growing regulatory support as well as incentives, and tax increment on...

  16. Impact of Hydrogen Production on U.S. Energy Markets

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    * Evaluate impacts on U.S. energy markets including price and consumption changes for coal, natural gas, ... * IEA cost data from "Prospects for Hydrogen and Fuel Cells" * ...

  17. Laser ablation based fuel ignition

    DOE Patents [OSTI]

    Early, James W.; Lester, Charles S.

    1998-01-01

    There is provided a method of fuel/oxidizer ignition comprising: (a) application of laser light to a material surface which is absorptive to the laser radiation; (b) heating of the material surface with the laser light to produce a high temperature ablation plume which emanates from the heated surface as an intensely hot cloud of vaporized surface material; and (c) contacting the fuel/oxidizer mixture with the hot ablation cloud at or near the surface of the material in order to heat the fuel to a temperature sufficient to initiate fuel ignition.

  18. Laser ablation based fuel ignition

    DOE Patents [OSTI]

    Early, J.W.; Lester, C.S.

    1998-06-23

    There is provided a method of fuel/oxidizer ignition comprising: (a) application of laser light to a material surface which is absorptive to the laser radiation; (b) heating of the material surface with the laser light to produce a high temperature ablation plume which emanates from the heated surface as an intensely hot cloud of vaporized surface material; and (c) contacting the fuel/oxidizer mixture with the hot ablation cloud at or near the surface of the material in order to heat the fuel to a temperature sufficient to initiate fuel ignition. 3 figs.

  19. Distributed generation hits market

    SciTech Connect (OSTI)

    1997-10-01

    The pace at which vendors are developing and marketing gas turbines and reciprocating engines for small-scale applications may signal the widespread growth of distributed generation. Loosely defined to refer to applications in which power generation equipment is located close to end users who have near-term power capacity needs, distributed generation encompasses a broad range of technologies and load requirements. Disagreement is inevitable, but many industry observers associate distributed generation with applications anywhere from 25 kW to 25 MW. Ten years ago, distributed generation users only represented about 2% of the world market. Today, that figure has increased to about 4 or 5%, and probably could settle in the 20% range within a 3-to-5-year period, according to Michael Jones, San Diego, Calif.-based Solar Turbines Inc. power generation marketing manager. The US Energy Information Administration predicts about 175 GW of generation capacity will be added domestically by 2010. If 20% comes from smaller plants, distributed generation could account for about 35 GW. Even with more competition, it`s highly unlikely distributed generation will totally replace current market structures and central stations. Distributed generation may be best suited for making market inroads when and where central systems need upgrading, and should prove its worth when the system can`t handle peak demands. Typical applications include small reciprocating engine generators at remote customer sites or larger gas turbines to boost the grid. Additional market opportunities include standby capacity, peak shaving, power quality, cogeneration and capacity rental for immediate demand requirements. Integration of distributed generation systems--using gas-fueled engines, gas-fired combustion engines and fuel cells--can upgrade power quality for customers and reduce operating costs for electric utilities.

  20. An analysis of US propane markets, winter 1996-1997

    SciTech Connect (OSTI)

    1997-06-01

    In late summer 1996, in response to relatively low inventory levels and tight world oil markets, prices for crude oil, natural gas, and products derived from both began to increase rapidly ahead of the winter heating season. Various government and private sector forecasts indicated the potential for supply shortfalls and sharp price increases, especially in the event of unusually severe winter weather. Following a rapid runup in gasoline prices in the spring of 1996, public concerns were mounting about a possibly similar situation in heating fuels, with potentially more serious consequences. In response to these concerns, the Energy Information Administration (EIA) participated in numerous briefings and meetings with Executive Branch officials, Congressional committee members and staff, State Energy Offices, and consumers. EIA instituted a coordinated series of actions to closely monitor the situation and inform the public. This study constitutes one of those actions: an examination of propane supply, demand, and price developments and trends.

  1. An Evaluation of the Total Cost of Ownership of Fuel Cell-Powered...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of supporting infrastructure, maintenance costs, warehouse space costs, and labor costs. ... Early Markets: Fuel Cells for Material Handling Equipment Early-Stage Market Change and ...

