National Library of Energy BETA

Sample records for heat incentives csv

  1. Performance based incentive for Combined Heat and Power Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment up to five megawatts at ...

  2. Utility Incentives for Combined Heat and Power | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to:EA EISTJThin FilmUnited States:UserLabor CommissionPageUtilityIncentives for

  3. How do I display the Map of Wind Farms csv coordinates in ArcMap...

    Open Energy Info (EERE)

    I display the Map of Wind Farms csv coordinates in ArcMap software? Home > Groups > Geospatial I downloaded the Map of Wind Farms data as a .csv from http:en.openei.orgwiki...

  4. APS- Renewable Energy Incentive Program

    Broader source: Energy.gov [DOE]

    Through the Renewable Incentive Program, Arizona Public Service (APS) offers customers who install solar water heating systems the opportunity to sell the renewable energy credits (RECs) associat...

  5. Notes on the PMC Journal List CSV file This CSV file, available from the Journal List page on the PMC site, http://www.ncbi.nlm.nih.gov/pmc/

    E-Print Network [OSTI]

    Levin, Judith G.

    Notes on the PMC Journal List CSV file This CSV file, available from the Journal List page on the PMC site, http://www.ncbi.nlm.nih.gov/pmc/ journals/, is a list of journals that currently deposit in PMC. It includes journals that are no longer in publication or no longer deposit material in PMC

  6. Aligning Contract Incentives

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contract Incentives" * The purpose of the memo: * Align Contractor Incentives with taxpayer interests * Hold each party to the contract responsible for its actions * Ultimately...

  7. Tax Incentives

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCEDInstallers/ContractorsPhotovoltaics »Tankless Water Heater »HeatRoofsCompressed airExemptionTax

  8. Effective Incentive Structures

    Broader source: Energy.gov [DOE]

    Presents an in-depth look at effective incentive structures, how to clarify your program goals, and tips to plan for the long term.

  9. CSV's | NISAC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 OutreachProductswsicloudwsiclouddenDVA N C E D B LReports from the CloudGEGR-N Goods PO

  10. Photovoltaic Incentive Design Handbook

    SciTech Connect (OSTI)

    Hoff, T. E.

    2006-12-01

    Investments in customer-owned grid-connected photovoltaic (PV) energy systems are growing at a steady pace. This is due, in part, to the availability of attractive economic incentives offered by public state agencies and utilities. In the United States, these incentives have largely been upfront lump payments tied to the system capacity rating. While capacity-based ''buydowns'' have stimulated the domestic PV market, they have been criticized for subsidizing systems with potentially poor energy performance. As a result, the industry has been forced to consider alternative incentive structures, particularly ones that pay based on long-term measured performance. The industry, however, lacks consensus in the debate over the tradeoffs between upfront incentive payments versus longer-term payments for energy delivery. This handbook is designed for agencies and utilities that offer or intend to offer incentive programs for customer-owned PV systems. Its purpose is to help select, design, and implement incentive programs that best meet programmatic goals. The handbook begins with a discussion of the various available incentive structures and then provides qualitative and quantitative tools necessary to design the most appropriate incentive structure. It concludes with program administration considerations.

  11. Country Review of Energy-Efficiency Financial Incentives in the Residential Sector

    E-Print Network [OSTI]

    Can, Stephane de la Rue du

    2011-01-01

    Energy-Efficiency Resource Standards ESCO Energy Services Company FI financial incentive GHG greenhouse gas HVAC heating, ventilation, and air conditioning

  12. Federal Incentives for Water Power

    SciTech Connect (OSTI)

    2013-04-05

    This factsheet lists the major federal incentives for water power technologies available as of April 2013.

  13. Aligning Incentives With Program Goals

    Broader source: Energy.gov [DOE]

    Presents techniques used by Michigan Saves to increase participation and provide greater incentives.

  14. LADWP- Solar Incentive Program

    Broader source: Energy.gov [DOE]

    The Los Angeles Department of Water and Power's (LADWP) Solar Incentive Program began in 2000, with a funding level of $150 million. The California Solar Initiative, created in 2007 upon the...

  15. Biomass Energy Production Incentive

    Office of Energy Efficiency and Renewable Energy (EERE)

    In 2007 South Carolina enacted the Energy Freedom and Rural Development Act, which provides production incentives for certain biomass-energy facilities. Eligible systems earn $0.01 per kilowatt-h...

  16. Ameren Illinois (Gas)- Business Efficiency Incentives

    Broader source: Energy.gov [DOE]

    The Specialty Equipment Application offers incentives on steamers, griddles, fryers, and other commercial kitchen equipment. The Steam Trap /Process Steam Incentive Program offers incentives on s...

  17. ConEd (Gas)- Multi-family Energy Efficiency Incentives Program

    Broader source: Energy.gov [DOE]

    Con Edison is offering a Multifamily Natural Gas Heating Rebate Program. Through this program, incentives are offered on energy efficient heating equipment for 5-75 unit buildings in the eligible...

  18. CPS Energy- New Residential Construction Incentives

    Broader source: Energy.gov [DOE]

    CPS Energy offers incentives for new residential construction that is at least 15% more efficient than required by the [http://dsireusa.org/incentives/incentive.cfm?Incentive_Code=TX29R&re=1...

  19. Performance Incentives for Transmission

    E-Print Network [OSTI]

    Oren, Shmuel S.

    Performance Incentives for Transmission FERC's Standard Market Design should accommodate a performance-based regulation mechanism that is designed to align the interests of transmission operators to investment, transmission investors would be entitled to the CRRs or CRR auc- tion revenues engendered

  20. Incentives and Internet Algorithms

    E-Print Network [OSTI]

    Feigenbaum, Joan

    Game Theory Internet Design #12;9 Game Theory and the Internet · Long history of work: ­ NetworkingIncentives and Internet Algorithms Joan Feigenbaum Yale University http://www.cs.yale.edu/~jf Scott with selfishness? · Internet Architecture: robust scalability ­ How to build large and robust systems? #12

  1. Agricultural Biomass and Landfill Diversion Incentive (Texas...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Landfill Diversion Incentive (Texas) Agricultural Biomass and Landfill Diversion Incentive (Texas) < Back Eligibility Agricultural Commercial Construction Fuel Distributor...

  2. California Energy Incentive Programs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels| Department ofBusinessCEA90:2:09California Energy Incentive

  3. SBSP Commercial Upstream Incentive Project

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SBSP Commercial Upstream Incentive Project 2014 Building Technologies Office Peer Review Todd Levin, tlevin@anl.gov, Cathy Milostan, cmilostan@anl.gov Argonne National Laboratory...

  4. Designing Incentives Toolkit Better Buildings Residential Network

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    enough and what to incentivize. When aligned with program goals, incentives can be a very useful tool in achieving home energy upgrades. Definition Incentives provide motivation to...

  5. Alternative Fuel Production Facility Incentives (Kentucky) |...

    Broader source: Energy.gov (indexed) [DOE]

    Developer Utility Program Info State Kentucky Program Type Corporate Tax Incentive The Kentucky Economic Development and Finance Authority (KEDFA) provides tax incentives to...

  6. Profit incentives and technological change

    E-Print Network [OSTI]

    Linn, Joshua

    2005-01-01

    This thesis is a collection of three empirical essays on the effect of profit incentives on innovation and technology adoption. Chapter 1, written with Daron Acemoglu, investigates the effect of (potential) market size on ...

  7. SCE- California Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    Southern California Edison offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new...

  8. Local Option- Green Building Incentives

    Office of Energy Efficiency and Renewable Energy (EERE)

    SB 1597 of 2008 also granted authority to a few select jurisdictions to provide density bonuses, make adjustments to otherwise applicable development requirements, or provide other incentives to a...

  9. Cooperation Incentives for Wireless Networks

    E-Print Network [OSTI]

    Wu, Chuchu

    2015-01-01

    incentives in multi-hop wireless networks. In INFOCOM,for offloading traffic from LTE network to wireless peer-to-reputation sys- tem for wireless mesh networks using network

  10. Nonprice incentives and energy conservation

    E-Print Network [OSTI]

    Asensio, OI; Delmas, MA; Delmas, MA

    2015-01-01

    Floor Ideology Member Environmental Organization Weather Controls HeatingFloor Ideology Member Environmental Organization Hourly Weather Controls HeatingFloor Ideology Member Environmental Organization Hourly Weather Controls Heating

  11. Better Buildings: Financing and Incentives: Spotlight on Michigan...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Michigan: Experiment to Find the Right Mix of Incentives Better Buildings: Financing and Incentives: Spotlight on Michigan: Experiment to Find the Right Mix of Incentives Better...

  12. Designing Effective Incentives to Drive Residential Retrofit Program Participation

    Broader source: Energy.gov [DOE]

    This webinar covered retrofit program incentive contests, decision points to consider when designing an incentive program, and examples of incentive structures.

  13. Combined Heat and Power: A Technology Whose Time Has Come

    E-Print Network [OSTI]

    Ferraina, Steven

    2014-01-01

    Incentives for Combined Heat and Power, U.S. E NVTL . PCombined Heat and Power: A Technology Whose Time Has ComeWashington, D.C. COMBINED HEAT AND POWER A. Create an

  14. Energy Savings Mortgage Incentive for Existing Homes

    Broader source: Energy.gov [DOE]

    The incentive is a matching program, split equally between state funds and non-state contributions. The incentive claimed may not exceed half of the improvement cost, and improvement costs must m...

  15. Federal Incentives for Wind Power (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-05-01

    This fact sheet describes the federal incentives available as of April 2013 that encourage increased development and deployment of wind energy technologies, including research grants, tax incentives, and loan programs.

  16. Energy Incentive Programs, Florida | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    incentive program that rewards innovations that trim at least 25 kW from summer peak demand (April - October between 3 and 6 P.M.). To qualify for an incentive under this...

  17. Puerto Rico- Economic Development Incentives for Renewables

    Broader source: Energy.gov [DOE]

    The 2008 Economic Incentives for the Development of Puerto Rico Act (EIA) provides a wide array of tax credits and incentives that enable local and foreign companies dedicated to certain business...

  18. Federal Incentives for Water Power (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-05-01

    This fact sheet describes the federal incentives available as of April 2013 for the development of water power technologies.

  19. S ENERGY POLICY ACT OF 2005 SECTION 242 HYDROELECTRIC INCENTIVE...

    Broader source: Energy.gov (indexed) [DOE]

    HYDROELECTRIC INCENTIVE PROGRAM CALENDAR YEAR 2013 INCENTIVE PAYMENTS Payee (Applicant) Hydro Facility Albany Engineering Corporation (AEC) Mechanicville Hydroelectric Project...

  20. Optimization of Heat Exchanger Cleaning

    E-Print Network [OSTI]

    Siegell, J. H.

    1986-01-01

    EXCHANGER CLEANING Jeffrey H. Siegell Exxon Research and Engineering Company Florham Park, New Jersey ABSTRACT The performance of heat integration systems is quantified in terms of the amount of heat that is recovered. This decreases with time due... to increased fouling of the heat exchange surface. Using the "Total Fouling Related Expenses (TFRE)" approach, economic incentives for heat exchanger cleaning are evaluated using linear, exponential, and exponential finite decrease models of the heat...

  1. Delmarva- Commissioning and Operations Incentive Programs

    Broader source: Energy.gov [DOE]

    Delmarva's Enhanced Commissioning Program offers building design and commissioning incentives to commercial, industrial, governmental and institutional customers planning large new buildings....

  2. Catawba County- Green Construction Permitting Incentive Program

    Broader source: Energy.gov [DOE]

    Catawba County is providing incentives to encourage the construction of sustainably built homes and commercial buildings. Rebates on permit fees and plan reviews are available for certain...

  3. PEPCO- Commissioning and Operations Incentive Programs

    Broader source: Energy.gov [DOE]

    Pepco's Enhanced Commissioning Program offers building design and commissioning incentives to commercial, industrial, governmental and institutional customers planning large new buildings....

  4. Energy Incentive Programs | Department of Energy

    Office of Environmental Management (EM)

    and typically funded out of general tax revenues. It also provides information about demand-response and load management programs, which offer incentives to curtail demand...

  5. Mohave Electric Cooperative- Renewable Energy Incentive Program

    Broader source: Energy.gov [DOE]

    Mohave Electric Cooperative provides incentives for its customers to install renewable energy systems on their homes and businesses. Mohave Electric Cooperative will provide rebates for...

  6. Delaware Electric Cooperative- Green Energy Program Incentives

    Office of Energy Efficiency and Renewable Energy (EERE)

    The Delaware Electric Cooperative (DEC) provides incentives for solar photovoltaic (PV), solar thermal, wind, fuel cells, and geothermal installed by DEC member-owners. Eligibility is limited to ...

  7. Questar Gas- Residential Solar Assisted Water Heating Rebate Program

    Office of Energy Efficiency and Renewable Energy (EERE)

    Questar gas provides incentives for residential customers to purchase and install solar water heating systems (both for domestic and pool heating uses) on their newly-constructed homes. Rebates of...

  8. CSV File Documentation: Consumption

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming Dry NaturalPrices1 Table 1.101 (Million Short6RU NtightGasCHP

  9. Incentive Games and Mechanisms for Risk Management

    E-Print Network [OSTI]

    Alpcan, Tansu

    2010-01-01

    Incentives play an important role in (security and IT) risk management of a large-scale organization with multiple autonomous divisions. This paper presents an incentive mechanism design framework for risk management based on a game-theoretic approach. The risk manager acts as a mechanism designer providing rules and incentive factors such as assistance or subsidies to divisions or units, which are modeled as selfish players of a strategic (noncooperative) game. Based on this model, incentive mechanisms with various objectives are developed that satisfy efficiency, preference-compatibility, and strategy-proofness criteria. In addition, iterative and distributed algorithms are presented, which can be implemented under information limitations such as the risk manager not knowing the individual units' preferences. An example scenario illustrates the framework and results numerically. The incentive mechanism design approach presented is useful for not only deriving guidelines but also developing computer-assistan...

  10. Alternative Energy Development Incentive (Personal)

    Broader source: Energy.gov [DOE]

    Eligible projects include the construction of electricity generation facilities of 2 megawatts or greater that utilize hydroelectric, solar, biomass, geothermal, wind, or waste heat from an indus...

  11. Alternative Energy Development Incentive (Corporate)

    Broader source: Energy.gov [DOE]

    Eligible projects include the construction of electricity generation facilities of 2 megawatts or greater that utilize hydroelectric, solar, biomass, geothermal, wind, or waste heat from an indus...

  12. Motivate Homeowner Action With Updated DOE Incentives Database...

    Energy Savers [EERE]

    Database Motivate Homeowner Action With Updated DOE Incentives Database Is customer motivation a barrier to marketing upgrades in your community? You can find ideas for incentives...

  13. Structuring Rebate and Incentive Programs for Sustainable Demand...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Structuring Rebate and Incentive Programs for Sustainable Demand Structuring Rebate and Incentive Programs for Sustainable Demand Better Buildings Neighborhood Program Peer...

  14. Final Guidance for EPAct 2005 Section 242 Hydroelectric Incentive...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Final Guidance for EPAct 2005 Section 242 Hydroelectric Incentive Program Final Guidance for EPAct 2005 Section 242 Hydroelectric Incentive Program This document contains the Final...

  15. Incentives and Financing for Energy Efficient Homes | Department...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Incentives and Financing for Energy Efficient Homes Incentives and Financing for Energy Efficient Homes August 19, 2015 - 5:16pm Addthis Consumers can find financial assistance for...

  16. Find Energy Incentives Quicker and Easier with DSIRE Open Data...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Website March 3, 2015 - 4:16pm Addthis The updated Database of State Incentives for Renewables & Efficiency helps homeowners and businesses find incentive programs that can reduce...

  17. Better Buildings: Financing and Incentives: Spotlight on Maine...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to a Sustainable Level of Incentives More Documents & Publications Spotlight on Maine: Transition to a Sustainable Level of Incentives Better Buildings: Workforce, Spotlight on...

  18. Financial Incentives Available for Facilities Affected by the...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Financial Incentives Available for Facilities Affected by the US EPA Boiler MACT Proposed Rule, December 2012 Financial Incentives Available for Facilities Affected by the US EPA...

  19. Strategies to Address Split Incentives in Multifamily Buildings...

    Office of Environmental Management (EM)

    Strategies to Address Split Incentives in Multifamily Buildings Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily ...

  20. Aligning Contract Incentives & Contract Mgt Trends - David Leotta...

    Energy Savers [EERE]

    Contract Incentives" The purpose of the memo: Align Contractor Incentives with taxpayer interests Hold each party to the contract responsible for its actions Ultimately the...

  1. EPA Clean Energy Incentive Program Stakeholder Calls - Potential...

    Energy Savers [EERE]

    Energy Incentive Program Stakeholder Calls - Potential CEIP Project Partners EPA Clean Energy Incentive Program Stakeholder Calls - Potential CEIP Project Partners November 23,...

  2. Nonprice incentives and energy conservation

    E-Print Network [OSTI]

    Asensio, OI; Delmas, MA; Delmas, MA

    2015-01-01

    Yes Yes Yes Yes Yes Yes Degree-hour bins Yes Yes Yes Yes YesOrganization Hourly Weather Controls Heating Degree HoursCooling Degree Hours Yes Yes Yes Yes Yes Time Dummies Day-

  3. PG&E- California Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    Pacific Gas & Electric (PG&E) offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new...

  4. SCE- New Construction Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    Southern California Edison offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new...

  5. Alternative Energy Development Incentive (Personal) (Utah)

    Broader source: Energy.gov [DOE]

    The Alternative Energy Development Incentive (AEDI) is a post-performance non-refundable tax credit for 75% of new state tax revenues (including, state, corporate, sales and withholding taxes) over...

  6. Alternative Energy Development Incentive (Corporate) (Utah)

    Broader source: Energy.gov [DOE]

    The Alternative Energy Development Incentive (AEDI) is a post-performance non-refundable tax credit for 75% of new state tax revenues (including, state, corporate, sales and withholding taxes) over...

  7. Clean Coal Incentive Tax Credit (Kentucky)

    Broader source: Energy.gov [DOE]

    Clean Coal Incentive Tax Credit provides for a property tax credit for new clean coal facilities constructed at a cost exceeding $150 million and used for the purposes of generating electricity....

  8. SDG&E- California Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    SDG&E offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new construction projects. A...

  9. CPS Energy- New Commercial Construction Incentives

    Broader source: Energy.gov [DOE]

    CPS Energy offers incentives for new commercial construction that is at least 15% more efficient than required by the City of San Antonio Building Code (based on IECC 2009). The building code and...

  10. Made in Minnesota Solar Energy Production Incentive

    Broader source: Energy.gov [DOE]

    Since January 2014, The Department of Commerce (DOC) has administered a state Made in Minnesota Solar Energy Production Incentive. Systems must be less than 40 kW-DC and be certified as "Made in ...

  11. Fuel Cell Rebate and Performance Incentive

    Broader source: Energy.gov [DOE]

    Under PON 2157 The New York State Energy Research and Development Authority (NYSERDA) offers incentives for the purchase, installation, and operation of customer sited tier (CST, also called "beh...

  12. Energy Incentive Programs, Georgia | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,Georgia Energy Incentive

  13. Energy Incentive Programs, Louisiana | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisiana Energy Incentive

  14. Energy Incentive Programs, Maine | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisiana Energy IncentiveMaine

  15. List of Geothermal Heat Pumps Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed airGeothermal Facilities Jump to:Pumps

  16. List of Heat pumps Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed airGeothermal Facilities JumpJump to:

  17. List of Heat pumps Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed airGeothermal Facilities JumpJump

  18. List of Heat recovery Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed airGeothermal Facilities JumpJumpList

  19. List of Passive Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed airGeothermalList

  20. List of Solar Pool Heating Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of RefuelingRoomList of Solar Pool

  1. List of Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of RefuelingRoomList of Solar

  2. List of Solar Thermal Process Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of RefuelingRoomList of

  3. List of Solar Water Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of RefuelingRoomList ofSolar Water

  4. The impact of financial incentives on firm behavior

    E-Print Network [OSTI]

    Matsa, David

    2006-01-01

    This dissertation analyzes the impact of various financial incentives on firm behavior. The first two chapters examine product-market and input-market effects of a firm's capital structure and the incentives they create. ...

  5. Fact #891: September 21, 2015 Comparison of State Incentives...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1: September 21, 2015 Comparison of State Incentives for Plug-In Electric Vehicle Purchases Fact 891: September 21, 2015 Comparison of State Incentives for Plug-In Electric...

  6. Requirements Engineering and Technology Transfer: Obstacles, Incentives and Improvement Agenda

    E-Print Network [OSTI]

    Leite, Julio Cesar Sampaio do Prado

    Requirements Engineering and Technology Transfer: Obstacles, Incentives and Improvement Agenda technology transfer. In addition, major incentives for using RE methods are discussed, along with ideas engineering; Technology transfer 1. Introduction In a 1993 evaluation of requirements engineering (RE

  7. Fact #893: October 5, 2015 Incentives for the Installation of...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    common type of incentive is a state tax credit, but there are also states that give rebates, grants, tax exemptions, and loans to those installing EVSE. The incentives can apply...

  8. Incentive competitions as a policy tool for technological innovation

    E-Print Network [OSTI]

    Campbell, Georgina A. (Georgina Amy)

    2011-01-01

    Large incentive competitions are becoming increasingly popular amongst policymakers and philanthropists as a mission-orientated tool for inducing innovation, particularly in areas of national priority where market incentives ...

  9. Fact #788: July 15, 2013 State and Private Consumer Incentives...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 15, 2013 State and Private Consumer Incentives for Plug-In Vehicles Many states offer their own consumer incentives for plug-in vehicles, such as HOV lane exemptions and...

  10. City of Palo Alto Utilities- Solar Water Heating Program

    Broader source: Energy.gov [DOE]

    City of Palo Alto Utilities is offering incentives for their residential, commercial and industrial customers to install solar water heating systems on their homes and facilities with a goal of 1...

  11. Quantitative Financial Analysis of Alternative Energy Efficiency Shareholder Incentive Mechanisms

    E-Print Network [OSTI]

    Cappers, Peter

    2010-01-01

    Analysis of Alternative Energy Efficiency ShareholderAnalysis of Alternative Energy Efficiency Shareholderof alternative shareholder incentive mechanisms for energy

  12. Utility Incentive Programs Energy Efficiency Opportunities

    E-Print Network [OSTI]

    Massachusetts at Amherst, University of

    . Building energy efficiency measures that have higher B/C ratios should be implemented first or at the sameUtility Incentive Programs Energy Efficiency Opportunities June 19th, 2013 CHP/MAEEP Boston, MA #12 building performance good for employees, shoppers, students o Fewer Emissions Benefits to the Energy

  13. Forging the Link: Linking the Economic Incentives

    E-Print Network [OSTI]

    the effects of land use changes on water resources, the economic incentives of LID, changes in climate and opportunities of growth 2. Unplanned growth can lead to a loss of natural resources that support a community the Resource Manual that provides additional background information for local implementation. FTL focuses

  14. Energy Incentive Programs, Arizona | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, Arizona Updated

  15. Energy Incentive Programs, Arkansas | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, Arizona UpdatedArkansas

  16. Energy Incentive Programs, California | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, Arizona

  17. Energy Incentive Programs, Colorado | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, ArizonaColorado Energy

  18. Energy Incentive Programs, Connecticut | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, ArizonaColorado

  19. Energy Incentive Programs, Delaware | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs, ArizonaColoradoDelaware

  20. Energy Incentive Programs, Florida | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,

  1. Energy Incentive Programs, Hawaii | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,Georgia Energy

  2. Energy Incentive Programs, Idaho | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,Georgia EnergyIdaho

  3. Energy Incentive Programs, Illinois | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,Georgia

  4. Energy Incentive Programs, Indiana | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,GeorgiaIndiana Energy

  5. Energy Incentive Programs, Iowa | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,GeorgiaIndiana

  6. Energy Incentive Programs, Kansas | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive Programs,GeorgiaIndianaKansas

  7. Energy Incentive Programs, Kentucky | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy Incentive

  8. Energy Incentive Programs, Maryland | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisiana Energy

  9. Energy Incentive Programs, Massachusetts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisiana EnergyMassachusetts

  10. Energy Incentive Programs, Michigan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisiana

  11. Energy Incentive Programs, Minnesota | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisianaMinnesota Energy

  12. Energy Incentive Programs, Mississippi | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisianaMinnesota

  13. Energy Incentive Programs, Missouri | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisianaMinnesotaMissouri Energy

  14. Energy Incentive Programs, Montana | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisianaMinnesotaMissouri

  15. Energy Incentive Programs, Nebraska | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona Energy IncentiveLouisianaMinnesotaMissouriNebraska

  16. Energy Incentive Programs, Ohio | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy IncentiveCarolinaOhio

  17. Energy Incentive Programs, Oregon | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire EnergyOregon Energy Incentive

  18. Energy Incentive Programs, Texas | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire EnergyOregonTexas Energy Incentive

  19. Energy Incentive Programs, Wyoming | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshireWyoming Energy Incentive Programs,

  20. List of Dehumidifiers Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives Jump

  1. Canadian incentives for oil and gas exploration. [Applicability to USA

    SciTech Connect (OSTI)

    Not Available

    1980-04-01

    During the 1970s a number of different exploration and production incentive programs were put in place in Canada, in particular in the Province of Alberta, Canada's principal oil- and gas-producing province. The DOE/RA is evaluating Canadian incentives for oil and gas exploration, and this study is intended to provide information that will help guide DOE/RA in determining the applicability of Canadian incentive programs in US energy policy. The study describes and documents the fiscal structure in which the Canadian oil industry operates. The incentive features of pricing policy, taxation policy, and provincial royalty systems are discussed. A principal focus of the study is on one of the most important of Canada's specific incentive programs, the Alberta Exploratory Drilling Incentive Credit Program (EDICP). The study describes and evaluates the effect of the EDICP on increased oil and gas exploration activity. Similarly, the study also reviews and evaluates other specific incentive programs such as the Alberta Geophysical Incentive Program, Frontier Exploration Allowances, and various tar sand and heavy oil development incentives. Finally the study evaluates the applicability of Canadian incentives to US energy policy.

  2. Making solar laws work. A study of state solar energy incentives

    SciTech Connect (OSTI)

    Roessner, J.D.

    1980-11-01

    The results of a research investigation of solar financial and research, demonstration, and development R D and D) incentive programs in 18 states are summarized. The investigation focuses upon implementation - the organization and administrative processes required to convert a law into a viable program. Eleven financial and 12 RD and D programs were investigated. Results indicate that four conditions are common to successful implementation of both types of incentive programs: the opportunity to use solar energy as a heating source; characteristics of the agency selected to complement the law; involvement of outside groups in program implementation; and the specificity of guidance given to those responsible for implementation. Other conditions specific to the implementation of each type of program are discussed as well as the implications of these findings for state and federal policy makers.

  3. Making solar laws work: a study of state solar energy incentives

    SciTech Connect (OSTI)

    Roessner, J.D.

    1980-11-01

    The results of a research investigation of solar financial and research, demonstration, and development (RD and D) incentive programs in 18 states are summarized. The investigation focuses upon implementation - the organization and administrative processes required to convert a law into a viable program. Eleven financial and 12 RD and D programs were investigated. Results indicate that four conditions are common to successful implementation of both types of incentive programs: the opportunity to use solar energy as a heating source; characteristics of the agency selected to complement the law; involvement of outside groups in program implementation; and the specificity of guidance given to those responsible for implementation. Other conditions specific to the implementation of each type of program are discussed as well as the implications of these findings for state and federal policy makers.

  4. Structuring Rebate and Incentive Programs for Sustainable Demand...

    Broader source: Energy.gov (indexed) [DOE]

    Peer Exchange Call: Structuring Rebate and Incentive Programs for Sustainable Demand, call slides and discussion summary, August 18, 2011. Call Slides and Discussion Summary More...

  5. Customer Incentives for Energy Efficiency Through Program Offerings

    SciTech Connect (OSTI)

    none,

    2010-02-01

    Summarizes the approaches used by energy efficiency program administrators when assessing the range of financial and other incentives to be used in energy efficiency programs.

  6. EPAct 2005 Section 242 Hydroelectric Incentive Program - 2013...

    Broader source: Energy.gov (indexed) [DOE]

    for Hydroelectric Production Incentives under Section 242 of the Energy Policy Act of 2005. Qualified hydroelectric facilities-existing powered or non-powered dams and conduits...

  7. Fact #893: October 5, 2015 Incentives for the Installation of...

    Broader source: Energy.gov (indexed) [DOE]

    Incentives for the Installation of Electric Vehicle Charging Stations fotw893web.xlsx More Documents & Publications Richmond Electric Vehicle Initiative Electric Vehicle...

  8. Federal Tax Incentives for PV: Potential Implications for Program Design

    E-Print Network [OSTI]

    Wiser, Ryan; Bolinger, Mark

    2006-01-01

    Forthcoming. EPAct 2005s PV Tax Credits: What Are TheyAssumptions Installed PV system costs exhibit economies ofFederal Tax Incentives for PV Potential Implications for

  9. DEMEC Member Utilities- Green Energy Program Incentives (8 utilities)

    Office of Energy Efficiency and Renewable Energy (EERE)

    Delaware's municipal utilities provide incentives for solar photovoltaic (PV), solar thermal, wind, geothermal, and fuel cell systems installed by their electric customers. Eligibility is limited...

  10. Aligning Utility Incentives with Investment in Energy Efficiency...

    Open Energy Info (EERE)

    Aligning Utility Incentives with Investment in Energy Efficiency: A Resource of the National Action Plan for Energy Efficiency (United States) Jump to: navigation, search Tool...

  11. Local Incentive-Based Policy for Vegetable-Agroforestry: alocally...

    Open Energy Info (EERE)

    Local Incentive-Based Policy for Vegetable-Agroforestry: a locally-appropriate adaptation and mitigation action (LAAMA) to climate change Jump to: navigation, search Tool Summary...

  12. California Energy Incentive Programs An Annual Update on Key...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Issues and Financial Opportunities for Federal Sites in California California Energy Incentive Programs An Annual Update on Key Energy Issues and Financial Opportunities...

  13. DSM shareholder incentives: Current designs and economic theory

    SciTech Connect (OSTI)

    Stoft, S.; Eto, J.; Kito, S.

    1995-01-01

    This report reviews recent DSM shareholder incentive designs and performance at 10 US utilities identifies opportunities for regulators to improve the design of DSM shareholder incentive mechanisms to increase the procurement of cost-effective DSM resources. We develop six recommendations: (1) apply shared-savings incentives to DSM resource programs; (2) use markup incentives for individual programs only when net benefits are difficult to measure, but are known to be positive; (3) set expected incentive payments based on covering a utility`s {open_quotes}hidden costs,{close_quotes} which include some transitional management and risk-adjusted opportunity costs; (4) use higher marginal incentives rates than are currently found in practice, but limit total incentive payments by adding a fixed charge; (5) mitigate risks to regulators and utilities by lowering marginal incentive rates at high and low performance levels; and (6) use an aggregate incentive mechanism for all DSM resource programs, with limited exceptions (e.g., information programs where markups are more appropriate).

  14. Better Buildings: Financing and Incentives: Spotlight on Michigan...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    betterbuildings.energy.govneighborhoods 1 Spotlight on Michigan: Experiment to Find the Right Mix of Incentives With support from the U.S. Energy Department's Better Buildings...

  15. Incentive Peregrine s Incubator | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QAsource History View NewTexas: Energy ResourcesOrder at 8, 13 (Vt. Water Res. Bd. May,InThrMa Jump to:Incentive

  16. Performance-Based Incentive | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QAsource History ViewMayo, Maryland:NPIProtectio ProgramInformation 9thPerformance-Based Incentive Jump to:

  17. Hawaii/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LISTStar2-0057-EA JumpDuimen River Power CoHawaii/Incentives < Hawaii Jump to:

  18. Vermont/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to:EA EISTJThin FilmUnitedVairex CorporationVereniumVermont/Incentives <

  19. California/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmentalBowerbank, Maine:Kansas:Information 2ndCalifornia/Incentives < California Jump

  20. Florida/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX ECoopButtePowerEdistoWhiskey flatsInformation 7th congressionalFlorida/Incentives

  1. Green Building Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History View New Pages RecentPlantMagmaIncentives Jump to: navigation, search

  2. List of Daylighting Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives Jump to:Data

  3. List of Dishwasher Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives JumpDishwasher

  4. List of Doors Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives JumpDishwasherList of

  5. List of Furnaces Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipmentFuelFurnaces

  6. Minnesota/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to: navigation, search Name Minn-Dakota WindMinnesota/Incentives <

  7. Mississippi/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to: navigation, search NameMississippi/Incentives < Mississippi Jump to:

  8. Colorado/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX ECoopButtePower Ventures Jump to:Information 4thColorado/Incentives < Colorado

  9. Connecticut/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX ECoopButtePower Ventures JumpCommercialRenewable Services GmbHConnecticut/Incentives

  10. Corporate Tax Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX ECoopButtePower Ventures JumpCommercialRenewableGlobalTechnology VenturesPlusIncentives

  11. Nebraska/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to: navigation,National Marine FisheriesPolicy |Nebraska/Incentives <

  12. Nevada/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to: navigation,National MarineUSAID ClimateStateNevada/Incentives <

  13. New Jersey/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to: navigation,NationalJersey/Incentives < New Jersey Jump to:

  14. New York/Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsourceII Jump to:Information 3rd congressional district:York/Incentives < New York

  15. Ameren Illinois (Electric & Gas)- Multi-Family Properties Energy Efficiency Incentives

    Broader source: Energy.gov [DOE]

    The shell measure segment offers incentives for air sealing the shell of multifamily buildings. Incentives will be paid based on the total CFM reduction. Insulation incentives will be based on sq...

  16. Designing PV Incentive Programs to Promote System Performance: A Review of Current Practice

    E-Print Network [OSTI]

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2006-01-01

    Dan. 2006. Best Practices in PV Rebate Programs: Helpingprogram staff. Designing PV Incentive Programs to PromoteGroup), Mike Taylor Designing PV Incentive Programs to

  17. Financial Incentives Available for Facilities Affected by the US EPA Boiler MACT Proposed Rule, December 2012

    Broader source: Energy.gov [DOE]

    Overview of incentives for which larger boilers and then CHP systems qualify; Federal incentive programs are discussed and state, utility and local?level programs.

  18. Better Buildings- Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

    Broader source: Energy.gov [DOE]

    Better Buildings - Spotlight on Portland, Oregon; Financing and Incentives: Use Incentives to Get Attention and Encourage Deep Savings.

  19. Heat pipe array heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C. (Lafayette, NY)

    1987-08-25

    A heat pipe arrangement for exchanging heat between two different temperature fluids. The heat pipe arrangement is in a ounterflow relationship to increase the efficiency of the coupling of the heat from a heat source to a heat sink.

  20. Designing Effective Incentives to Drive Residential Retrofit Program Participation (Text Version)

    Broader source: Energy.gov [DOE]

    Transcript of the webinar, "Designing Effective Incentives to Drive Residential Retrofit Program Participation."

  1. SDG&E- New Construction Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    SDG&E offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new construction projects. A...

  2. Alliant Energy Interstate Power and Light- New Home Construction Incentives

    Broader source: Energy.gov [DOE]

    Interstate Power and Light's New Home Program gives incentives to builders and contractors who build energy efficient homes. A base rebate is available to those customers that make the minimum...

  3. SoCalGas- New Construction Advanced Homes Incentives

    Broader source: Energy.gov [DOE]

    SoCalGas offers an incentive for home builders to build homes which exceed 2008 Title 24 standards by 15%. The program is open to all single-family and multi-family new construction projects. A...

  4. Federal Fuel Cell Tax Incentives: An Investment in Clean and...

    Broader source: Energy.gov (indexed) [DOE]

    A brief created by the US Fuel Cell Council that covers federal fuel cell tax incentives 200810itc.pdf More Documents & Publications Fuel Cell Financing for Tax-Exempt Entities...

  5. Incentive Cost Recovery Rule for Nuclear Power Generation (Louisiana)

    Broader source: Energy.gov [DOE]

    The Incentive Cost Recovery Rule for Nuclear Power Generation establishes guidelines for any utility seeking to develop a nuclear power plant in Louisiana. The rule clarifies, as well as...

  6. Human capital, institutions, and incentives : micro and macro perspectives

    E-Print Network [OSTI]

    Gallego, Francisco A

    2006-01-01

    This dissertation consists of four essays on human capital, institutions, and incentives. In the first essay, I investigate the effects of voucher-school competition on educational outcomes in Chile. I present a theoretical ...

  7. The Role of Incentives in Promoting CHP Development

    E-Print Network [OSTI]

    Kaufman, N.; Elliot, R. N.

    2010-01-01

    financial incentives. ACEEE has collected data on state regulatory policies that suggest that states with a regulatory structure favorable to CHP have more implementation activity. The four regulatory factors that stick out are: 1) fair interconnection...

  8. Incentive zoning and environmental quality in Boston's Fenway neighborhood

    E-Print Network [OSTI]

    DeFlorio, Joshua (Joshua C.)

    2007-01-01

    A density bonus, also called incentive zoning, is a conditional liberalization of zoning regulations, allowing a real estate development to exceed as-of-right density limits in exchange for the in-kind provision or purchase ...

  9. Puerto Rico- Green Energy Fund Tier II Incentive Program

    Office of Energy Efficiency and Renewable Energy (EERE)

    NOTE: There is one application period per quarter. Applications must be submitted by the fifth day of each quarter (July 5, October 5, January 5, and April 5). Incentives are expected to be...

  10. EPAct 2005 Section 242 Hydroelectric Incentive Program- 2013 Electrical Production

    Broader source: Energy.gov [DOE]

    In 2014, Congress appropriated funds for Hydroelectric Production Incentives under Section 242 of the Energy Policy Act of 2005. Qualified hydroelectric facilitiesexisting powered or non-powered...

  11. Institutional Investors, Managerial Incentives, and Firms' Risk Profiles

    E-Print Network [OSTI]

    Celil, Hursit S

    2013-04-11

    In this dissertation, I study the influence of monitoring by institutional investors on corporate behavior within the context of CEO compensation-based incentives. I find that institutional investors provide an executive ...

  12. Short & long run transmission incentives for generation location

    E-Print Network [OSTI]

    Turvey, Ralph

    2006-01-01

    This paper is about one aspect of Britain's electricity trading system, its advantages and its weaknesses concerning the incentives it provides or fails to provide for the location of generation. (Similar considerations ...

  13. Recovery Act Incentives for Wind Energy Equipment Manufacturing

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to 30% of system costs is also available to individuals who purchase and install small wind energy systems. www.dsireusa.orgincentivesincentive. cfm?IncentiveCodeUS02F The...

  14. Innovation incentives and competition in the hard disk drive industry

    E-Print Network [OSTI]

    Wu, Xiaohua Sherry

    2011-01-01

    Firms in the hard disk drive industry are continually engaging in R & D and improving the quality of their products. We explore various determinants of the product innovation incentives for firms concerned with both their ...

  15. SRP- EarthWise Solar Energy Incentive Program

    Broader source: Energy.gov [DOE]

    '''''NOTE: SRP reopened its incentive programs effective May 1, 2013. SRP has funding available for 12 MW of residential photovoltaic (PV) systems, 4 MW of small commercial PV systems, 5 MW of...

  16. How unconventional gas prospers without tax incentives

    SciTech Connect (OSTI)

    Kuuskraa, V.A.; Stevens, S.H.