  2. ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","District Chilled Water","Propane","Othera"

    U.S. Energy Information Administration (EIA) Indexed Site

    7. Energy Sources, Number of Buildings, 1999" ,"Number of Buildings (thousand)" ,"All Buildings","All Buildings Using Any Energy Source","Energy Sources Used (more than one may apply)" ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","District Chilled Water","Propane","Othera" "All Buildings ................",4657,4403,4395,2670,434,117,50,451,153 "Building

  3. ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","District Chilled Water","Propane","Othera"

    U.S. Energy Information Administration (EIA) Indexed Site

    8. Energy Sources, Floorspace, 1999" ,"Total Floorspace (million square feet)" ,"All Buildings","All Buildings Using Any Energy Source","Energy Sources Used (more than one may apply)" ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","District Chilled Water","Propane","Othera" "All Buildings ................",67338,65753,65716,45525,13285,5891,2750,6290,2322

  4. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    2 U.S. Energy Information Administration / 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 2013 2014 2015 American Fuel Resources, LLC Advance Uranium Asset Management Ltd. AREVA / AREVA NC, Inc. AREVA NC, Inc. AREVA / AREVA NC, Inc. ARMZ (AtomRedMetZoloto) BHP Billiton Olympic Dam Corporation Pty Ltd ARMZ (AtomRedMetZoloto) BHP Billiton Olympic Dam Corporation Pty Ltd CAMECO BHP Billiton Olympic Dam Corporation Pty

  5. Cold start characteristics of ethanol as an automobile fuel

    DOE Patents [OSTI]

    Greiner, Leonard

    1982-01-01

    An alcohol fuel burner and decomposer in which one stream of fuel is preheated by passing it through an electrically heated conduit to vaporize the fuel, the fuel vapor is mixed with air, the air-fuel mixture is ignited and combusted, and the combustion gases are passed in heat exchange relationship with a conduit carrying a stream of fuel to decompose the fuel forming a fuel stream containing hydrogen gas for starting internal combustion engines, the mass flow of the combustion gas being increased as it flows in heat exchange relationship with the fuel carrying conduit, is disclosed.

  6. Solid oxide fuel cell power plant having a fixed contact oxidation catalyzed section of a multi-section cathode air heat exchanger

    DOE Patents [OSTI]

    Saito, Kazuo; Lin, Yao

    2015-02-17

    The multi-section cathode air heat exchanger (102) includes at least a first heat exchanger section (104), and a fixed contact oxidation catalyzed section (126) secured adjacent each other in a stack association. Cool cathode inlet air flows through cool air channels (110) of the at least first (104) and oxidation catalyzed sections (126). Hot anode exhaust flows through hot air channels (124) of the oxidation catalyzed section (126) and is combusted therein. The combusted anode exhaust then flows through hot air channels (112) of the first section (104) of the cathode air heat exchanger (102). The cool and hot air channels (110, 112) are secured in direct heat exchange relationship with each other so that temperatures of the heat exchanger (102) do not exceed 800.degree. C. to minimize requirements for using expensive, high-temperature alloys.

  7. Biogas Markets and Federal Policy | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Markets and Federal Policy Biogas Markets and Federal Policy National policy and legislative outlook for biogas and fuel cells. Presented by Patrick Serfass, American Biogas Council, at the NREL/DOE Biogas and Fuel Cells Workshop held June 11-13, 2012, in Golden, Colorado. PDF icon june2012_biogas_workshop_serfass.pdf More Documents & Publications Biogas and Fuel Cells Workshop Summary Report: Proceedings from the Biogas and Fuel Cells Workshop, Golden, Colorado, June 11-13, 2012 State Level

  8. LOW SULFUR HOME HEATING OIL DEMONSTRATION PROJECT SUMMARY REPORT.

    SciTech Connect (OSTI)

    BATEY, J.E.; MCDONALD, R.J.