    1995-12-11

    It was widely believed that the development of unconventional natural gas (coalbed methane, gas shales, and tight gas) would die once US Sec. 29 credits stopped. Quieter voices countered, and hoped, that technology advances would keep these large but difficult to produce gas resources alive and maybe even healthy. Sec. 29 tax credits for new unconventional gas development stopped at the end of 1992. Now, nearly three years later, who was right and what has happened? There is no doubt that Sec. 29 tax credits stimulated the development of coalbed methane, gas shales, and tight gas. What is less known is that the tax credits helped spawn and push into use an entire new set of exploration, completion, and production technologies founded on improved understanding of unconventional gas reservoirs. As set forth below, while the incentives inherent in Sec. 29 provided the spark, it has been the base of science and technology that has maintained the vitality of these gas sources. The paper discusses the current status; resource development; technology; unusual production, proven reserves, and well completions if coalbed methane, gas shales, and tight gas; and international aspects.

  17. Incentive Pass-through for Residential Solar Systems in California

    Broader source: Energy.gov [DOE]

    The deployment of solar photovoltaic (PV) systems has grown rapidly over the last decade, partly because of various government incentives. In the United States, those established in California are among the largest and longest-running incentives. Building on past research, this report addresses the still-unanswered question: to what degree have the direct PV incentives in California been passed along from installers to consumers? This report addresses this question by carefully examining the residential PV market in California and applying both a structural-modeling approach and a reduced-form regression analysis to estimate the incentive pass-through rate. The results suggest an average pass-through rate of direct incentives of nearly 100%, but with regional differences among California counties. While these results could have multiple explanations, they suggest a relatively competitive market and well-functioning subsidy program. Further analysis is required to determine whether similar results broadly apply to other states, to other customer segments, to all third-party-owned PV systems, or to all forms of financial incentives for solar.

  18. Analysis of federal incentives used to stimulate energy consumption

    SciTech Connect (OSTI)

    Cole, R.J.; Cone, B.W.; Emery, J.C.; Huelshoff, M.; Lenerz, D.E.; Marcus, A.; Morris, F.A.; Sheppard, W.J.; Sommers, P.

    1981-08-01

    The purpose of the analysis is to identify and quantify Federal incentives that have increased the consumption of coal, oil, natural gas, and electricity. The introductory chapter is intended as a device for presenting the policy questions about the incentives that can be used to stimulate desired levels of energy development. In the theoretical chapter federal incentives were identified for the consumption of energy as Federal government actions whose major intent or result is to stimulate energy consumption. The stimulus comes through changing values of variables included in energy demand functions, thereby inducing energy consumers to move along the function in the direction of greater quantity of energy demanded, or through inducing a shift of the function to a position where more energy will be demanded at a given price. The demand variables fall into one of six categories: price of the energy form, price of complements, price of substitutes, preferences, income, and technology. The government can provide such incentives using six different policy instruments: taxation, disbursements, requirements, nontraditional services, traditional services, and market activity. The four major energy forms were examined. Six energy-consuming sectors were examined: residential, commercial, industrial, agricultural, transportation, and public. Two types of analyses of incentive actions are presented in this volume. The generic chapter focused on actions taken in 1978 across all energy forms. The subsequent chapters traced the patterns of incentive actions, energy form by energy form, from the beginning of the 20th century, to the present. The summary chapter includes the results of the previous chapters presented by energy form, incentive type, and user group. Finally, the implications of these results for solar policy are presented in the last chapter. (MCW)

  19. Process Integration- What is the Incentive?

    E-Print Network [OSTI]

    Declercq, D.; Kaibel, G.

    1985-01-01

    are studi ed. Recent research has 1ed to a better under standi ng concerni ng the optimum use of utilities and related capital and has introduced some fundamental principles when studying process modifications. Insight becomes usable for practical app 1... on the base of the whole process, since possible interactions are not always considered. Recent developments, particularly in the field of heat integration, have resulted in a systematic approach using methodical analysis. The methods used allow to carry...

  20. A primer on incentive regulation for electric utilities

    SciTech Connect (OSTI)

    Hill, L.J.

    1995-10-01

    In contemplating a regulatory approach, the challenge for regulators is to develop a model that provides incentives for utilities to engage in socially desirable behavior. In this primer, we provide guidance on this process by discussing (1) various models of economic regulation, (2) problems implementing these models, and (3) the types of incentives that various models of regulation provide electric utilities. We address five regulatory models in depth. They include cost-of-service regulation in which prudently incurred costs are reflected dollar-for-dollar in rates and four performance-based models: (1) price-cap regulation, in which ceilings are placed on the average price that a utility can charge its customers; (2) revenue-cap regulation, in which a ceiling is placed on revenues; (3) rate-of-return bandwidth regulation, in which a utility`s rates are adjusted if earnings fall outside a {open_quotes}band{close_quotes} around equity returns; and (4) targeted incentives, in which a utility is given incentives to improve specific components of its operations. The primary difference between cost-of-service and performance-based approaches is the latter sever the tie between costs and prices. A sixth, {open_quotes}mixed approach{close_quotes} combines two or more of the five basic ones. In the recent past, a common mixed approach has been to combine targeted incentives with cost-of-service regulation. A common example is utilities that are subject to cost-of-service regulation are given added incentives to increase the efficiency of troubled electric-generating units.

  1. Property:Incentive/Amt | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to: navigation,

  2. From prediction error to incentive salience: mesolimbic computation of reward motivation

    E-Print Network [OSTI]

    Berridge, Kent

    From prediction error to incentive salience: mesolimbic computation of reward motivation Kent C separable psychological components of learning, incentive motivation and pleasure. Most computational models have focused only on the learning component of reward, but the motivational component is equally

  3. Evaluation of the Landowner Incentive Program in Texas: 1997-2007

    E-Print Network [OSTI]

    Knipps, Anna

    2012-02-14

    The Landowner Incentive Program (LIP) was developed by the Texas Parks and Wildlife Department in 1997 in response to controversy and conflict between wildlife conservation agencies and landowners. The incentive was meant ...

  4. Designing PV Incentive Programs to Promote System Performance: A Review of Current Practice

    E-Print Network [OSTI]

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2006-01-01

    Solar Rebate Program Solar & Small Wind Incentive ProgramSolar Electric and Wind Program (Small PV Program) **

  5. Federal Register Notice EPAct 2005 Section 242 Hydroelectric Incentive Program: January 2015

    Broader source: Energy.gov [DOE]

    Federal Register Notice for the EPAct 2005 Section 242 Hydroelectric Incentive Program application period announcement: January, 2015.

  6. Social Game for Building Energy Efficiency: Incentive Design

    E-Print Network [OSTI]

    Sastry, S. Shankar

    consumption of buildings, both residential and commercial, accounts for approximately 40% of all energy usageSocial Game for Building Energy Efficiency: Incentive Design Lillian J. Ratliff, Ming Jin, Ioannis of a social game encouraging energy efficient behavior in occupants by dis- tributing points which determine

  7. Allocation of emission rights Economic incentives for emission

    E-Print Network [OSTI]

    Allocation of emission rights Economic incentives for emission reductions of CO2 in developing of Physical Resource Theory #12;CO2 per capita emissions in 1999 0 1 2 3 4 5 6 Population PercapitaCO2emissions(tonC/cap/yr) AFRICA CPA FAR EAST MEA OCEANIA WEU NAM FSU/ EEU WORLD AVERAGE LAM Department

  8. EWEB- Solar Electric Program (Performance-Based Incentive)

    Broader source: Energy.gov [DOE]

    The rebate for residential customers who choose to net meter is $1.70 per watt-AC, with a maximum incentive of $6,000. The rebate for commercial customers who choose to net meter is $1.00 per wat...

  9. COMPARING ALASKA'S OIL PRODUCTION TAXES: INCENTIVES AND ASSUMPTIONS1

    E-Print Network [OSTI]

    Pantaleone, Jim

    1 COMPARING ALASKA'S OIL PRODUCTION TAXES: INCENTIVES AND ASSUMPTIONS1 Matthew Berman In a recent analysis comparing the current oil production tax, More Alaska Production Act (MAPA, also known as SB 21 oil prices, production rates, and costs. He noted that comparative revenues are highly sensitive

  10. ANIMAL TRACING: BENEFITS IN CATTLE INDUSTRY AND PRIVATE INCENTIVES

    E-Print Network [OSTI]

    McCarl, Bruce A.

    ANIMAL TRACING: BENEFITS IN CATTLE INDUSTRY AND PRIVATE INCENTIVES LEVAN ELBAKIDZE Assistant are those of the author and not necessarily the sponsor." #12;ANIMAL TRACING: BENEFITS IN CATTLE INDUSTRY major economic damages in the cattle industry. One of the strategies to mitigate potential outbreak

  11. City of Pasadena This page outlines solar financing mechanisms, incentives, permitting process, and interconnection

    E-Print Network [OSTI]

    ://www.dsireusa.org/incentives/incentive.cfm?Incentive_Code=US02F&re=1 &ee=1 Third Party Ownership o Solar Power Purchase Agreements A Solar Power Purchase to Power Purchase Agreements in that a third party pays for and owns the system, but with this financing and Power. To skip directly to each section please use these hyperlinks: Find an Installer | Financing

  12. City of Santa Ana This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    ://www.dsireusa.org/incentives/incentive.cfm?Incentive_Code=U S02F&re=1&ee=1 Third Party Ownership o Solar Power Purchase Agreements A Solar Power Purchase to the host customer. o Solar Leases Solar Leases are similar to Power Purchase Agreements in that a third PV system to be interconnected to your utility's power grid California Solar Statistics provides

  13. City of Palm Desert This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    ://www.dsireusa.org/incentives/incentive.cfm?Incentive_Code=U S02F&re=1&ee=1 Third Party Ownership o Solar Power Purchase Agreements A Solar Power Purchase to the host customer. o Solar Leases Solar Leases are similar to Power Purchase Agreements in that a third PV system to be interconnected to your utility's power grid California Solar Statistics provides

  14. Economic Incentives of Providing Network Security Services Journal of Information Technology Management 1

    E-Print Network [OSTI]

    Chen, Li-Chiou

    Economic Incentives of Providing Network Security Services Journal of Information Technology Management 1 THE ECONOMIC INCENTIVES OF PROVIDING NETWORK SECURITY SERVICES ON THE INTERNET INFRASTRUCTURE Li in the economic incentives inherent in providing the defenses as well as uncertainty in current defenses. We

  15. Incentive Price Revision-Successive Targets UT-B Contracts Div Page 1 of 3

    E-Print Network [OSTI]

    Incentive Price Revision-Successive Targets UT-B Contracts Div Jan 2006 Page 1 of 3 incent-price-rev-suc-ext-utbx-jan06.doc INCENTIVE PRICE REVISION - SUCCESSIVE TARGETS (Jan 2006) (a) General. The supplies or services identified in the Agreement as item numbers ______ are subject to price revision in accordance

  16. Incentive Price Revision Firm Target UT-B Contracts Div Page 1 of 2

    E-Print Network [OSTI]

    Incentive Price Revision Firm Target UT-B Contracts Div Jan 2006 Page 1 of 2 incent-price-rev-firm-ext-utbx-jan06.doc INCENTIVE PRICE REVISION - FIRM TARGET (Jan 2006) (a) General. The supplies or services identified in the Agreement as item numbers __________ are subject to price revision in accordance

  17. International Microgrid Assessment: Governance, INcentives, and Experience (IMAGINE)

    E-Print Network [OSTI]

    Marnay, Chris

    2014-01-01

    building integrated PV, geothermal heat pumps, and biogasPV and thermal), biogas/biomass, hydropower, heat pumps (PV, wind, power electronics Needs Electrical storage (batteries, PEVs), solid Increased control CERTS, heterogeneous PQR (DC/AC) state switching, heat pumps,

  18. Analysis of the results of Federal incentives used to stimulate energy production

    SciTech Connect (OSTI)

    Cone, B.W.; Emery, J.C.; Fassbender, A.G.

    1980-06-01

    The research program analyzed the Federal incentives used to stimulate nuclear, hydro, coal, gas, oil, and electricity production in order to supply what was learned to the selection of an incentives strategy to induce new energy production from renewable resources. Following the introductory chapter, Chapter 2 examines the problem of estimating effects from a theoretical perspective. Methods of quantifying and identifying the many interactive effects of government actions are discussed. Chapter 3 presents a generic analysis of the result of Federal incentives. Chapters 4 through 9 deal with incentives to energy forms - nuclear, hydro, coal, oil, gas, and electricity. Chapter 10 summarizes the estimated results of the incentives, which are presented in terms of their quantity and price impacts. The incentive costs per million Btu of induced energy production is also discussed. Chapter 11 discusses the parity issue, that is an equivalence between Federal incentives to renewable resources and to traditional energy resources. Any analysis of incentives for solar needs will profit from an analysis of the costs of solar incentives per million Btu compared with those for traditional energy forms. Chapter 12 concludes the analysis, discussing the history of traditional energy incentives as a guide to solar-energy incentives. 216 references, 38 figures, 91 tables.

  19. Energy Incentive Programs, New Hampshire | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy Incentive Programs, New

  20. Energy Incentive Programs, New Jersey | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy Incentive Programs,

  1. Energy Incentive Programs, New Mexico | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy Incentive Programs,Mexico

  2. Energy Incentive Programs, New York | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy Incentive

  3. Energy Incentive Programs, North Carolina | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy IncentiveCarolina Energy

  4. Energy Incentive Programs, North Dakota | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeCommunication3-EDepartment ofArizona EnergyHampshire Energy IncentiveCarolina

  5. Energy Project Incentive Funds: Updates and Trends | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum12, 2015 Infographic courtesyEducation DataMay 24,Thursday,Project Incentive

  6. Alternative Fuels Data Center: Natural Gas Laws and Incentives

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels Data Center Home Page on Digglaws-incentivesFuels andNatural Gas Printable

  7. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,602 1,397...

  8. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All...

  9. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings ... 2,037...

  10. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,870 1,276...

  11. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings ... 636 580 46 1 Q 114.0...

  12. Susanville District Heating District Heating Low Temperature...

    Open Energy Info (EERE)

    Susanville District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Susanville District Heating District Heating Low Temperature...

  13. County of Los Angeles This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    ://www.dsireusa.org/incentives/incentive.cfm?Incentive_Code=U S02F&re=1&ee=1 Third Party Ownership o Solar Power Purchase Agreements A Solar Power Purchase to the host customer. o Solar Leases Solar Leases are similar to Power Purchase Agreements in that a third system Arrange for your PV system to be interconnected to your utility's power grid California Solar

  14. International Microgrid Assessment: Governance, INcentives, and Experience (IMAGINE)

    E-Print Network [OSTI]

    Marnay, Chris

    2014-01-01

    Biogas Solar Hot water/ice, rocks, concrete Batteries Lighting Life support Refrigeration Security Heating/Biogas Solar Hot water/ice, rocks, concrete Batteries Lighting Life support Refrigeration Security Heating/

  15. International Microgrid Assessment: Governance,INcentives, and Experience (IMAGINE)

    E-Print Network [OSTI]

    Romankiewicz, John

    2014-01-01

    Biogas Solar Hot water/ice, rocks, concrete Batteries Data center Lighting Life support Refrigeration Security Heating/

  16. Designing PV Incentive Programs to Promote System Performance: A Review of Current Practice

    E-Print Network [OSTI]

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2006-01-01

    communication with New York State Energy Research andSolar Pioneer Program New York Energy $mart PV IncentivePower Authority (LIPA) New York State Energy Research and

  17. Energy Smart Federal Partnership: Partnering to Provide Technical Assistance, Financial Incentives, and More

    Broader source: Energy.gov [DOE]

    Presentation covers technical and financial incentives for the Energy Smart Federal Partnership and is given at the Spring 2011 Federal Utility Partnership Working Group (FUPWG) meeting.

  18. Designing PV Incentive Programs to Promote Performance: A Review of Current Practice

    E-Print Network [OSTI]

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2007-01-01

    DESIGNING PV INCENTIVE PROGRAMS TO PROMOTE SYSTEMcustomer-sited photovoltaic (PV) systems, provided throughface to ensuring that their PV systems perform well, and the

  19. Incentive Thresholds, Risk-Taking, and Performance. Evidence from Hedge Funds

    E-Print Network [OSTI]

    Shelef, Orie

    2012-01-01

    term incentive plans. 2Taking Stock: Are Employee Optionspercentile of managers. 8Taking Stock: Are Employee OptionsCEO stock options on company risk-taking and performance.

  20. Microsoft PowerPoint - Wayne_Shirley_Overview_of_Incentives2008...

    Office of Environmental Management (EM)

    Presentation to the Kansas Corporation Commission E Effi i I i W k h Energy Efficiency Incentives Workshop August 26, 2008 Presented by The Regulatory Assistance Project...

  1. Cost Bases for Incentive Rates Applicable to Industrial Loads

    E-Print Network [OSTI]

    Stover, C. N.

    1987-01-01

    ; they involve a depressed economy base in all or certain segments of the service area, a decrease in load, excess generation capacity, and an increase in base rates. An increase in rates may also be related to the commercial operation of a base load unit, i... utility has completely abandoned a pricing structure that is in any way related to cost. Some of the incentive rates are very short lived and reflect transient economic conditions while others tend to reflect long-term economic relationships...

  2. Category:Lists for Incentive Types | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmentalBowerbank,CammackFLIR Jump to: navigation,Ground GravityLists for Incentive Types

  3. Category:Lists for Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmentalBowerbank,CammackFLIR Jump to: navigation,Ground GravityLists for Incentive

  4. Gateway:Incentives and Policies | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX ECoopButtePowerEdistoWhiskeyFootprintGEXA Corp.InformationtecnologíasIncentives and

  5. List of Compressed air Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives Jump to: navigation,

  6. List of Data Center Equipment Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives Jump to:Data Center

  7. List of Duct/Air sealing Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives JumpDishwasherList

  8. List of Equipment Insulation Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipment Insulation

  9. List of Evaporative Coolers Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipment InsulationList

  10. List of Food Service Equipment Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipment

  11. List of Fuel Cells Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipmentFuel Cells

  12. List of Fuel Cells using Renewable Fuels Incentives | Open Energy

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air IncentivesEquipmentFuel

  13. List of Refueling Stations Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of Refueling Stations Incentives

  14. List of Renewable Fuels Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of Refueling StationsIncentives

  15. List of Renewable Transportation Fuels Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressedList of Refueling StationsIncentivesList

  16. Incentive Fee Determination Summary Contractor: Washington Closure Hanford LLC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACT EVALUATION PLAN FOR THE SITE-218in a V2O5 Battery ElectrodeIncentive

  17. SEDS CSV File Documentation: Price and Expenditure

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming963 1.969 1.979 1.988 1.996 2.003 1990-2016 East)4.B.A.B.6.1.5. Unit

  18. International Microgrid Assessment. Governance, INcentives, and Experience (IMAGINE)

    SciTech Connect (OSTI)

    Marnay, Chris; Zhou, Nan; Qu, Min; Romankiewicz, John

    2012-06-01

    Microgrids can provide an avenue for increasing the amount of distributed generation and delivery of electricity, where control is more dispersed and quality of service is locally tailored to end-use requirements. Much of this functionality is very different from the predominant utility model to date of centralized power production which is then transmitted and distributed across long distances with a uniform quality of service. This different functionality holds much promise for positive change, in terms of increasing reliability, energy efficiency, and renewable energy while decreasing and carbon emissions. All of these functions should provide direct cost savings for customers and utilities as well as positive externalities for society. As we have seen from the international experience, allowing microgrids to function in parallel with the grid requires some changes in electricity governance and incentives to capture cost savings and actively price in positive externalities. If China can manage to implement these governance changes and create those incentive policies, it will go beyond the establishment of a successful microgrid demonstration program and become an international leader in microgrid deployment.

  19. Role of joule heating effect and bulk-surface phases in voltage...

    Office of Scientific and Technical Information (OSTI)

    Format Close Chicago Cite: Chicago Format Close Bibtex Cite: Bibtex Format Close Export Metadata EndNote Excel CSV XML Save Share this Record Send to Email Send to Email...

  20. Price Incentives for Fuel Switching: Did Price Differences Slow the Phase-Out of Leaded

    E-Print Network [OSTI]

    California at Berkeley. University of

    the potential eects of price incentives on the fuel switching process. In the U.S., these eects have beenPWP-010 Price Incentives for Fuel Switching: Did Price Differences Slow the Phase-Out of Leaded on Workable Energy Regulation (POWER). POWER is a program of the University of California Energy Institute

  1. Not Just a TRIP! Two Cases of Business Strategy and Economic Incentives to Patent in Beijing

    E-Print Network [OSTI]

    Sadoulet, Elisabeth

    Not Just a TRIP! Two Cases of Business Strategy and Economic Incentives to Patent in Beijing Senior! Corporate Strategies and National Incentives to Patent in Beijing ABSTRACT In order to explore the utilization of IP law in Beijing, I have conducted quantitative analyses of the propensity to patent (using

  2. A Privacy-Preserving Scheme for Incentive-Based Demand Response in the Smart Grid

    E-Print Network [OSTI]

    Fang, Yuguang "Michael"

    1 A Privacy-Preserving Scheme for Incentive-Based Demand Response in the Smart Grid Yanmin Gong to both grid operators and customers, exploiting the full potential of demand response. However to be attributable to individuals. However, this assumption does not hold in incentive-based demand response (IDR

  3. New Appliance Tax Credits, Rebates, and Incentives for Consumers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    air conditioners Clothes washers Dishwashers Freezers Furnaces (oil and gas) Heat pumps (air source and geothermal) Refrigerators Room air conditioners Water heaters State...

  4. The incentives and disincentives of innovation prizes : a survey of the dropout teams from Progressive Insurance Automotive X PRIZE

    E-Print Network [OSTI]

    Bhushan, Bharat, S.M. Massachusetts Institute of Technology

    2010-01-01

    Technological innovation is driven by incentives. However, our understanding of how incentives actually work "on the ground" to change the level of activity of innovators or to shape the direction of their innovation is ...

  5. Designing PV Incentive Programs to Promote Performance: A Review of Current Practice in the U.S.

    E-Print Network [OSTI]

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2008-01-01

    Solar Rebate Program Solar & Small Wind Incentive ProgramSolar Electric and Wind Program (Small PV Program)

  6. Heat collector

    DOE Patents [OSTI]

    Merrigan, M.A.

    1981-06-29

    A heat collector and method suitable for efficiently and cheaply collecting solar and other thermal energy are provided. The collector employs a heat pipe in a gravity-assist mode and is not evacuated. The collector has many advantages, some of which include ease of assembly, reduced structural stresses on the heat pipe enclosure, and a low total materials cost requirement. Natural convective forces drive the collector, which after startup operates entirely passively due in part to differences in molecular weights of gaseous components within the collector.

  7. Heat collector

    DOE Patents [OSTI]

    Merrigan, Michael A. (Santa Cruz, NM)

    1984-01-01

    A heat collector and method suitable for efficiently and cheaply collecting solar and other thermal energy are provided. The collector employs a heat pipe in a gravity-assist mode and is not evacuated. The collector has many advantages, some of which include ease of assembly, reduced structural stresses on the heat pipe enclosure, and a low total materials cost requirement. Natural convective forces drive the collector, which after startup operates entirely passively due in part to differences in molecular weights of gaseous components within the collector.

  8. Corrosive resistant heat exchanger

    DOE Patents [OSTI]

    Richlen, Scott L. (Annandale, VA)

    1989-01-01

    A corrosive and errosive resistant heat exchanger which recovers heat from a contaminated heat stream. The heat exchanger utilizes a boundary layer of innocuous gas, which is continuously replenished, to protect the heat exchanger surface from the hot contaminated gas. The innocuous gas is conveyed through ducts or perforations in the heat exchanger wall. Heat from the heat stream is transferred by radiation to the heat exchanger wall. Heat is removed from the outer heat exchanger wall by a heat recovery medium.

  9. Understanding the Complexities of Subnational Incentives in Supporting a National Market for Distributed Photovoltaics

    SciTech Connect (OSTI)

    Bush, B.; Doris, E.; Getman, D.

    2014-09-01

    Subnational policies pertaining to photovoltaic (PV) systems have increased in volume in recent years and federal incentives are set to be phased out over the next few. Understanding how subnational policies function within and across jurisdictions, thereby impacting PV market development, informs policy decision making. This report was developed for subnational policy-makers and researchers in order to aid the analysis on the function of PV system incentives within the emerging PV deployment market. The analysis presented is based on a 'logic engine,' a database tool using existing state, utility, and local incentives allowing users to see the interrelationships between PV system incentives and parameters, such as geographic location, technology specifications, and financial factors. Depending on how it is queried, the database can yield insights into which combinations of incentives are available and most advantageous to the PV system owner or developer under particular circumstances. This is useful both for individual system developers to identify the most advantageous incentive packages that they qualify for as well as for researchers and policymakers to better understand the patch work of incentives nationwide as well as how they drive the market.

  10. Distributed Solar Incentive Programs: Recent Experience and Best Practices for Design and Implementation

    SciTech Connect (OSTI)

    Bird, L.; Reger, A.; Heeter, J.

    2012-12-01

    Based on lessons from recent program experience, this report explores best practices for designing and implementing incentives for small and mid-sized residential and commercial distributed solar energy projects. The findings of this paper are relevant to both new incentive programs as well as those undergoing modifications. The report covers factors to consider in setting and modifying incentive levels over time, differentiating incentives to encourage various market segments, administrative issues such as providing equitable access to incentives and customer protection. It also explores how incentive programs can be designed to respond to changing market conditions while attempting to provide a longer-term and stable environment for the solar industry. The findings are based on interviews with program administrators, regulators, and industry representatives as well as data from numerous incentive programs nationally, particularly the largest and longest-running programs. These best practices consider the perspectives of various stakeholders and the broad objectives of reducing solar costs, encouraging long-term market viability, minimizing ratepayer costs, and protecting consumers.

  11. ABSORPTION HEAT PUMP IN THE DISTRICT HEATING

    E-Print Network [OSTI]

    Oak Ridge National Laboratory

    #12;ABSORPTION HEAT PUMP IN THE DISTRICT HEATING PLANT Dr.sc.ing. Agnese Lickrastina M.Sc. Normunds European Heat Pump Summit 2013, Nuremberg, 15-16.10.2013 Riga District Heating company Operation of the DH plant Imanta Selection of the heat pump/chiller Operation of the heat pump/chiller Summary

  12. Utility and State Industrial Efficient Motors Systems Incentives Programs: Experience and Success Factors

    E-Print Network [OSTI]

    Roop, J. M.; Stucky, D. J.

    1993-01-01

    This paper summarizes the results of a survey of utility and state demand-side management (DSM) programs that address efficient motor systems (EMS). The paper discusses the incentive structures in place at the state and utility level to encourage...

  13. Country Review of Energy-Efficiency Financial Incentives in the Residential Sector

    E-Print Network [OSTI]

    Can, Stephane de la Rue du

    2011-01-01

    of State Incentives for Renewable Energy. www.dsireusa.orgbe used to finance renewable-energy and energy-efficiencyfor a broad range of renewable energy and energy-efficiency

  14. Incentive Mechanisms for Internet Congestion Management: Fixed-Budget Rebate Versus Time-of-Day Pricing

    E-Print Network [OSTI]

    Loiseau, Patrick

    Mobile data traffic has been steadily rising in the past years. This has generated a significant interest in the deployment of incentive mechanisms to reduce peak-time congestion. Typically, the design of these mechanisms ...

  15. City of Anaheim This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    City of Anaheim This page outlines solar PV incentives, financing mechanisms, permitting process Apply for local permits Install your PV system Arrange for your PV system to be interconnected to your

  16. Cost trends and government incentives in the California photovoltaics market, 2007-2008

    E-Print Network [OSTI]

    Wang Yan, S.B. Massachusetts Institute of Technology

    2009-01-01

    The focus of this thesis is to analyze cost trends and government incentives in the California PV market during 2007-2008. The data show that pre-rebate system costs increased in California during this time period and that ...

  17. Agency and incentive contract in private investment of transport project : an exploration of fundamental relationships

    E-Print Network [OSTI]

    Chiang, Risharng

    2002-01-01

    This thesis codifies and relates critical incentive-design and financial-contracting issue to the unique principal-agent circumstances generated from private investment of transport infrastructure and provides a framework ...

  18. Incentive-based approaches for mitigating greenhouse gas emissions : issues and prospects for India

    E-Print Network [OSTI]

    Gupta, Shreekant.

    As a consequence of the flexibility mechanisms incorporated in the Kyoto Protocol, incentive-based policies such as emissions trading and the clean development mechanism are being widely discussed in the context of greenhouse ...

  19. Incentive regulation in theory and practice : electricity distribution and transmission networks

    E-Print Network [OSTI]

    Joskow, Paul L.

    2005-01-01

    Modern theoretical principles to govern the design of incentive regulation mechanisms are reviewed and discussed. General issues associated with applying these principles in practice are identified. Examples of the actual ...

  20. Efficiency of incentives to jointly increase carbon sequestration and species conservation

    E-Print Network [OSTI]

    Thomas, David D.

    Efficiency of incentives to jointly increase carbon sequestration and species conservation the provision of carbon sequestration and species conservation across heterogeneous landscapes. Using data from the Willamette Basin, Oregon, we compare the provision of carbon sequestration and species conservation under

  1. Incentive mechanisms as a strategic option for acid rain compliance

    SciTech Connect (OSTI)

    South, D.W.; Bailey, K.A.; McDermott, K.A.

    1991-01-01

    Title IV of the Clean Air Act Amendments (CAAA) of 1990 (P.L. 101--549) establishes the use of flexible emission compliance strategies for electric utilities to reduce the emissions of add precursors (SO[sub 2], NO[sub 2]). To control SO[sub 2] emissions, tradeable emission allowances will be used; NO[sub 2] emissions will be controlled by an emission standard, but a utility is permitted to average NO[sub 2] emissions systemwide to meet the standard. Both of these policies promote flexibility and cost savings for the utility while achieving the prescribed emission reduction goals of P.L. 101--549. The use of SO[sub 2] emission allowances has two notable benefits: A utility has the choice of a wide range of compliance methods allowing it to minimize compliance costs and second; the use of transferable emission allowances promote technological innovation with respect to emissions reduction/control. This report discusses the use of regulatory incentives towards the achievement of a Title IV goal of cost reduction of SO[sub 2] emissions.

  2. Incentive mechanisms as a strategic option for acid rain compliance

    SciTech Connect (OSTI)

    South, D.W.; Bailey, K.A.; McDermott, K.A.

    1991-12-31

    Title IV of the Clean Air Act Amendments (CAAA) of 1990 (P.L. 101--549) establishes the use of flexible emission compliance strategies for electric utilities to reduce the emissions of add precursors (SO{sub 2}, NO{sub 2}). To control SO{sub 2} emissions, tradeable emission allowances will be used; NO{sub 2} emissions will be controlled by an emission standard, but a utility is permitted to average NO{sub 2} emissions systemwide to meet the standard. Both of these policies promote flexibility and cost savings for the utility while achieving the prescribed emission reduction goals of P.L. 101--549. The use of SO{sub 2} emission allowances has two notable benefits: A utility has the choice of a wide range of compliance methods allowing it to minimize compliance costs and second; the use of transferable emission allowances promote technological innovation with respect to emissions reduction/control. This report discusses the use of regulatory incentives towards the achievement of a Title IV goal of cost reduction of SO{sub 2} emissions.

  3. United States/Mexico electricity exchanges. [History, incentives, and constraints

    SciTech Connect (OSTI)

    None,

    1980-05-01

    As a result of the agreement between the respective presidents, a joint study was undertaken to analyze the possibilities of increasing the international electricity exchange between the two countries. Responsibility for this undertaking was assigned to the United States Department of Energy (DOE) and to the Direccion de Energia de Mexico (DEM) through the Comision Federal de Electricidad (CFE). Representatives from Mexico and the US were chosen from the regional utilities along the border between the two countries and made up working groups that particiated in the study. With the support of both governments, and a high degree of cooperation between the two countries, work on the study was completed within fourteen months The completion of the study has been a major step in broadening the base of bilateral energy relations. the study highlights the opportunities for increased electricity exchanges, which could increase cooperation along the common border. Expansion of electricity interchange could offer substantial economic benefit to both countries, both directly and indirectly. Direct benefits include increased reliability of electric power and cost savings through economies of scale and diversity of peak demand patterns. Indirect benefits include improved economic and employment opportunities, especially in the border areas of both countries. This report provides background on the history of past exchanges and the characteristics of the US and Mexico electric systems, a summary of opportunities and incentives, and suggestions for procedures to remove obstacles and constraints.

  4. Bayonet heat exchangers in heat-assisted Stirling heat pump

    SciTech Connect (OSTI)

    Yagyu, S.; Fukuyama, Y.; Morikawa, T.; Isshiki, N.; Satoh, I.; Corey, J.; Fellows, C.

    1998-07-01

    The Multi-Temperature Heat Supply System is a research project creating a city energy system with lower environmental load. This system consists of a gas-fueled internal combustion engine and a heat-assisted Stirling heat pump utilizing shaft power and thermal power in a combination of several cylinders. The heat pump is mainly driven by engine shaft power and is partially assisted by thermal power from engine exhaust heat source. Since this heat pump is operated by proportioning the two energy sources to match the characteristics of the driving engine, the system is expected to produce cooling and heating water at high COP. This paper describes heat exchanger development in the project to develop a heat-assisted Stirling heat pump. The heat pump employs the Bayonet type heat exchangers (BHX Type I) for supplying cold and hot water and (BHX Type II) for absorbing exhaust heat from the driving engine. The heat exchanger design concepts are presented and their heat transfer and flow loss characteristics in oscillating gas flow are investigated. The main concern in the BHX Type I is an improvement of gas side heat transfer and the spirally finned tubes were applied to gas side of the heat exchanger. For the BHX Type II, internal heat transfer characteristics are the main concern. Shell-and-tube type heat exchangers are widely used in Stirling machines. However, since brazing is applied to the many tubes for their manufacturing processes, it is very difficult to change flow passages to optimize heat transfer and loss characteristics once they have been made. The challenge was to enhance heat transfer on the gas side to make a highly efficient heat exchanger with fewer parts. It is shown that the Bayonet type heat exchanger can have good performance comparable to conventional heat exchangers.

  5. Heating System Specification Specification of Heating System

    E-Print Network [OSTI]

    Day, Nancy

    Appendix A Heating System Specification /* Specification of Heating System (loosely based */ requestHeat : Room ­? bool; 306 #12; APPENDIX A. HEATING SYSTEM SPECIFICATION 307 /* user inputs */ living --- HEATER??ACTIVE --- ACTIVATING??HEATER --- HEATER??RUNNING ; #12; APPENDIX A. HEATING SYSTEM SPECIFICATION

  6. Opportunities and Incentives for CHP in Massachusetts June 19, 2013

    E-Print Network [OSTI]

    Massachusetts at Amherst, University of

    to energy fuels, clean power generation, and solar power plant construction Investing in Cleaner Power and residential portfolio on four continents Renewable Energy: Ownership of solar, wind, biomass and other power-site combined heat and power ("CHP") and renewable energy solutions such as solar power to facility owners

  7. SMALL PARTICLE HEAT EXCHANGERS

    E-Print Network [OSTI]

    Hunt, A.J.

    2011-01-01

    The Small Particle Heat Exchange Receiver (SPHER) for Solarof the small particle heat exchange receiver (or SPHER), asabsorption process, the heat exchange to the gas, the choice

  8. Heat pump system

    DOE Patents [OSTI]

    Swenson, Paul F. (Cleveland, OH); Moore, Paul B. (Fedhaurn, FL)

    1982-01-01

    An air heating and cooling system for a building includes an expansion-type refrigeration circuit and a heat engine. The refrigeration circuit includes two heat exchangers, one of which is communicated with a source of indoor air from the building and the other of which is communicated with a source of air from outside the building. The heat engine includes a heat rejection circuit having a source of rejected heat and a primary heat exchanger connected to the source of rejected heat. The heat rejection circuit also includes an evaporator in heat exchange relation with the primary heat exchanger, a heat engine indoor heat exchanger, and a heat engine outdoor heat exchanger. The indoor heat exchangers are disposed in series air flow relationship, with the heat engine indoor heat exchanger being disposed downstream from the refrigeration circuit indoor heat exchanger. The outdoor heat exchangers are also disposed in series air flow relationship, with the heat engine outdoor heat exchanger disposed downstream from the refrigeration circuit outdoor heat exchanger. A common fluid is used in both of the indoor heat exchanges and in both of the outdoor heat exchangers. In a first embodiment, the heat engine is a Rankine cycle engine. In a second embodiment, the heat engine is a non-Rankine cycle engine.

  9. Water and Space Heating Heat Pumps

    E-Print Network [OSTI]

    Kessler, A. F.

    1985-01-01

    This paper discusses the design and operation of the Trane Weathertron III Heat Pump Water Heating System and includes a comparison of features and performance to other domestic water heating systems. Domestic water is generally provided through...

  10. Industrial Waste Heat Recovery Using Heat Pipes

    E-Print Network [OSTI]

    Ruch, M. A.

    1981-01-01

    For almost a decade now, heat pipes with secondary finned surfaces have been utilized in counter flow heat exchangers to recover sensible energy from industrial exhaust gases. Over 3,000 such heat exchangers are now in service, recovering...

  11. Heating systems for heating subsurface formations

    DOE Patents [OSTI]

    Nguyen, Scott Vinh (Houston, TX); Vinegar, Harold J. (Bellaire, TX)

    2011-04-26

    Methods and systems for heating a subsurface formation are described herein. A heating system for a subsurface formation includes a sealed conduit positioned in an opening in the formation and a heat source. The sealed conduit includes a heat transfer fluid. The heat source provides heat to a portion of the sealed conduit to change phase of the heat transfer fluid from a liquid to a vapor. The vapor in the sealed conduit rises in the sealed conduit, condenses to transfer heat to the formation and returns to the conduit portion as a liquid.

  12. Heat transfer and heat exchangers reference handbook

    SciTech Connect (OSTI)

    Not Available

    1991-01-15

    The purpose of this handbook is to provide Rocky Flats personnel with an understanding of the basic concepts of heat transfer and the operation of heat exchangers.

  13. Integrated heat pump and heat storage system

    SciTech Connect (OSTI)

    Katz, A.

    1983-09-13

    An integrated heat pump and heat storage system is disclosed comprising a heat pump, a first conduit for supplying return air from an enclosure to the heat pump, a second conduit for supplying heated air from the heat pump to the enclosure, heat storage apparatus. A first damper is operative in a first orientation to permit return air from the enclosure to enter the first conduit and to prevent return air from passing through the heat storage apparatus and operative in a second orientation to cause return air to pass through the heat storage apparatus for being heated thereby before entering the first conduit. A second damper is operative in a first orientation to cause heated air from the second conduit to pass through the heat storage apparatus for giving up a portion of its heat for storage and operative in a second orientation to prevent heated air from the second conduit from passing through the heat storage apparatus and to permit the heated air from the second conduit to reach the enclosure. The heat storage apparatus may comprise phase change materials.