    2005-06-01

    This project was funded by NYSERDA and has clearly demonstrated many advantages of using low sulfur content heating oil to provide thermal comfort in homes. Prior laboratory research in the United States and Canada had indicated a number of potential benefits of using lower sulfur (0.05%) heating oil. However, this prior research has not resulted in the widespread use of low sulfur fuel oil in the marketplace. The research project described in this report was conducted with the assistance of a well-established fuel oil marketer in New York State (NYS) and has provided clear proof of the many real-world advantages of marketing and using low sulfur content No. 2 fuel oil. The very positive experience of the participating marketer over the past three years has already helped to establish low sulfur heating oil as a viable option for many other fuel marketers. In large part, based on the initial findings of this project and the experience of the participating NYS oilheat marketer, the National Oilheat Research Alliance (NORA) has already fully supported a resolution calling for the voluntary use of low sulfur (0.05 percent) home heating oil nationwide. The NORA resolution has the goal of converting eighty percent of all oil-heated homes to the lower sulfur fuel (0.05 percent by weight) by the year 2007. The Oilheat Manufacturers Association (OMA) has also passed a resolution fully supporting the use of lower sulfur home heating oil in the equipment they manufacture. These are important endorsements by prominent national oil heat associations. Using lower sulfur heating oil substantially lowers boiler and furnace fouling rates. Laboratory studies had indicated an almost linear relationship between sulfur content in the oil and fouling rates. The completed NYSERDA project has verified past laboratory studies in over 1,000 occupied residential homes over the course of three heating seasons. In fact, the reduction in fouling rates so clearly demonstrated by this project is almost the same as predicted by past laboratory studies. Fouling deposition rates are reduced by a factor of two to three by using lower sulfur oil. This translates to a potential for substantial service cost savings by extending the interval between labor-intensive cleanings of the internal surfaces of the heating systems in these homes. In addition, the time required for annual service calls can be lowered, reducing service costs and customer inconvenience. The analyses conducted as part of this field demonstration project indicates that service costs can be reduced by up to $200 million a year nationwide by using lower sulfur oil and extending vacuum cleaning intervals depending on the labor costs and existing cleaning intervals. The ratio of cost savings to added fuel costs is economically attractive based on past fuel price differentials for the lower sulfur product. The ratio of cost savings to added costs vary widely as a function of hourly service rates and the additional cost for lower sulfur oil. For typical values, the expected benefit is a factor of two to four higher than the added fuel cost. This means that for every dollar spent on higher fuel cost, two to four dollars can be saved by lowered vacuum cleaning costs when the cleaning intervals are extended. Information contained in this report can be used by individual oil marketers to estimate the benefit to cost ratio for their specific applications. Sulfur oxide and nitrogen oxide air emissions are reduced substantially by using lower sulfur fuel oil in homes. Sulfur oxides emissions are lowered by 75 percent by switching from fuel 0.20 percent to 0.05 percent sulfur oil. This is a reduction of 63,000 tons a year nationwide. In New York State, sulfur oxide emissions are reduced by 13,000 tons a year. This translates to a total value of $12 million a year in Sulfur Oxide Emission Reduction Credits for an emission credit cost of $195 a ton. While this ''environmental cost'' dollar savings is smaller than the potential service costs reduction, it is very significant. It represents an important reduction in air pollutants that contribute directly to acid rain and other adverse impacts in the United States. When all air emissions are included, low sulfur content home heating oil and utility gas are virtually equal in their environmental impacts.

  9. Distributed Generation with Heat Recovery and Storage

    SciTech Connect (OSTI)

    Siddiqui, Afzal; Marnay, Chris; Firestone, Ryan M.; Zhou, Nan

    2005-07-29

    Electricity generated by distributed energy resources (DER) located close to end-use loads has the potential to meet consumer requirements more efficiently than the existing centralized grid. Installation of DER allows consumers to circumvent the costs associated with transmission congestion and other non-energy costs of electricity delivery and potentially to take advantage of market opportunities to purchase energy when attractive. On-site thermal power generation is typically less efficient than central station generation, but by avoiding non-fuel costs of grid power and utilizing combined heat and power (CHP) applications, i.e., recovering heat from small-scale on-site generation to displace fuel purchases, then DER can become attractive to a strictly cost-minimizing consumer. In previous efforts, the decisions facing typical commercial consumers have been addressed using a mixed-integer linear programme, the DER Customer Adoption Model(DER-CAM). Given the site s energy loads, utility tariff structure, and information (both technical and financial) on candidate DER technologies, DER-CAM minimizes the overall energy cost for a test year by selecting the units to install and determining their hourly operating schedules. In this paper, the capabilities of DER-CAM are enhanced by the inclusion of the option to store recovered low-grade heat. By being able to keep an inventory of heat for use in subsequent periods, sites are able to lower costs even further by reducing off-peak generation and relying on storage. This and other effects of storages are demonstrated by analysis of five typical commercial buildings in San Francisco, California, and an estimate of the cost per unit capacity of heat storage is calculated.