  14. An analysis of cost effective incentives for initial commercial deployment of advanced clean coal technologies

    SciTech Connect (OSTI)

    Spencer, D.F. [SIMTECHE, Half Moon Bay, CA (United States)

    1997-12-31

    This analysis evaluates the incentives necessary to introduce commercial scale Advanced Clean Coal Technologies, specifically Integrated Coal Gasification Combined Cycle (ICGCC) and Pressurized Fluidized Bed Combustion (PFBC) powerplants. The incentives required to support the initial introduction of these systems are based on competitive busbar electricity costs with natural gas fired combined cycle powerplants, in baseload service. A federal government price guarantee program for up to 10 Advanced Clean Coal Technology powerplants, 5 each ICGCC and PFBC systems is recommended in order to establish the commercial viability of these systems by 2010. By utilizing a decreasing incentives approach as the technologies mature (plants 1--5 of each type), and considering the additional federal government benefits of these plants versus natural gas fired combined cycle powerplants, federal government net financial exposure is minimized. Annual net incentive outlays of approximately 150 million annually over a 20 year period could be necessary. Based on increased demand for Advanced Clean Coal Technologies beyond 2010, the federal government would be revenue neutral within 10 years of the incentives program completion.

  15. Dual source heat pump

    DOE Patents [OSTI]

    Ecker, Amir L. (Dallas, TX); Pietsch, Joseph A. (Dallas, TX)

    1982-01-01

    What is disclosed is a heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating the fluid in heat exchange relationship with a refrigerant fluid; at least two refrigerant heat exchangers, one for effecting heat exchange with the fluid and a second for effecting heat exchange between refrigerant and a heat exchange fluid and the ambient air; a compressor for efficiently compressing the refrigerant; at least one throttling valve for throttling liquid refrigerant; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circulating device and heat exchange fluid circuit for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and direction of flow of the refrigerant therethrough for selecting a particular mode of operation. The heat exchange fluid provides energy for defrosting the second heat exchanger when operating in the air source mode and also provides a alternate source of heat.

  16. Renewable Energy Cost Modeling. A Toolkit for Establishing Cost-Based Incentives in the United States

    SciTech Connect (OSTI)

    Gifford, Jason S.; Grace, Robert C.; Rickerson, Wilson H.

    2011-05-01

    This report serves as a resource for policymakers who wish to learn more about levelized cost of energy (LCOE) calculations, including cost-based incentives. The report identifies key renewable energy cost modeling options, highlights the policy implications of choosing one approach over the other, and presents recommendations on the optimal characteristics of a model to calculate rates for cost-based incentives, FITs, or similar policies. These recommendations shaped the design of NREL's Cost of Renewable Energy Spreadsheet Tool (CREST), which is used by state policymakers, regulators, utilities, developers, and other stakeholders to assist with analyses of policy and renewable energy incentive payment structures. Authored by Jason S. Gifford and Robert C. Grace of Sustainable Energy Advantage LLC and Wilson H. Rickerson of Meister Consultants Group, Inc.

  17. Examination of incentive mechanisms for innovative technologies applicable to utility and nonutility power generators

    SciTech Connect (OSTI)

    McDermott, K.A. [Illinois Commerce Commission, Springfield, IL (United States); Bailey, K.A.; South, D.W. [Argonne National Lab., IL (United States). Environmental Assessment and Information Sciences Div.

    1993-08-01

    Innovative technologies, built by either utility or nonutility power generators, have the potential to lower costs with less environmental emissions than conventional technologies. However, the public-good nature of information, along with uncertain costs, performance, and reliability, discourages rapid adoption of these technologies. The effect of regulation of electricity production may also have an adverse impact on motivation to innovate. Slower penetration of cleaner, more efficient technologies could result in greater levels of pollution, higher electricity prices, and a reduction in international competitiveness. Regulatory incentives could encourage adoption and deployment of innovative technologies of all kinds, inducting clean coal technologies. Such incentives must be designed to offset risks inherent in innovative technology and encourage cost-effective behavior. To evaluate innovative and conventional technologies equally, the incremental cost of risk (ICR) of adopting the innovative technology must be determined. Through the ICR, the magnitude of incentive required to make a utility (or nonutility) power generator equally motivated to use either conventional or innovative technologies can be derived. Two technology risks are examined: A construction risk, represented by a 15% cost overrun, and an operating risk, represented by a increased forced outage rate (decreased capacity factor). Different incentive mechanisms and measurement criteria are used to assess the effects of these risks on ratepayers and shareholders. In most cases, a regulatory incentive could offset the perceived risks while encouraging cost-effective behavior by both utility and nonutility power generators. Not only would the required incentive be recouped, but the revenue requirements would be less for the innovative technology; also, less environmental pollution would be generated. In the long term, ratepayers and society would benefit from innovative technologies.

  18. Property:Incentive/AddlPlace | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSource JumpWho Bought

  19. Property:Incentive/AddlPlaceCity | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSource JumpWho

  20. Property:Incentive/AddlPlaceCounty | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSource JumpWhoAddlPlaceCounty

  1. Property:Incentive/AddlPlaceUtility | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSource

  2. Property:Incentive/Auth10Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to:

  3. Property:Incentive/Auth11Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to:1Link Jump to:

  4. Property:Incentive/Auth13Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to:1Link Jump

  5. Property:Incentive/Auth14Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to:1Link

  6. Property:Incentive/Auth15Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump to:1Link5Link

  7. Property:Incentive/Auth16Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump

  8. Property:Incentive/Auth17Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump7Link Jump to:

  9. Property:Incentive/Auth2Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump7Link Jump

  10. Property:Incentive/Auth3Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump7Link

  11. Property:Incentive/Auth4Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt Jump7LinkAuth4Link

  12. Property:Incentive/Auth5Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmt

  13. Property:Incentive/Auth6Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmtAuth6Link Jump to:

  14. Property:Incentive/Auth7Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmtAuth6Link Jump

  15. Property:Incentive/Auth8Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmtAuth6Link JumpAuth8Link

  16. Property:Incentive/Auth9Link | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmtAuth6Link

  17. Property:Incentive/AuthDtEnact | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to: navigation,PropertyPartner7Website JumpHeatSourceAmtAuth6LinkAuthDtEnact

  18. Impact of Direct Financial Incentives in the Emerging Battery Electric Vehicle Market: A Preliminary Analysis

    Broader source: Energy.gov [DOE]

    This study addresses the question What is the impact of state-level electric vehicle incentives on electric vehicle adoption?. It focus on rebates, tax credits, and HOV-lane access for battery electric vehicles (BEVs) but also examines the influence of public BEV charging infrastructure on BEV adoption so far. The analysis uses state-level, temporal variation in BEV incentives to identify variation in BEV registrations through econometric methods. This presentation will review initial findings of the project and gather your feedback on future research needs.

  19. EPA Clean Energy Incentive Program Stakeholder Calls- Potential CEIP Project Partners

    Broader source: Energy.gov [DOE]

    The U.S. Environmental Protection Agency (EPA) is inviting participants to a stakeholder call to gather input and ideas about the Clean Energy Incentive Program (CEIP), a Clean Power Plan program designed to provide additional incentives for early investments in zero-emitting wind or solar power projects as well as in energy efficiency measures in low-income communities. This call will focus on hearing ideas and input from groups that have a general interest in CEIP projects, such as environmental justice groups, community groups, local governments, tribes, and environmental non-governmental organizations.

  20. Do Generation Firms in Restructured Electricity Markets Have Incentives to Support Social-Welfare-Improving Transmission Investments? *

    E-Print Network [OSTI]

    Oren, Shmuel S.

    Transmission Grid Study of the U.S. Department of Energy (Abraham, 2002) declares: "Growth in electricity of incentives for investment in the U.S. electricity transmission system are sparse. Moreover, noneDo Generation Firms in Restructured Electricity Markets Have Incentives to Support Social

  1. National Grid (Gas)- Residential Gas Heating Rebate Programs

    Broader source: Energy.gov [DOE]

    National Grid offers financial incentives for various energy efficiency measures in Rhode Island homes. Incentives are available for deep energy retrofit, heaters, furnaces, boilers, and others....

  2. Multiple source heat pump

    DOE Patents [OSTI]

    Ecker, Amir L. (Duncanville, TX)

    1983-01-01

    A heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating a fluid in heat exchange relationship with a refrigerant fluid, at least three refrigerant heat exchangers, one for effecting heat exchange with the fluid, a second for effecting heat exchange with a heat exchange fluid, and a third for effecting heat exchange with ambient air; a compressor for compressing the refrigerant; at least one throttling valve connected at the inlet side of a heat exchanger in which liquid refrigerant is vaporized; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circuit and pump for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and directional flow of refrigerant therethrough for selecting a particular mode of operation. Also disclosed are a variety of embodiments, modes of operation, and schematics therefor.

  3. Heat Plan DenmarkHeat Plan Denmark Anders Dyrelundy

    E-Print Network [OSTI]

    efficient use of renewable energy in district heating individual heat pumps solar heating and wood pellets individual heat pumps, solar heating and wood pellets 6Ris International Energy Conference 2009Heat Plan

  4. Heat Exchangers for Solar Water Heating Systems | Department...

    Energy Savers [EERE]

    Heat Exchangers for Solar Water Heating Systems Heat Exchangers for Solar Water Heating Systems Image of a heat exchanger. | Photo from iStockphoto.com Image of a heat exchanger. |...

  5. Heat-Of-Reaction Chemical Heat Pumps--Possible Configurations

    E-Print Network [OSTI]

    Kirol, L. D.

    1986-01-01

    Chemical heat pumps utilize working fluids which undergo reversible chemical changes. Mechanically driven reactive heat pump cycles or, alternatively, heat driven heat pumps in which either heat engine or heat pump ...

  6. Introduction to Heat Exchangers

    E-Print Network [OSTI]

    Heller, Barbara

    . Since, the effectiveness can be written in terms of heat capacitance rate [W/K], C, and change in temperature [K], . The heat capacitance rate is defined in terms of mass flow rate [kg/s], , and specific heat: ! ! ! " # = ! ! "# ! ! ! - ! ! ! ! ! ! = ! !! ! ! ! ! = ! ! ! ! ! - ! ! ! ! ! "# ! ! ! - ! ! ! ! ! ! = ! ! ! ! ! - ! ! ! ! ! "# ! ! ! - ! ! ! ! ! Heat%Capacitance%Rate % ! = ! !! ! ! Heat%Capacitance%Rate%[W % ! = ! ! ! ! ! ! ! = ! ! !! ! ! ! max

  7. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Environmental Management (EM)

    todesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Better Buildings: Financing and Incentives: Spotlight on Maine: Transition to a Sustainable Level of Incentives...

  8. City of Palmdale This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    ) Programs o Commercial PACE The Los Angeles County PACE program offers funding for nonresidential solarCity of Palmdale This page outlines solar PV incentives, financing mechanisms, permitting process solar energy system for your home or business. o Typically solar installers will: Locate financing

  9. City of Long Beach This page outlines solar PV incentives, financing mechanisms, permitting process, and

    E-Print Network [OSTI]

    ) Programs o Commercial PACE The Los Angeles County PACE program offers funding for nonresidential solarCity of Long Beach This page outlines solar PV incentives, financing mechanisms, permitting process;Find an Installer Qualified contractors are your key to getting the most productive solar energy

  10. City of Santa Monica This page outlines solar PV incentives, financing mechanisms, permitting process, and interconnection

    E-Print Network [OSTI]

    ) Programs o Commercial PACE The Los Angeles County PACE program offers funding for nonresidential solarCity of Santa Monica This page outlines solar PV incentives, financing mechanisms, permitting contractors are your key to getting the most productive solar energy system for your home or business. o

  11. The effect of giving explicit incentives to correct mistakes on subsequent problem solving in quantum mechanics

    E-Print Network [OSTI]

    Brown, Benjamin; Singh, Chandralekha

    2015-01-01

    One attribute of experts is that they are likely to learn from their own mistakes. Experts are unlikely to make the same mistakes when asked to solve a problem a second time, especially if they had access to a correct solution. Here, we discuss a study spanning several years in which advanced undergraduate physics students in a quantum mechanics course were given incentives to correct their mistakes in the midterm exam and they could get back up to 50% of the points lost on each midterm exam problem. The solutions to the midterm exam problems were provided to all students in both groups but those who corrected their mistakes were provided the solution after they submitted their corrections to the instructor. The performance on the final exam on the same problems suggests that students who were given incentives to correct their mistakes significantly outperformed those who were not given an incentive. The incentive to correct mistakes had the greatest impact on the final exam performance of students who perfor...

  12. Optimum Inverter Sizing in Consideration of Irradiance Pattern and PV Incentives

    E-Print Network [OSTI]

    Lehman, Brad

    Optimum Inverter Sizing in Consideration of Irradiance Pattern and PV Incentives Song Chen* Peng Li is that irradiance levels in real installations only occasionally reach irradiance levels of the STC conditions (1000 some researchers propose that undersized inverters cause considerable energy loss under high irradiance

  13. Ownership Change, Incentives and Plant Efficiency: The Divestiture of U.S. Electric Generation Plants

    E-Print Network [OSTI]

    Sadoulet, Elisabeth

    Ownership Change, Incentives and Plant Efficiency: The Divestiture of U.S. Electric Generation generating plants. Between 1998 and 2001, over 300 electric generating plants in the US, accounting Plants James B. Bushnell and Catherine Wolfram March 2005 Abstract Electric industry restructuring

  14. Do Generation Firms in Restructured Electricity Markets Have Incentives to Support Socially-Efficient Transmission Investments? *

    E-Print Network [OSTI]

    .S. transmission system is under stress (Abraham, 2002). Growth of electricity demand and new generation capacity investment in new generation and growth in electricity demand. Much of the current underinvestment1 Do Generation Firms in Restructured Electricity Markets Have Incentives to Support Socially

  15. Barter -Mechanism Design of A Market-incented Wisdom Exchange for Organizations and Communities

    E-Print Network [OSTI]

    Chen, Yiling

    Barter - Mechanism Design of A Market-incented Wisdom Exchange for Organizations and Communities the design and creation of information mar- kets with a goal of bringing an electronic, distributed market of an information market and its various forces. In this paper, we focus on presenting the framework design

  16. Profit Incentive In A Secondary Spectrum Market: A Contract Design Approach

    E-Print Network [OSTI]

    Liu, Mingyan

    Profit Incentive In A Secondary Spectrum Market: A Contract Design Approach Shang-Pin Sheng such a contract design approach in the context of the secondary spectrum market, where a license holder advertises}@umich.edu Abstract--In this paper we formulate a contract design problem where a primary license holder wishes

  17. A Truthful Incentive Mechanism for Emergency Demand Response in Colocation Data Centers

    E-Print Network [OSTI]

    Ren, Shaolei

    program, the operator has to rely on the highly expensive and/or environmentally-unfriendly on-site energy--Data centers are key participants in demand re- sponse programs, including emergency demand response (EDR of incentives to reduce energy consumption by tenants who control their servers and are typically on fixed power

  18. Country Review of Energy-Efficiency Financial Incentives in the Residential Sector

    SciTech Connect (OSTI)

    Can, Stephane de la Rue du; Shah, Nihar; Phadke, Amol

    2011-07-13

    A large variety of energy-efficiency policy measures exist. Some are mandatory, some are informative, and some use financial incentives to promote diffusion of efficient equipment. From country to country, financial incentives vary considerably in scope and form, the type of framework used to implement them, and the actors that administer them. They range from rebate programs administered by utilities under an Energy-Efficiency Resource Standards (EERS) regulatory framework (California, USA) to the distribution of Eco-points rewarding customers for buying highly efficient appliances (Japan). All have the primary objective of transforming the current market to accelerate the diffusion of efficient technologies by addressing up-front cost barriers faced by consumers; in most instances, efficient technologies require a greater initial investment than conventional technologies. In this paper, we review the different market transformation measures involving the use of financial incentives in the countries belonging to the Major Economies Forum. We characterize the main types of measures, discuss their mechanisms, and provide information on program impacts to the extent that ex-ante or ex-post evaluations have been conducted. Finally, we identify best practices in financial incentive programs and opportunities for coordination between Major Economies Forum countries as envisioned under the Super Efficient Appliance Deployment (SEAD) initiative.

  19. A Truthful Incentive Mechanism for Emergency Demand Response in Colocation Data Centers

    E-Print Network [OSTI]

    Li, Zongpeng

    A Truthful Incentive Mechanism for Emergency Demand Response in Colocation Data Centers Linquan--Data centers are key participants in demand re- sponse programs, including emergency demand response (EDR grids, demand response programs are adopted in many countries for exploiting flexibility of electricity

  20. Efficient Use of WaterEfficient Use of Water Through Financial Incentive Programs

    E-Print Network [OSTI]

    Keller, Arturo A.

    and incorporated mutual water companies Projects: Agricultural capital outlay measures to increase water savings#12;Efficient Use of WaterEfficient Use of Water Through Financial Incentive Programs Department;#12;Water Use Efficiency WorksWater Use Efficiency Works The California Water Plan: by 2030: Urban 1

  1. EIS-0016: Cumulative Production/Consumption Effects of the Crude Oil Price Incentive Rulemakings, Programmatic

    Office of Energy Efficiency and Renewable Energy (EERE)

    The U.S. Department of Energy prepared this Final Statement to FEA-FES-77-7 to assess the environmental and socioeconomic implications of a rulemaking on crude oil pricing incentives as pertains to the full range of oil production technologies (present as well as anticipated.)

  2. Health-Insurer Bargaining Power and Firms' Incentives to Manage Earnings Francesco Bova

    E-Print Network [OSTI]

    Tipple, Brett

    Health-Insurer Bargaining Power and Firms' Incentives to Manage Earnings Francesco Bova Rotman of Toronto okhope@rotman.utoronto.ca August 19, 2014 Abstract Health-insurance premiums account for a significant portion of the cost base of U.S. corporations. A recent study finds that health-insurance premiums

  3. Heat Pump for High School Heat Recovery

    E-Print Network [OSTI]

    Huang, K.; Wang, H.; Zhou, X.

    2006-01-01

    The heat pump system used for recycling and reusing waste heat in s high school bathroom was minutely analyzed in its coefficient of performance, onetime utilization ratio of energy, economic property and so on. The results showed that this system...

  4. Pagosa Springs District Heating District Heating Low Temperature...

    Open Energy Info (EERE)

    Pagosa Springs District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Pagosa Springs District Heating District Heating Low...

  5. City of Klamath Falls District Heating District Heating Low Temperatur...

    Open Energy Info (EERE)

    City of Klamath Falls District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name City of Klamath Falls District Heating District Heating...

  6. San Bernardino District Heating District Heating Low Temperature...

    Open Energy Info (EERE)

    San Bernardino District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name San Bernardino District Heating District Heating Low...

  7. Philip District Heating District Heating Low Temperature Geothermal...

    Open Energy Info (EERE)

    Philip District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Philip District Heating District Heating Low Temperature Geothermal...

  8. Kethcum District Heating District Heating Low Temperature Geothermal...

    Open Energy Info (EERE)

    Kethcum District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Kethcum District Heating District Heating Low Temperature Geothermal...

  9. Boise City Geothermal District Heating District Heating Low Temperatur...

    Open Energy Info (EERE)

    Boise City Geothermal District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Boise City Geothermal District Heating District Heating...

  10. Midland District Heating District Heating Low Temperature Geothermal...

    Open Energy Info (EERE)

    Midland District Heating District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Midland District Heating District Heating Low Temperature Geothermal...

  11. Northeast Home Heating Oil Reserve System Heating Oil, PIA Office...

    Broader source: Energy.gov (indexed) [DOE]

    Northeast Home Heating Oil Reserve System Heating Oil, PIA Office of Fossil Energy Headquaters Northeast Home Heating Oil Reserve System Heating Oil, PIA Office of Fossil Energy...

  12. SMALL PARTICLE HEAT EXCHANGERS

    E-Print Network [OSTI]

    Hunt, A.J.

    2011-01-01

    heat exchangers. These types of heat exchangers have limitedheat exchanger to solar collection systems that utilize linear trough- typenon-solar heat exchangers. These may be of the type used to

  13. Concentrating solar heat collector

    SciTech Connect (OSTI)

    Fattor, A.P.

    1980-09-23

    A heat storage unit is integrated with a collection unit providing a heat supply in off-sun times, and includes movable insulation means arranged to provide insulation during off-sun times for the heat storage unit.

  14. Absorption heat pump system

    DOE Patents [OSTI]

    Grossman, G.

    1982-06-16

    The efficiency of an absorption heat pump system is improved by conducting liquid from a second stage evaporator thereof to an auxiliary heat exchanger positioned downstream of a primary heat exchanger in the desorber of the system.

  15. Absorption heat pump system

    DOE Patents [OSTI]

    Grossman, Gershon (Oak Ridge, TN)

    1984-01-01

    The efficiency of an absorption heat pump system is improved by conducting liquid from a second stage evaporator thereof to an auxiliary heat exchanger positioned downstream of a primary heat exchanger in the desorber of the system.

  16. Locating Heat Recovery Opportunities

    E-Print Network [OSTI]

    Waterland, A. F.

    1981-01-01

    Basic concepts of heat recovery are defined as they apply to the industrial community. Methods for locating, ranking, and developing heat recovery opportunities are presented and explained. The needs for useful heat 'sinks' are emphasized as equal...

  17. Woven heat exchanger

    DOE Patents [OSTI]

    Piscitella, R.R.

    1984-07-16

    This invention relates to a heat exchanger for waste heat recovery from high temperature industrial exhaust streams. In a woven ceramic heat exchanger using the basic tube-in-shell design, each heat exchanger consisting of tube sheets and tube, is woven separately. Individual heat exchangers are assembled in cross-flow configuration. Each heat exchanger is woven from high temperature ceramic fiber, the warp is continuous from tube to tube sheet providing a smooth transition and unitized construction.

  18. A Global Review of Incentive Programs to Accelerate Energy-Efficient Appliances and Equipment

    SciTech Connect (OSTI)

    de la Rue du Can, Stephane; Phadke, Amol; Leventis, Greg; Gopal, Anand

    2013-08-01

    Incentive programs are an essential policy tool to move the market toward energy-efficient products. They offer a favorable complement to mandatory standards and labeling policies by accelerating the market penetration of energy-efficient products above equipment standard requirements and by preparing the market for increased future mandatory requirements. They sway purchase decisions and in some cases production decisions and retail stocking decisions toward energy-efficient products. Incentive programs are structured according to their regulatory environment, the way they are financed, by how the incentive is targeted, and by who administers them. This report categorizes the main elements of incentive programs, using case studies from the Major Economies Forum to illustrate their characteristics. To inform future policy and program design, it seeks to recognize design advantages and disadvantages through a qualitative overview of the variety of programs in use around the globe. Examples range from rebate programs administered by utilities under an Energy-Efficiency Resource Standards (EERS) regulatory framework (California, USA) to the distribution of Eco-Points that reward customers for buying efficient appliances under a government recovery program (Japan). We found that evaluations have demonstrated that financial incentives programs have greater impact when they target highly efficient technologies that have a small market share. We also found that the benefits and drawbacks of different program design aspects depend on the market barriers addressed, the target equipment, and the local market context and that no program design surpasses the others. The key to successful program design and implementation is a thorough understanding of the market and effective identification of the most important local factors hindering the penetration of energy-efficient technologies.

  19. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Revised: December, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings...

  20. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings*...

  1. Geothermal Heat Pumps

    Broader source: Energy.gov [DOE]

    Geothermal heat pumps are expensive to install but pay for themselves over time in reduced heating and cooling costs. Find out if one is right for your home.

  2. Proceedings of the 1992 EPRI heat rate improvement conference

    SciTech Connect (OSTI)

    Henry, R.E. (Sargent and Lundy, Chicago, IL (United States))

    1993-03-01

    Diverse but compelling forces such as increasing fuel prices, greater power demands, growing competition, and ever more aggressive regulatory incentives are causing utilities to place additional focus on power plant heat rate. The 1992 heat rate improvement conference was a gathering of utility industry experts to share knowledge and concerns on such key issues as on-line measurement of stack gas mass flow rate-increasingly important because of the regulations of the Clean Air Act of 1990. These proceedings present the latest developments by EPRI and the utility industry to improve heat rate. Representatives of utilities, architect/engineering firms, research firms, and manufacturers presented 71 papers, and a panel discussion by the ASME performance test code committee on PTC 46 provided a forum on the overall plant performance test code. These proceedings report on a number of heat rate improvement programs, both in development and in place, including EPRI's Plant Monitoring Workstation (PMW), the State-of-the-Art Power Plant (SOAPP) conceptual design tool, and several developments in boiler performance monitoring, including an on-line system at PEPCO's Morgantown unit 2. Other conference papers describe advances in heat rate improvement through (1) computer software tools modeling boiler cleanliness, heat balance, duct system dynamics, heat rate root cause diagnosis, and conceptual plant design; (2) new instruments and testing systems in the areas of performance testing, heat rate monitoring, circulating water flow measurement, and low-pressure turbine efficiency measurement; and (3) auxiliary equipment improvements such as condensing heat exchangers, macrobiofouling control, condenser in-leakage and air binding control, air heater monitoring, and feedwater heater level control. Individual papers are indexed separately.

  3. Direct fired heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C. (Lafayette, NY); Root, Richard A. (Spokane, WA)

    1986-01-01

    A gas-to-liquid heat exchanger system which transfers heat from a gas, generally the combustion gas of a direct-fired generator of an absorption machine, to a liquid, generally an absorbent solution. The heat exchanger system is in a counterflow fluid arrangement which creates a more efficient heat transfer.

  4. Woven heat exchanger

    DOE Patents [OSTI]

    Piscitella, Roger R. (Idaho Falls, ID)

    1987-01-01

    In a woven ceramic heat exchanger using the basic tube-in-shell design, each heat exchanger consisting of tube sheets and tube, is woven separately. Individual heat exchangers are assembled in cross-flow configuration. Each heat exchanger is woven from high temperature ceramic fiber, the warp is continuous from tube to tube sheet providing a smooth transition and unitized construction.

  5. Rotary magnetic heat pump

    DOE Patents [OSTI]

    Kirol, L.D.

    1987-02-11

    A rotary magnetic heat pump constructed without flow seals or segmented rotor accomplishes recuperation and regeneration by using split flow paths. Heat exchange fluid pumped through heat exchangers and returned to the heat pump splits into two flow components: one flowing counter to the rotor rotation and one flowing with the rotation. 5 figs.

  6. Rotary magnetic heat pump

    DOE Patents [OSTI]

    Kirol, Lance D. (Shelly, ID)

    1988-01-01

    A rotary magnetic heat pump constructed without flow seals or segmented rotor accomplishes recuperation and regeneration by using split flow paths. Heat exchange fluid pumped through heat exchangers and returned to the heat pump splits into two flow components: one flowing counter to the rotor rotation and one flowing with the rotation.

  7. Mass and Heat Recovery

    E-Print Network [OSTI]

    Hindawai, S. M.

    2010-01-01

    In the last few years heat recovery was under spot and in air conditioning fields usually we use heat recovery by different types of heat exchangers. The heat exchanging between the exhaust air from the building with the fresh air to the building...

  8. Heat Treating Apparatus

    DOE Patents [OSTI]

    De Saro, Robert (Annandale, NJ); Bateman, Willis (Sutton Colfield, GB)

    2002-09-10

    Apparatus for heat treating a heat treatable material including a housing having an upper opening for receiving a heat treatable material at a first temperature, a lower opening, and a chamber therebetween for heating the heat treatable material to a second temperature higher than the first temperature as the heat treatable material moves through the chamber from the upper to the lower opening. A gas supply assembly is operatively engaged to the housing at the lower opening, and includes a source of gas, a gas delivery assembly for delivering the gas through a plurality of pathways into the housing in countercurrent flow to movement of the heat treatable material, whereby the heat treatable material passes through the lower opening at the second temperature, and a control assembly for controlling conditions within the chamber to enable the heat treatable material to reach the second temperature and pass through the lower opening at the second temperature as a heated material.

  9. Integrated heat pump system

    SciTech Connect (OSTI)

    Reedy, W.R.

    1988-03-01

    An integrated heat pump and hot water system is described that includes: a heat pump having an indoor heat exchanger and an outdoor heat exchanger that are selectively connected to the suction line and the discharge line respectively of a compressor by a flow reversing means, and to each other by a liquid line having an expansion device mounted therein, whereby heating and cooling is provided to an indoor comfort zone by cycling the flow reversing means, a refrigerant to water heat exchanger having a hot water flow circuit in heat transfer relation with a first refrigerant condensing circuit and a second refrigerant evaporating circuit, a connection mounted in the liquid between the indoor heat exchanger and the expansion device, control means for regulating the flow of refrigerant through the refrigerant to water heat exchanger to selectively transfer heat into and out of the hot water flow circuit.

  10. Thulium-170 heat source

    DOE Patents [OSTI]

    Walter, Carl E. (Pleasanton, CA); Van Konynenburg, Richard (Livermore, CA); VanSant, James H. (Tracy, CA)

    1992-01-01

    An isotopic heat source is formed using stacks of thin individual layers of a refractory isotopic fuel, preferably thulium oxide, alternating with layers of a low atomic weight diluent, preferably graphite. The graphite serves several functions: to act as a moderator during neutron irradiation, to minimize bremsstrahlung radiation, and to facilitate heat transfer. The fuel stacks are inserted into a heat block, which is encased in a sealed, insulated and shielded structural container. Heat pipes are inserted in the heat block and contain a working fluid. The heat pipe working fluid transfers heat from the heat block to a heat exchanger for power conversion. Single phase gas pressure controls the flow of the working fluid for maximum heat exchange and to provide passive cooling.

  11. Thermoelectric heat exchange element

    DOE Patents [OSTI]

    Callas, James J. (Peoria, IL); Taher, Mahmoud A. (Peoria, IL)

    2007-08-14

    A thermoelectric heat exchange module includes a first substrate including a heat receptive side and a heat donative side and a series of undulatory pleats. The module may also include a thermoelectric material layer having a ZT value of 1.0 or more disposed on at least one of the heat receptive side and the heat donative side, and an electrical contact may be in electrical communication with the thermoelectric material layer.

  12. A comparison of three cap-and-trade market designs and incentives for new technologies to reduce Greenhouse gases

    SciTech Connect (OSTI)

    Van Horn, Andrew; Remedios, Edward

    2008-03-15

    A source-based market design is preferable for its simplicity, lower costs, faster implementation, more accurate tracking and verification, and greater incentives for the adoption of lower-emitting technologies. (author)

  13. Production Incentives and Payment Methods in Major Texas Fluid Milk Markets.

    E-Print Network [OSTI]

    Krienke, A. B.; Stelly, Randall

    1967-01-01

    of demand for fluid milk products is low. Therefore, even with extreme fluctu ations in the price for Grade A milk, it may be difficult to obtain desired adjustments in consumption. For this reason, at least during certain seasons, some Grade A milk... class. Several producer payment methods have been developed which not only define an equitable means for allocating Class I and Class II sales to individual producers but which also are expected to provide the incentive for certain types...

  14. Incentive Regulation in Theory and Practice: Electricity Distribution and Transmission Networks

    E-Print Network [OSTI]

    Joskow, Paul

    2006-03-14

    . The first relates to the System Operator (SO) incentive schemes that have been offered to the National Grid Company in England and Wales discussed below. The second is the menu of sliding scale mechanisms offered to the electric distribution companies... ) the introduction of new products and services, and stimulate efficient investment in and pricing of access to regulated infrastructure services. 1 Prepared for the National Bureau of Economic Research Conference...

  15. List of Energy Mgmt. Systems/Building Controls Incentives | Open Energy

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives

  16. Playing Hot and Cold: How Can Russian Heat Policy Find Its Way Toward Energy Efficiency?

    SciTech Connect (OSTI)

    Roshchanka, Volha; Evans, Meredydd

    2012-09-15

    The Russian district heating has a large energy-saving potential, and, therefore, need for investments. The scale of needed investments is significant: the government estimates that 70 percent of the district heating infrastructure needs replacement or maintenance, a reflection of decades of under investment. Government budgets will be unable to cover them, and iInvolvingement ofthe private industry will be critical to attracting the necessary investementis necessary. For private parties to invest in district heating facilities across Russia, and not only in pockets of already successful enterprises, regulators have to develop a comprehensive policy that works district heating systems under various conditionscost-reflective tariffs, metering, incentives for efficiency and social support for the neediest (instead of subsidies for all).

  17. Can historic neighborhoods compete? Analysis of and recommendations for local incentives for owner-occupied historic housing

    E-Print Network [OSTI]

    Rowe, Rebecca Elizabeth

    2005-02-17

    -1 CAN HISTORIC NEIGHBORHOODS COMPETE? ANALYSIS OF AND RECOMMENDATIONS FOR LOCAL INCENTIVES FOR OWNER-OCCUPIED RESIDENTIAL STRUCTURES A Thesis by REBECCA ELIZABETH ROWE Submitted to the Office of Graduate Studies of Texas A&M University in partial... fulfillment of the requirements for the degree of MASTER OF SCIENCE December 2004 Major Subject: Architecture ii CAN HISTORIC NEIGHBORHOODS COMPETE? ANALYSIS OF AND RECOMMENDATIONS FOR LOCAL INCENTIVES FOR OWNER-OCCUPIED RESIDENTIAL STRUCTURES A Thesis...

  18. Heat transfer system

    DOE Patents [OSTI]

    Not Available

    1980-03-07

    A heat transfer system for a nuclear reactor is described. Heat transfer is accomplished within a sealed vapor chamber which is substantially evacuated prior to use. A heat transfer medium, which is liquid at the design operating temperatures, transfers heat from tubes interposed in the reactor primary loop to spaced tubes connected to a steam line for power generation purposes. Heat transfer is accomplished by a two-phase liquid-vapor-liquid process as used in heat pipes. Condensible gases are removed from the vapor chamber through a vertical extension in open communication with the chamber interior.

  19. Heat transfer system

    DOE Patents [OSTI]

    McGuire, Joseph C. (Richland, WA)

    1982-01-01

    A heat transfer system for a nuclear reactor. Heat transfer is accomplished within a sealed vapor chamber which is substantially evacuated prior to use. A heat transfer medium, which is liquid at the design operating temperatures, transfers heat from tubes interposed in the reactor primary loop to spaced tubes connected to a steam line for power generation purposes. Heat transfer is accomplished by a two-phase liquid-vapor-liquid process as used in heat pipes. Condensible gases are removed from the vapor chamber through a vertical extension in open communication with the chamber interior.

  20. Wound tube heat exchanger

    DOE Patents [OSTI]

    Ecker, Amir L. (Duncanville, TX)

    1983-01-01

    What is disclosed is a wound tube heat exchanger in which a plurality of tubes having flattened areas are held contiguous adjacent flattened areas of tubes by a plurality of windings to give a double walled heat exchanger. The plurality of windings serve as a plurality of effective force vectors holding the conduits contiguous heat conducting walls of another conduit and result in highly efficient heat transfer. The resulting heat exchange bundle is economical and can be coiled into the desired shape. Also disclosed are specific embodiments such as the one in which the tubes are expanded against their windings after being coiled to insure highly efficient heat transfer.

  1. Consolidated Electric Cooperative- Heat Pump and Water Heating Rebates

    Office of Energy Efficiency and Renewable Energy (EERE)

    Consolidated Electric Cooperative provides rebates to residential customers who install electric water heaters, dual-fuel heating system or geothermal heat pumps. A dual-fuel heating systems...

  2. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Survey: Energy End-Use Consumption Tables Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other...

  3. HEAT TRANSFER FLUIDS

    E-Print Network [OSTI]

    Lenert, Andrej

    2012-01-01

    The choice of heat transfer fluids has significant effects on the performance, cost, and reliability of solar thermal systems. In this chapter, we evaluate existing heat transfer fluids such as oils and molten salts based ...

  4. Fusion heating technology

    SciTech Connect (OSTI)

    Cole, A.J.

    1982-06-01

    John Lawson established the criterion that in order to produce more energy from fusion than is necessary to heat the plasma and replenish the radiation losses, a minimum value for both the product of plasma density and confinement time t, and the temperature must be achieved. There are two types of plasma heating: neutral beam and electromagnetic wave heating. A neutral beam system is shown. Main development work on negative ion beamlines has focused on the difficult problem of the production of high current sources. The development of a 30 keV-1 ampere multisecond source module is close to being accomplished. In electromagnetic heating, the launcher, which provides the means of coupling the power to the plasma, is most important. The status of heating development is reviewed. Electron cyclotron resonance heating (ECRH), lower hybrid heating (HHH), and ion cyclotron resonance heating (ICRH) are reviewed.

  5. Photovoltaic roof heat flux

    E-Print Network [OSTI]

    Samady, Mezhgan Frishta

    2011-01-01

    designs (relatively) Photovoltaic Solar P a n e l AtmosphereCALIFORNIA, SAN DIEGO Photovoltaic Roof Heat Flux A ThesisABSTRACT OF T H E THESIS Photovoltaic Roof Heat Flux by

  6. Photovoltaic roof heat flux

    E-Print Network [OSTI]

    Samady, Mezhgan Frishta

    2011-01-01

    influence on the heat transfer as the radiation. Since thethe heat transfer analysis, the difference of net radiationheat transfer involved i n this project were conduction, convection and radiation.

  7. Abrasion resistant heat pipe

    DOE Patents [OSTI]

    Ernst, D.M.

    1984-10-23

    A specially constructed heat pipe is described for use in fluidized bed combustors. Two distinct coatings are spray coated onto a heat pipe casing constructed of low thermal expansion metal, each coating serving a different purpose. The first coating forms aluminum oxide to prevent hydrogen permeation into the heat pipe casing, and the second coating contains stabilized zirconium oxide to provide abrasion resistance while not substantially affecting the heat transfer characteristics of the system.

  8. Abrasion resistant heat pipe

    DOE Patents [OSTI]

    Ernst, Donald M. (Leola, PA)

    1984-10-23

    A specially constructed heat pipe for use in fluidized bed combustors. Two distinct coatings are spray coated onto a heat pipe casing constructed of low thermal expansion metal, each coating serving a different purpose. The first coating forms aluminum oxide to prevent hydrogen permeation into the heat pipe casing, and the second coating contains stabilized zirconium oxide to provide abrasion resistance while not substantially affecting the heat transfer characteristics of the system.

  9. Solar heat receiver

    DOE Patents [OSTI]

    Hunt, A.J.; Hansen, L.J.; Evans, D.B.

    1982-09-29

    A receiver is described for converting solar energy to heat a gas to temperatures from 700 to 900/sup 0/C. The receiver is formed to minimize impingement of radiation on the walls and to provide maximum heating at and near the entry of the gas exit. Also, the receiver is formed to provide controlled movement of the gas to be heated to minimize wall temperatures. The receiver is designed for use with gas containing fine heat absorbing particles, such as carbon particles.

  10. MA HEAT Loan Overview

    Broader source: Energy.gov [DOE]

    Presents information on the success of Massachusetts's HEAT loan offerings and how the financing tool is funded.

  11. Solar heat receiver

    DOE Patents [OSTI]

    Hunt, Arlon J. (Oakland, CA); Hansen, Leif J. (Berkeley, CA); Evans, David B. (Orinda, CA)

    1985-01-01

    A receiver for converting solar energy to heat a gas to temperatures from 700.degree.-900.degree. C. The receiver is formed to minimize impingement of radiation on the walls and to provide maximum heating at and near the entry of the gas exit. Also, the receiver is formed to provide controlled movement of the gas to be heated to minimize wall temperatures. The receiver is designed for use with gas containing fine heat absorbing particles, such as carbon particles.

  12. Geothermal Heat Pump Basics

    Broader source: Energy.gov [DOE]

    Geothermal heat pumps use the constant temperature of the earth as an exchange medium for heat. Although many parts of the country experience seasonal temperature extremesfrom scorching heat in the summer to sub-zero cold in the winterthe ground a few feet below the earth's surface remains at a relatively constant temperature.