  10. Distributed Generation with Heat Recovery and Storage

    SciTech Connect (OSTI)

    Siddiqui, Afzal S.; Marnay, Chris; Firestone, Ryan M.; Zhou, Nan

    2006-06-16

    Electricity produced by distributed energy resources (DER)located close to end-use loads has the potential to meet consumerrequirements more efficiently than the existing centralized grid.Installation of DER allows consumers to circumvent the costs associatedwith transmission congestion and other non-energy costs of electricitydelivery and potentially to take advantage of market opportunities topurchase energy when attractive. On-site, single-cycle thermal powergeneration is typically less efficient than central station generation,but by avoiding non-fuel costs of grid power and by utilizing combinedheat and power (CHP) applications, i.e., recovering heat from small-scaleon-site thermal generation to displace fuel purchases, DER can becomeattractive to a strictly cost-minimizing consumer. In previous efforts,the decisions facing typical commercial consumers have been addressedusing a mixed-integer linear program, the DER Customer Adoption Model(DER-CAM). Given the site s energy loads, utility tariff structure, andinformation (both technical and financial) on candidate DER technologies,DER-CAM minimizes the overall energy cost for a test year by selectingthe units to install and determining their hourly operating schedules. Inthis paper, the capabilities of DER-CAM are enhanced by the inclusion ofthe option to store recovered low-grade heat. By being able to keep aninventory of heat for use in subsequent periods, sites are able to lowercosts even further by reducing lucrative peak-shaving generation whilerelying on storage to meet heat loads. This and other effects of storageare demonstrated by analysis of five typical commercial buildings in SanFrancisco, California, USA, and an estimate of the cost per unit capacityof heat storage is calculated.

  11. High Temperature Gas-Cooled Reactor Projected Markets and Preliminary Economics

    SciTech Connect (OSTI)

    Larry Demick

    2011-08-01

    This paper summarizes the potential market for process heat produced by a high temperature gas-cooled reactor (HTGR), the environmental benefits reduced CO2 emissions will have on these markets, and the typical economics of projects using these applications. It gives examples of HTGR technological applications to industrial processes in the typical co-generation supply of process heat and electricity, the conversion of coal to transportation fuels and chemical process feedstock, and the production of ammonia as a feedstock for the production of ammonia derivatives, including fertilizer. It also demonstrates how uncertainties in capital costs and financial factors affect the economics of HTGR technology by analyzing the use of HTGR technology in the application of HTGR and high temperature steam electrolysis processes to produce hydrogen.

  12. Fuel cell gas management system

    DOE Patents [OSTI]

    DuBose, Ronald Arthur

    2000-01-11

    A fuel cell gas management system including a cathode humidification system for transferring latent and sensible heat from an exhaust stream to the cathode inlet stream of the fuel cell; an anode humidity retention system for maintaining the total enthalpy of the anode stream exiting the fuel cell equal to the total enthalpy of the anode inlet stream; and a cooling water management system having segregated deionized water and cooling water loops interconnected by means of a brazed plate heat exchanger.

  13. Alcohol fuel from Ohio farms

    SciTech Connect (OSTI)

    Jones, J.D.

    1984-01-01

    This booklet provides an introduction to technical, marketing, and regulatory issues involved in on-farm alcohol fuel production. Discussed are ethanol production provcesses, investment, potential returns, regulations and permits, and sources of financial and technical assistance. 2 figures. (DMC)

  14. Fuel Cell Seminar, 1992: Program and abstracts

    SciTech Connect (OSTI)

    Not Available

    1992-12-31

    This year`s theme, ``Fuel Cells: Realizing the Potential,`` focuses on progress being made toward commercial manufacture and use of fuel cell products. Fuel cell power plants are competing for market share in some applications and demonstrations of market entry power plants are proceeding for additional applications. Development activity on fuel cells for transportation is also increasing; fuel cell products have potential in energy and transportation industries, with very favorable environmental impacts. This Seminar has the purpose of fostering communication by providing a forum for the international community interested in development, application, and business opportunities related fuel cells. Over 190 technical papers are included, the majority being processed for the data base.

  15. A Life-Cycle Assessment Comparing Select Gas-to-Liquid Fuels...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Shell Gas to Liquids in the context of a Future Fuel Strategy - Technical Marketing Aspects Verification of Shell GTL Fuel as CARB Alternative Diesel Assessment of Environmental ...

  16. Economics of Direct Hydrogen Polymer Electrolyte Membrane Fuel Cell Systems

    SciTech Connect (OSTI)

    Mahadevan, Kathyayani

    2011-10-04

    Battelle's Economic Analysis of PEM Fuel Cell Systems project was initiated in 2003 to evaluate the technology and markets that are near-term and potentially could support the transition to fuel cells in automotive markets. The objective of Battelle?s project was to assist the DOE in developing fuel cell systems for pre-automotive applications by analyzing the technical, economic, and market drivers of direct hydrogen PEM fuel cell adoption. The project was executed over a 6-year period (2003 to 2010) and a variety of analyses were completed in that period. The analyses presented in the final report include: Commercialization scenarios for stationary generation through 2015 (2004); Stakeholder feedback on technology status and performance status of fuel cell systems (2004); Development of manufacturing costs of stationary PEM fuel cell systems for backup power markets (2004); Identification of near-term and mid-term markets for PEM fuel cells (2006); Development of the value proposition and market opportunity of PEM fuel cells in near-term markets by assessing the lifecycle cost of PEM fuel cells as compared to conventional alternatives used in the marketplace and modeling market penetration (2006); Development of the value proposition of PEM fuel cells in government markets (2007); Development of the value proposition and opportunity for large fuel cell system application at data centers and wastewater treatment plants (2008); Update of the manufacturing costs of PEM fuel cells for backup power applications (2009).

  17. Supplying LNG markets using nitrogen rejection units at Exxon Shute Creek Facility

    SciTech Connect (OSTI)

    Hanus, P.M.; Kimble, E.L.

    1995-11-01

    Interest is growing in the United States for using Liquid Natural Gas (LNG) as an alternative transportation fuel for diesel and as a source of heating fuel. For gas producers, LNG offers a premium price opportunity versus conventional natural gas sales. To supply this developing market, two existing Nitrogen Rejection Units (NRU) at the Exxon Shute Creek Facility in Wyoming were modified allowing LNG extraction and truck loading for transport to customers. The modifications involved adding heat exchanger capacity to the NRUs to compensate for the refrigeration loss when LNG is removed. Besides allowing for LNG extraction, the modifications also debottlenecked the NRUs resulting in higher methane recovery and lower compression costs. With the modifications, the NRUs are capable of producing for sale 60,000 gpd (5 MMscfd gas equivalent) of high purity LNG. Total investment has been $5 million with initial sales of LNG occurring in September 1994.

  18. Heat pipe array heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C.

    1987-08-25

    A heat pipe arrangement for exchanging heat between two different temperature fluids. The heat pipe arrangement is in a ounterflow relationship to increase the efficiency of the coupling of the heat from a heat source to a heat sink.

  19. Automotive Waste Heat Conversion to Electric Power using Skutterudites...

    Broader source: Energy.gov (indexed) [DOE]

    Development of a Scalable 10% Efficient Thermoelectric Generator Vehicle Fuel Economy Improvement through Thermoelectric Waste Heat Recovery Vehicular Applications of ...

  20. Energy Information Administration/Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    30.5 See footnotes at end of table. 440 Energy Information AdministrationPetroleum Marketing Annual 1998 Table A3. RefinerReseller Prices of Distillate and Residual Fuel Oils,...