  13. Liquid heat capacity lasers

    DOE Patents [OSTI]

    Comaskey, Brian J. (Walnut Creek, CA); Scheibner, Karl F. (Tracy, CA); Ault, Earl R. (Livermore, CA)

    2007-05-01

    The heat capacity laser concept is extended to systems in which the heat capacity lasing media is a liquid. The laser active liquid is circulated from a reservoir (where the bulk of the media and hence waste heat resides) through a channel so configured for both optical pumping of the media for gain and for light amplification from the resulting gain.

  14. Pioneering Heat Pump Project

    Broader source: Energy.gov [DOE]

    Project objectives: To install and monitor an innovative WaterFurnace geothermal system that is technologically advanced and evolving; To generate hot water heating from a heat pump that uses non-ozone depleting refrigerant CO2. To demonstrate the energy efficiency of this system ground source heat pump system.

  15. Heat Transfer Guest Editorial

    E-Print Network [OSTI]

    Kandlikar, Satish

    Journal of Heat Transfer Guest Editorial We are indeed delighted in bringing out this special issue was showcased in diverse areas such as traditional heat and mass transfer, lab-on-chip, sensors, biomedical applica- tions, micromixers, fuel cells, and microdevices. Selected papers in the field of heat transfer

  16. A corrosive resistant heat exchanger

    DOE Patents [OSTI]

    Richlen, S.L.

    1987-08-10

    A corrosive and erosive resistant heat exchanger which recovers heat from a contaminated heat stream. The heat exchanger utilizes a boundary layer of innocuous gas, which is continuously replenished, to protect the heat exchanger surface from the hot contaminated gas. The innocuous gas is pumped through ducts or perforations in the heat exchanger wall. Heat from the heat stream is transferred by radiation to the heat exchanger wall. Heat is removed from the outer heat exchanger wall by a heat recovery medium. 3 figs., 3 tabs.

  17. Heat recovery in building envelopes

    E-Print Network [OSTI]

    Walker, Iain S.; Sherman, Max H.

    2003-01-01

    2003). Infiltration heat recovery ASHRAE Research ProjectModel for Infiltration Heat Recovery, Proc. 21 st AnnualN ATIONAL L ABORATORY Heat Recovery in Building Envelopes

  18. Heat Recovery in Building Envelopes

    E-Print Network [OSTI]

    Sherman, Max H.; Walker, Iain S.

    2001-01-01

    Model For Infiltration Heat Recovery. Proceedings 21st AivcLBNL 47329 HEAT RECOVERY IN BUILDING ENVELOPES Max H.contribution because of heat recovery within the building

  19. Heat recovery in building envelopes

    E-Print Network [OSTI]

    Walker, Iain S.; Sherman, Max H.

    2003-01-01

    2003). Infiltration heat recovery ASHRAE Research ProjectModel for Infiltration Heat Recovery, Proc. 21 st AnnualWalker, I.S. (2001). "Heat Recovery in Building Envelopes".

  20. Chemical heat pump

    DOE Patents [OSTI]

    Greiner, Leonard (2750-C Segerstrom Ave., Santa Ana, CA 92704)

    1980-01-01

    A chemical heat pump system is disclosed for use in heating and cooling structures such as residences or commercial buildings. The system is particularly adapted to utilizing solar energy, but also increases the efficiency of other forms of thermal energy when solar energy is not available. When solar energy is not available for relatively short periods of time, the heat storage capacity of the chemical heat pump is utilized to heat the structure as during nighttime hours. The design also permits home heating from solar energy when the sun is shining. The entire system may be conveniently rooftop located. In order to facilitate installation on existing structures, the absorber and vaporizer portions of the system may each be designed as flat, thin wall, thin pan vessels which materially increase the surface area available for heat transfer. In addition, this thin, flat configuration of the absorber and its thin walled (and therefore relatively flexible) construction permits substantial expansion and contraction of the absorber material during vaporization and absorption without generating voids which would interfere with heat transfer. The heat pump part of the system heats or cools a house or other structure through a combination of evaporation and absorption or, conversely, condensation and desorption, in a pair of containers. A set of automatic controls change the system for operation during winter and summer months and for daytime and nighttime operation to satisfactorily heat and cool a house during an entire year. The absorber chamber is subjected to solar heating during regeneration cycles and is covered by one or more layers of glass or other transparent material. Daytime home air used for heating the home is passed at appropriate flow rates between the absorber container and the first transparent cover layer in heat transfer relationship in a manner that greatly reduce eddies and resultant heat loss from the absorbant surface to ambient atmosphere.

  1. Heat Transfer Fluids for Solar Water Heating Systems | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Illustration of a solar water heater. Illustration of a solar water heater. Heat-transfer fluids carry heat through solar collectors and a heat exchanger to the heat storage tanks...

  2. Absorption heat pump system

    DOE Patents [OSTI]

    Grossman, Gershon (Oak Ridge, TN); Perez-Blanco, Horacio (Knoxville, TN)

    1984-01-01

    An improvement in an absorption heat pump cycle is obtained by adding adiabatic absorption and desorption steps to the absorber and desorber of the system. The adiabatic processes make it possible to obtain the highest temperature in the absorber before any heat is removed from it and the lowest temperature in the desorber before heat is added to it, allowing for efficient utilization of the thermodynamic availability of the heat supply stream. The improved system can operate with a larger difference between high and low working fluid concentrations, less circulation losses, and more efficient heat exchange than a conventional system.

  3. Heat pump apparatus

    DOE Patents [OSTI]

    Nelson, Paul A. (Wheaton, IL); Horowitz, Jeffrey S. (Woodridge, IL)

    1983-01-01

    A heat pump apparatus including a compact arrangement of individual tubular reactors containing hydride-dehydride beds in opposite end sections, each pair of beds in each reactor being operable by sequential and coordinated treatment with a plurality of heat transfer fluids in a plurality of processing stages, and first and second valves located adjacent the reactor end sections with rotatable members having multiple ports and associated portions for separating the hydride beds at each of the end sections into groups and for simultaneously directing a plurality of heat transfer fluids to the different groups. As heat is being generated by a group of beds, others are being regenerated so that heat is continuously available for space heating. As each of the processing stages is completed for a hydride bed or group of beds, each valve member is rotated causing the heat transfer fluid for the heat processing stage to be directed to that bed or group of beds. Each of the end sections are arranged to form a closed perimeter and the valve member may be rotated repeatedly about the perimeter to provide a continuous operation. Both valves are driven by a common motor to provide a coordinated treatment of beds in the same reactors. The heat pump apparatus is particularly suitable for the utilization of thermal energy supplied by solar collectors and concentrators but may be used with any source of heat, including a source of low-grade heat.

  4. Active microchannel heat exchanger

    DOE Patents [OSTI]

    Tonkovich, Anna Lee Y. (Pasco, WA) [Pasco, WA; Roberts, Gary L. (West Richland, WA) [West Richland, WA; Call, Charles J. (Pasco, WA) [Pasco, WA; Wegeng, Robert S. (Richland, WA) [Richland, WA; Wang, Yong (Richland, WA) [Richland, WA

    2001-01-01

    The present invention is an active microchannel heat exchanger with an active heat source and with microchannel architecture. The microchannel heat exchanger has (a) an exothermic reaction chamber; (b) an exhaust chamber; and (c) a heat exchanger chamber in thermal contact with the exhaust chamber, wherein (d) heat from the exothermic reaction chamber is convected by an exothermic reaction exhaust through the exhaust chamber and by conduction through a containment wall to the working fluid in the heat exchanger chamber thereby raising a temperature of the working fluid. The invention is particularly useful as a liquid fuel vaporizer and/or a steam generator for fuel cell power systems, and as a heat source for sustaining endothermic chemical reactions and initiating exothermic reactions.

  5. Financial Analysis of Incentive Mechanisms to Promote Energy Efficiency: Case Study of a Prototypical Southwest Utility

    SciTech Connect (OSTI)

    Cappers, Peter; Goldman, Charles; Chait, Michele; Edgar, George; Schlegel, Jeff; Shirley, Wayne

    2009-03-04

    Many state regulatory commissions and policymakers want utilities to aggressively pursue energy efficiency as a strategy to mitigate demand and energy growth, diversify the resource mix, and provide an alternative to building new, costly generation. However, as the National Action Plan for Energy Efficiency (NAPEE 2007) points out, many utilities continue to shy away from aggressively expanding their energy efficiency efforts when their shareholder's fundamental financial interests are placed at risk by doing so. Thus, there is increased interest in developing effective ratemaking and policy approaches that address utility disincentives to pursue energy efficiency or lack of incentives for more aggressive energy efficiency efforts. New regulatory initiatives to promote increased utility energy efficiency efforts also affect the interests of consumers. Ratepayers and their advocates are concerned with issues of fairness, impacts on rates, and total consumer costs. From the perspective of energy efficiency advocates, the quid pro quo for utility shareholder incentives is the obligation to acquire all, or nearly all, achievable cost-effective energy efficiency. A key issue for state regulators and policymakers is how to maximize the cost-effective energy efficiency savings attained while achieving an equitable sharing of benefits, costs and risks among the various stakeholders. In this study, we modeled a prototypical vertically-integrated electric investor-owned utility in the southwestern US that is considering implementing several energy efficiency portfolios. We analyze the impact of these energy efficiency portfolios on utility shareholders and ratepayers as well as the incremental effect on each party when lost fixed cost recovery and/or utility shareholder incentive mechanisms are implemented. A primary goal of our quantitative modeling is to provide regulators and policymakers with an analytic framework and tools that assess the financial impacts of alternative incentive approaches on utility shareholders and customers if energy efficiency is implemented under various utility operating, cost, and supply conditions.We used and adapted a spreadsheet-based financial model (the Benefits Calculator) which was developed originally as a tool to support the National Action Plan for Energy Efficiency (NAPEE). The major steps in our analysis are displayed graphically in Figure ES- 1. Two main inputs are required: (1) characterization of the utility which includes its initial financial and physical market position, a forecast of the utility?s future sales, peak demand, and resource strategy to meet projected growth; and (2) characterization of the Demand-Side Resource (DSR) portfolio ? projected electricity and demand savings, costs and economic lifetime of a portfolio of energy efficiency (and/or demand response) programs that the utility is planning or considering implementing during the analysis period. The Benefits Calculator also estimates total resource costs and benefits of the DSR portfolio using a forecast of avoided capacity and energy costs. The Benefits Calculator then uses inputs provided in the Utility Characterization to produce a ?business-as usual? base case as well as alternative scenarios that include energy efficiency resources, including the corresponding utility financial budgets required in each case. If a decoupling and/or a shareholder incentive mechanism are instituted, the Benefits Calculator model readjusts the utility?s revenue requirement and retail rates accordingly. Finally, for each scenario, the Benefits Calculator produces several metrics that provides insights on how energy efficiency resources, decoupling and/or a shareholder incentive mechanism impacts utility shareholders (e.g. overall earnings, return on equity), ratepayers (e.g., average customer bills and rates) and society (e.g. net resource benefits).

  6. PERFORMANCE OF A STIRLING ENGINE POWERED HEAT ACTIVATED HEAT PUMP

    E-Print Network [OSTI]

    Oak Ridge National Laboratory

    PERFORMANCE OF A STIRLING ENGINE POWERED HEAT ACTIVATED HEAT PUMP W. D. C. Richards and W. L. Auxer General Electric Company Space Division King of Prussia, Pa. ABSTRACT A heat activated heat pump (HAHP by the heat pump effect. The Stirling engine/Rankine cycle refrigeration loop heat pump being developed would

  7. Energy Efficiency Under Alternative Carbon Policies. Incentives, Measurement, and Interregional Effects

    SciTech Connect (OSTI)

    Steinberg, Daniel C.; Boyd, Erin

    2015-08-28

    In this report, we examine and compare how tradable mass-based polices and tradable rate-based policies create different incentives for energy efficiency investments. Through a generalized demonstration and set of examples, we show that as a result of the output subsidy they create, traditional rate-based policies, those that do not credit energy savings from efficiency measures, reduce the incentive for investment in energy efficiency measures relative to an optimally designed mass-based policy or equivalent carbon tax. We then show that this reduced incentive can be partially addressed by modifying the rate-based policy such that electricity savings from energy efficiency measures are treated as a source of zero-carbon generation within the framework of the standard, or equivalently, by assigning avoided emissions credit to the electricity savings at the rate of the intensity target. These approaches result in an extension of the output subsidy to efficiency measures and eliminate the distortion between supply-side and demand-side options for GHG emissions reduction. However, these approaches do not address electricity price distortions resulting from the output subsidy that also impact the value of efficiency measures. Next, we assess alternative approaches for crediting energy efficiency savings within the framework of a rate-based policy. Finally, we identify a number of challenges that arise in implementing a rate-based policy with efficiency crediting, including the requirement to develop robust estimates of electricity savings in order to assess compliance, and the requirement to track the regionality of the generation impacts of efficiency measures to account for their interstate effects.

  8. Radiant Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    across the room. When radiant heating is located in the floor, it is often called radiant floor heating or simply floor heating. Radiant heating has a number of advantages. It is...

  9. State Level Incentives for Biogas-Fuel Cell Projects | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2StandardFOA2-002 StateIncentives forLevel

  10. List of Custom/Others pending approval Incentives | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIXsource History ViewInformationWindsCompressed air Incentives Jump to:

  11. Tax Incentives

    Broader source: Energy.gov (indexed) [DOE]

    competitive solicitations for R&D cooperative agreements to improve the performance and lower the cost of wind energy, or to reduce barriers to deployment. * Projects that are...

  12. incentive2

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuelWeatherizeeEnergyMonumentWest Plume)Suite 600,8-03

  13. Optimization of Heat Exchangers

    SciTech Connect (OSTI)

    Ivan Catton

    2010-10-01

    The objective of this research is to develop tools to design and optimize heat exchangers (HE) and compact heat exchangers (CHE) for intermediate loop heat transport systems found in the very high temperature reator (VHTR) and other Generation IV designs by addressing heat transfer surface augmentation and conjugate modeling. To optimize heat exchanger, a fast running model must be created that will allow for multiple designs to be compared quickly. To model a heat exchanger, volume averaging theory, VAT, is used. VAT allows for the conservation of mass, momentum and energy to be solved for point by point in a 3 dimensional computer model of a heat exchanger. The end product of this project is a computer code that can predict an optimal configuration for a heat exchanger given only a few constraints (input fluids, size, cost, etc.). As VAT computer code can be used to model characteristics )pumping power, temperatures, and cost) of heat exchangers more quickly than traditional CFD or experiment, optimization of every geometric parameter simultaneously can be made. Using design of experiment, DOE and genetric algorithms, GE, to optimize the results of the computer code will improve heat exchanger disign.

  14. Heat pump system

    DOE Patents [OSTI]

    Swenson, Paul F. (Shaker Heights, OH); Moore, Paul B. (Fedhaven, FL)

    1983-01-01

    An air heating and cooling system for a building includes an expansion type refrigeration circuit and a vapor power circuit. The refrigeration circuit includes two heat exchangers, one of which is communicated with a source of indoor air from the building and the other of which is communicated with a source of air from outside the building. The vapor power circuit includes two heat exchangers, one of which is disposed in series air flow relationship with the indoor refrigeration circuit heat exchanger and the other of which is disposed in series air flow relationship with the outdoor refrigeration circuit heat exchanger. Fans powered by electricity generated by a vapor power circuit alternator circulate indoor air through the two indoor heat exchangers and circulate outside air through the two outdoor heat exchangers. The system is assembled as a single roof top unit, with a vapor power generator and turbine and compressor thermally insulated from the heat exchangers, and with the indoor heat exchangers thermally insulated from the outdoor heat exchangers.

  15. Heat pump system

    DOE Patents [OSTI]

    Swenson, Paul F.; Moore, Paul B.

    1983-06-21

    An air heating and cooling system for a building includes an expansion type refrigeration circuit and a vapor power circuit. The refrigeration circuit includes two heat exchangers, one of which is communicated with a source of indoor air from the building and the other of which is communicated with a source of air from outside the building. The vapor power circuit includes two heat exchangers, one of which is disposed in series air flow relationship with the indoor refrigeration circuit heat exchanger and the other of which is disposed in series air flow relationship with the outdoor refrigeration circuit heat exchanger. Fans powered by electricity generated by a vapor power circuit alternator circulate indoor air through the two indoor heat exchangers and circulate outside air through the two outdoor heat exchangers. The system is assembled as a single roof top unit, with a vapor power generator and turbine and compressor thermally insulated from the heat exchangers, and with the indoor heat exchangers thermally insulated from the outdoor heat exchangers.

  16. Policies supporting Heat Pump Technologies

    E-Print Network [OSTI]

    Oak Ridge National Laboratory

    Policies supporting Heat Pump Technologies in Canada IEA Heat Pump Workshop London, UK November 13 in the world, with an average of 16,995 kilowatt-hours per annum. #12;Canada's Context for Heat Pumps Impacts avenues: Ground source heat pumps for cold climates (heating and cooling) Reversible air source heat

  17. Fluidized bed heat treating system

    DOE Patents [OSTI]

    Ripley, Edward B; Pfennigwerth, Glenn L

    2014-05-06

    Systems for heat treating materials are presented. The systems typically involve a fluidized bed that contains granulated heat treating material. In some embodiments a fluid, such as an inert gas, is flowed through the granulated heat treating medium, which homogenizes the temperature of the heat treating medium. In some embodiments the fluid may be heated in a heating vessel and flowed into the process chamber where the fluid is then flowed through the granulated heat treating medium. In some embodiments the heat treating material may be liquid or granulated heat treating material and the heat treating material may be circulated through a heating vessel into a process chamber where the heat treating material contacts the material to be heat treated. Microwave energy may be used to provide the source of heat for heat treating systems.

  18. Water-heating dehumidifier

    DOE Patents [OSTI]

    Tomlinson, John J. (Knoxville, TN)

    2006-04-18

    A water-heating dehumidifier includes a refrigerant loop including a compressor, at least one condenser, an expansion device and an evaporator including an evaporator fan. The condenser includes a water inlet and a water outlet for flowing water therethrough or proximate thereto, or is affixed to the tank or immersed into the tank to effect water heating without flowing water. The immersed condenser design includes a self-insulated capillary tube expansion device for simplicity and high efficiency. In a water heating mode air is drawn by the evaporator fan across the evaporator to produce cooled and dehumidified air and heat taken from the air is absorbed by the refrigerant at the evaporator and is pumped to the condenser, where water is heated. When the tank of water heater is full of hot water or a humidistat set point is reached, the water-heating dehumidifier can switch to run as a dehumidifier.

  19. Renewable Energy Cost Modeling: A Toolkit for Establishing Cost-Based Incentives in the United States; March 2010 -- March 2011

    SciTech Connect (OSTI)

    Gifford, J. S.; Grace, R. C.; Rickerson, W. H.

    2011-05-01

    This report is intended to serve as a resource for policymakers who wish to learn more about establishing cost-based incentives. The report will identify key renewable energy cost modeling options, highlight the policy implications of choosing one approach over the other, and present recommendations on the optimal characteristics of a model to calculate rates for cost-based incentives, feed-in tariffs (FITs), or similar policies. These recommendations will be utilized in designing the Cost of Renewable Energy Spreadsheet Tool (CREST). Three CREST models will be publicly available and capable of analyzing the cost of energy associated with solar, wind, and geothermal electricity generators. The CREST models will be developed for use by state policymakers, regulators, utilities, developers, and other stakeholders to assist them in current and future rate-setting processes for both FIT and other renewable energy incentive payment structures and policy analyses.

  20. Heat storage duration

    SciTech Connect (OSTI)

    Balcomb, J.D.

    1981-01-01

    Both the amount and duration of heat storage in massive elements of a passive building are investigated. Data taken for one full winter in the Balcomb solar home are analyzed with the aid of sub-system simulation models. Heat storage duration is tallied into one-day intervals. Heat storage location is discussed and related to overall energy flows. The results are interpreted and conclusions drawn.

  1. SMALL PARTICLE HEAT EXCHANGERS

    E-Print Network [OSTI]

    Hunt, A.J.

    2011-01-01

    by half, the solar collection efficiency will still be insolar thermal electric power program rests on the efficiency,efficiency heat storage systems. This type of hybrid, solar-

  2. Mechanical Compression Heat Pumps

    E-Print Network [OSTI]

    Apaloo, T. L.; Kawamura, K.; Matsuda, J.

    1986-01-01

    of the compressors which constitute the heart and soul of the system. It will also provide a quick survey of the available types of compressors for heat pumping and some of the industrial processes where simultaneous heating and cooling proceed along parallel..., the real challenge comes process environment, or even for comfort HEAT PUMP APPLICATIONS INPU~ AND OUTPUT UTIUnES (HEAT SOUlCE) (ME0U.4) (API't1CATION) CoofIng, Dehumldilication. L.- -J ~Ing. Hot ...,tolel SIJr-lpIy Chilled ....,oter. Hoi waler...

  3. Waste Heat Recovery

    Office of Environmental Management (EM)

    DRAFT - PRE-DECISIONAL - DRAFT 1 Waste Heat Recovery 1 Technology Assessment 2 Contents 3 1. Introduction to the TechnologySystem ......

  4. Photovoltaic roof heat flux

    E-Print Network [OSTI]

    Samady, Mezhgan Frishta

    2011-01-01

    Effect of building integrated photovoltaics on microclimateof a building's integrated-photovoltaics on heating a n dgaps for building- integrated photovoltaics, Solar Energy

  5. Heat and mass exchanger

    DOE Patents [OSTI]

    Lowenstein, Andrew (Princeton, NJ); Sibilia, Marc J. (Princeton, NJ); Miller, Jeffrey A. (Hopewell, NJ); Tonon, Thomas (Princeton, NJ)

    2011-06-28

    A mass and heat exchanger includes at least one first substrate with a surface for supporting a continuous flow of a liquid thereon that either absorbs, desorbs, evaporates or condenses one or more gaseous species from or to a surrounding gas; and at least one second substrate operatively associated with the first substrate. The second substrate includes a surface for supporting the continuous flow of the liquid thereon and is adapted to carry a heat exchange fluid therethrough, wherein heat transfer occurs between the liquid and the heat exchange fluid.

  6. Heat and mass exchanger

    DOE Patents [OSTI]

    Lowenstein, Andrew (Princeton, NJ); Sibilia, Marc J. (Princeton, NJ); Miller, Jeffrey A. (Hopewell, NJ); Tonon, Thomas (Princeton, NJ)

    2007-09-18

    A mass and heat exchanger includes at least one first substrate with a surface for supporting a continuous flow of a liquid thereon that either absorbs, desorbs, evaporates or condenses one or more gaseous species from or to a surrounding gas; and at least one second substrate operatively associated with the first substrate. The second substrate includes a surface for supporting the continuous flow of the liquid thereon and is adapted to carry a heat exchange fluid therethrough, wherein heat transfer occurs between the liquid and the heat exchange fluid.

  7. Passive solar space heating

    SciTech Connect (OSTI)

    Balcomb, J.D.

    1980-01-01

    An overview of passive solar space heating is presented indicating trends in design, new developments, performance measures, analytical design aids, and monitored building results.

  8. HEATS: Thermal Energy Storage

    SciTech Connect (OSTI)

    2012-01-01

    HEATS Project: The 15 projects that make up ARPA-Es HEATS program, short for High Energy Advanced Thermal Storage, seek to develop revolutionary, cost-effective ways to store thermal energy. HEATS focuses on 3 specific areas: 1) developing high-temperature solar thermal energy storage capable of cost-effectively delivering electricity around the clock and thermal energy storage for nuclear power plants capable of cost-effectively meeting peak demand, 2) creating synthetic fuel efficiently from sunlight by converting sunlight into heat, and 3) using thermal energy storage to improve the driving range of electric vehicles (EVs) and also enable thermal management of internal combustion engine vehicles.

  9. Increasing Confidence In Geothermal Heat Pump Design Methods

    SciTech Connect (OSTI)

    Shonder, John A; Hughes, Patrick

    1998-03-01

    Sizing the ground heat exchanger is one of the most important tasks in the design of a geothermal heat pump (GHP) system. Undersizing the heat exchanger can result in poor operating efficiency, reduced comfort, and nuisance heat pump lockouts on safety controls, while an oversized heat exchanger increases the installation cost of the system. The cost of ground loop installation may mean the difference between a feasible and an unfeasible project. Thus there are strong incentives to select heat exchanger lengths which allow satisfactory performance under all operating conditions within a feasible project budget. Sizing a ground heat exchanger is not a simple calculation. In the first place, there is usually some uncertainty in the peak block and annual space conditioning loads for the building to be served by the GHPs. The thermal properties of the soil formation may be unknown as well. Drilling logs and core samples can identify the soil type, but handbook values for the thermal properties of soils vary widely. Properly-done short-term on-site tests and data analysis to obtain thermal properties provide more accurate information, but since these tests are expensive they are usually only feasible in large projects. Given the uncertainties inherent in the process, if designers were truly working 'close to the edge' - selecting the absolute minimum heat exchanger length required to meet the predicted loads - one would expect to see more examples of undersized heat exchangers. Indeed there have been a few. However, over the past twenty years GHPs have been installed and successfully operated at thousands of locations all over the world. Conversations with customers and facility managers reveal a high degree of satisfaction with the technology, but studies of projects reveal far more cases of generously sized ground heat exchangers than undersized ones. This indicates that the uncertainties in space conditioning loads and soil properties are covered by a factor of safety. These conservative designs increase the installed cost of GHP systems, limiting their use and applicability. Moreover, as ground heat exchanger sizing methods have improved, they have suggested (and field tests are beginning to verify) that standard bore backfill practices lead to unnecessarily large ground heat exchangers. Growing evidence suggests that in many applications use of sand backfill with a grout plug at the surface, or use of bottom-to-top thermally enhanced grout, may provide groundwater protection equal to current practice at far less cost. Site tests of thermal properties provides more accurate information, but since these tests are expensive they are usually only performed in large projects. Even so, because soil properties can vary over a distance as small as a few feet, the value of these tests is limited. One objective of ongoing research at the Oak Ridge National Laboratory (ORNL) is to increase designers confidence in available ground heat exchanger sizing methods that lead to reliable yet cost-effective designs. To this end we have developed research-grade models that address the interactions between buildings, geothermal heat pump systems and ground heat exchangers The first application of these models was at Fort Polk, Louisiana, where the space conditioning systems of over 4,000 homes were replaced with geothermal heat pumps (Shonder and Hughes, 1997; Hughes et. al., 1997). At Fort Polk, the models were calibrated to detailed data from one of the residences. Data on the energy use of the heat pump, combined with inlet and outlet water temperature and flow rate in the ground heat exchangers, allowed us to determine the thermal properties of the soil formation being experienced by the operating GHP system. Outputs from the models provide all the data required by the various commercially-available ground loop sizing programs. Accurate knowledge of both the building loads and the soil properties eliminated the uncertainty normally associated with the design process, and allowed us to compare the predictions of the commercially-available

  10. Heat pipes and use of heat pipes in furnace exhaust

    DOE Patents [OSTI]

    Polcyn, Adam D. (Pittsburgh, PA)

    2010-12-28

    An array of a plurality of heat pipe are mounted in spaced relationship to one another with the hot end of the heat pipes in a heated environment, e.g. the exhaust flue of a furnace, and the cold end outside the furnace. Heat conversion equipment is connected to the cold end of the heat pipes.

  11. First university owned district heating system using biomass heat

    E-Print Network [OSTI]

    Northern British Columbia, University of

    Highlights First university owned district heating system using biomass heat Capacity: 15 MMBtu Main Campus District Heating Performance Avoided: 3500 tonnes of CO2 Particulate: less than 10 mg District Heating Goals To displace 85% of natural gas used for core campus heating. Fuel Bunker Sawmill

  12. 4.A. HEAT FLOW 119 4.A. Heat flow

    E-Print Network [OSTI]

    Hunter, John K.

    denote the temperature, g : R the rate per unit volume at which heat sources create energy inside the body, and q : Rn the heat flux. That is, the rate per unit area at which heat energy diffuses across of energy implies that for any smooth open set the heat flux out of is equal to the rate at which heat

  13. Proceedings of Heat Transfer 2003: ASME Summer Heat Transfer Conference

    E-Print Network [OSTI]

    Kandlikar, Satish

    Proceedings of Heat Transfer 2003: ASME Summer Heat Transfer Conference Las Vegas, Nevada, USA July 21-23, 2003 HT2003-47449 HEAT TRANSFER FROM A MOVING AND EVAPORATING MENISCUS ON A HEATED SURFACE meniscus with complete evaporation of water without any meniscus break-up. The experimental heat transfer

  14. Heat Integrate Heat Engines in Process Plants

    E-Print Network [OSTI]

    Hindmarsh, E.; Boland, D.; Townsend, D. W.

    1986-01-01

    -06-75 Proceedings from the Eighth Annual Industrial Energy Technology Conference, Houston, TX, June 17-19, 1986 I I APPROPRIATE/INAPPROPRIATE INTEGRATION OF HEiT PUMPS, engine transfers h'eat across the' process; pinch.'" . . :i".p., J The insights...

  15. Microchannel heat sink assembly

    DOE Patents [OSTI]

    Bonde, W.L.; Contolini, R.J.

    1992-03-24

    The present invention provides a microchannel heat sink with a thermal range from cryogenic temperatures to several hundred degrees centigrade. The heat sink can be used with a variety of fluids, such as cryogenic or corrosive fluids, and can be operated at a high pressure. The heat sink comprises a microchannel layer preferably formed of silicon, and a manifold layer preferably formed of glass. The manifold layer comprises an inlet groove and outlet groove which define an inlet manifold and an outlet manifold. The inlet manifold delivers coolant to the inlet section of the microchannels, and the outlet manifold receives coolant from the outlet section of the microchannels. In one embodiment, the manifold layer comprises an inlet hole extending through the manifold layer to the inlet manifold, and an outlet hole extending through the manifold layer to the outlet manifold. Coolant is supplied to the heat sink through a conduit assembly connected to the heat sink. A resilient seal, such as a gasket or an O-ring, is disposed between the conduit and the hole in the heat sink in order to provide a watertight seal. In other embodiments, the conduit assembly may comprise a metal tube which is connected to the heat sink by a soft solder. In still other embodiments, the heat sink may comprise inlet and outlet nipples. The present invention has application in supercomputers, integrated circuits and other electronic devices, and is suitable for cooling materials to superconducting temperatures. 13 figs.

  16. Microchannel heat sink assembly

    DOE Patents [OSTI]

    Bonde, Wayne L. (Livermore, CA); Contolini, Robert J. (Pleasanton, CA)

    1992-01-01

    The present invention provides a microchannel heat sink with a thermal range from cryogenic temperatures to several hundred degrees centigrade. The heat sink can be used with a variety of fluids, such as cryogenic or corrosive fluids, and can be operated at a high pressure. The heat sink comprises a microchannel layer preferably formed of silicon, and a manifold layer preferably formed of glass. The manifold layer comprises an inlet groove and outlet groove which define an inlet manifold and an outlet manifold. The inlet manifold delivers coolant to the inlet section of the microchannels, and the outlet manifold receives coolant from the outlet section of the microchannels. In one embodiment, the manifold layer comprises an inlet hole extending through the manifold layer to the inlet manifold, and an outlet hole extending through the manifold layer to the outlet manifold. Coolant is supplied to the heat sink through a conduit assembly connected to the heat sink. A resilient seal, such as a gasket or an O-ring, is disposed between the conduit and the hole in the heat sink in order to provide a watetight seal. In other embodiments, the conduit assembly may comprise a metal tube which is connected to the heat sink by a soft solder. In still other embodiments, the heat sink may comprise inlet and outlet nipples. The present invention has application in supercomputers, integrated circuits and other electronic devices, and is suitable for cooling materials to superconducting temperatures.

  17. Chemical heat pump

    DOE Patents [OSTI]

    Greiner, Leonard (2853-A Hickory Pl., Costa Mesa, CA 92626)

    1984-01-01

    A chemical heat pump system is disclosed for use in heating and cooling structures such as residences or commercial buildings. The system is particularly adapted to utilizing solar energy, but also increases the efficiency of other forms of thermal energy when solar energy is not available. When solar energy is not available for relatively short periods of time, the heat storage capacity of the chemical heat pump is utilized to heat the structure, as during nighttime hours. The design also permits home heating from solar energy when the sun is shining. The entire system may be conveniently rooftop located. In order to facilitate intallation on existing structures, the absorber and vaporizer portions of the system may each be designed as flat, thin wall, thin pan vessels which materially increase the surface area available for heat transfer. In addition, this thin, flat configuration of the absorber and its thin walled (and therefore relatively flexible) construction permits substantial expansion and contraction of the absorber material during vaporization and absorption without generating voids which would interfere with heat transfer.

  18. Chemical heat pump

    DOE Patents [OSTI]

    Greiner, Leonard (2853-A Hickory Pl., Costa Mesa, CA 92626)

    1984-01-01

    A chemical heat pump system is disclosed for use in heating and cooling structures such as residences or commercial buildings. The system is particularly adapted to utilizing solar energy, but also increases the efficiency of other forms of thermal energy when solar energy is not available. When solar energy is not available for relatively short periods of time, the heat storage capacity of the chemical heat pump is utilized to heat the structure, as during nighttime hours. The design also permits home heating from solar energy when the sun is shining. The entire system may be conveniently rooftop located. In order to facilitate installation on existing structures, the absorber and vaporizer portions of the system may each be designed as flat, thin wall, thin pan vessels which materially increase the surface area available for heat transfer. In addition, this thin, flat configuration of the absorber and its thin walled (and therefore relatively flexible) construction permits substantial expansion and contraction of the absorber material during vaporization and absorption without generating voids which would interfere with heat transfer.

  19. Chemical heat pump

    DOE Patents [OSTI]

    Greiner, Leonard (2853-A Hickory Pl., Costa Mesa, CA 92626)

    1984-01-01

    A chemical heat pump system is disclosed for use in heating and cooling structures such as residences or commercial buildings. The system is particularly adapted to utilizing solar energy, but also increases the efficiency of other forms of thermal energy when solar energy is not available. When solar energy is not available for relatively short periods of time, the heat storage capacity of the chemical heat pump is utilized to heat the structure, as during nighttime hours. The design also permits home heating from solar energy when the sun is shining. The entire system may be conveniently rooftop located. In order to faciliate installation on existing structures, the absorber and vaporizer portions of the system may each be designed as flat, thin wall, thin pan vessels which materially increase the surface area available for heat transfer. In addition, this thin, flat configuration of the absorber and its thin walled (and therefore relatively flexible) construction permits substantial expansion and contraction of the absorber material during vaporization and absorption without generating voids which would interfere with heat transfer.

  20. Chemical heat pump

    DOE Patents [OSTI]

    Greiner, Leonard (2853-A Hickory Pl., Costa Mesa, CA 92626)

    1981-01-01

    A chemical heat pump system is disclosed for use in heating and cooling structures such as residences or commercial buildings. The system is particularly adapted to utilizing solar energy, but also increases the efficiency of other forms of thermal energy when solar energy is not available. When solar energy is not available for relatively short periods of time, the heat storage capacity of the chemical heat pump is utilized to heat the structure, as during nighttime hours. The design also permits home heating from solar energy when the sun is shining. The entire system may be conveniently rooftop located. In order to facilitate installation on existing structures, the absorber and vaporizer portions of the system may each be designed as flat, thin wall, thin pan vessels which materially increase the surface area available for heat transfer. In addition, this thin, flat configuration of the absorber and its thin walled (and therefore relatively flexible) construction permits substantial expansion and contraction of the absorber material during vaporization and absorption without generating voids which would interfere with heat transfer.

  1. Knudsen heat capacity

    SciTech Connect (OSTI)

    Babac, Gulru; Reese, Jason M.

    2014-05-15

    We present a Knudsen heat capacity as a more appropriate and useful fluid property in micro/nanoscale gas systems than the constant pressure heat capacity. At these scales, different fluid processes come to the fore that are not normally observed at the macroscale. For thermodynamic analyses that include these Knudsen processes, using the Knudsen heat capacity can be more effective and physical. We calculate this heat capacity theoretically for non-ideal monatomic and diatomic gases, in particular, helium, nitrogen, and hydrogen. The quantum modification for para and ortho hydrogen is also considered. We numerically model the Knudsen heat capacity using molecular dynamics simulations for the considered gases, and compare these results with the theoretical ones.

  2. Improved solar heating systems

    DOE Patents [OSTI]

    Schreyer, J.M.; Dorsey, G.F.

    1980-05-16

    An improved solar heating system is described in which the incident radiation of the sun is absorbed on collector panels, transferred to a storage unit and then distributed as heat for a building and the like. The improvement is obtained by utilizing a storage unit comprising separate compartments containing an array of materials having different melting points ranging from 75 to 180/sup 0/F. The materials in the storage system are melted in accordance with the amount of heat absorbed from the sun and then transferred to the storage system. An efficient low volume storage system is provided by utilizing the latent heat of fusion of the materials as they change states in storing ad releasing heat for distribution.

  3. Solar heating system

    DOE Patents [OSTI]

    Schreyer, James M. (Oak Ridge, TN); Dorsey, George F. (Concord, TN)

    1982-01-01

    An improved solar heating system in which the incident radiation of the sun is absorbed on collector panels, transferred to a storage unit and then distributed as heat for a building and the like. The improvement is obtained by utilizing a storage unit comprising separate compartments containing an array of materials having different melting points ranging from 75.degree. to 180.degree. F. The materials in the storage system are melted in accordance with the amount of heat absorbed from the sun and then transferred to the storage system. An efficient low volume storage system is provided by utilizing the latent heat of fusion of the materials as they change states in storing and releasing heat for distribution.

  4. Heat Exchangers for Solar Water Heating Systems | Department...

    Broader source: Energy.gov (indexed) [DOE]

    from iStockphoto.com Image of a heat exchanger. | Photo from iStockphoto.com Solar water heating systems use heat exchangers to transfer solar energy absorbed in solar...

  5. Heat Transfer Fluids for Solar Water Heating Systems | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    commonly used as the heat transfer fluid in refrigerators, air conditioners, and heat pumps. They generally have a low boiling point and a high heat capacity. This enables a...

  6. Heat Exchangers for Solar Water Heating Systems | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    air used to heat water or a space. Heat exchangers can be made of steel, copper, bronze, stainless steel, aluminum, or cast iron. Solar heating systems usually use copper, because...

  7. Abstract of Doctoral Dissertation in "Engineering and Public Policy, EPP" Retrospectiveand Prospective Analysis of Incentives for Wind Power in

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    Prospective Analysis of Incentives for Wind Power in Author: Ivonne Pea (pena.ivonne@gmail.com) 2014 IST main parts: a first introductory section, a retrospective study of wind power in Portugal and a prospective analysis of the Portuguese wind power sector. The introductory section is a brief overview

  8. Conflicting Investment Incentives in Electricity Transmission Enzo Sauma, Student Member, IEEE and Shmuel S. Oren, Fellow, IEEE

    E-Print Network [OSTI]

    , this principle is not always true in deregulated electricity systems, where transfers are not always feasible composed of two nodes satisfying their electricity demand with local generators. Assume the1 Conflicting Investment Incentives in Electricity Transmission Enzo Sauma, Student Member, IEEE

  9. Incentives to Accelerate the Penetration of Electricity in the Industrial Sector by Promoting New Technologies: A French Experiment

    E-Print Network [OSTI]

    Bouchet, J.; Froehlich, R.

    1983-01-01

    A major problem encountered when trying to speed up electrification of French industry has been 'hot to finance, at end-user's level, investments related to such a change of technology'. Government incentives, the aims of which are to help saving...

  10. Report on inspection of the performance based incentive program at the Richland Operations Office

    SciTech Connect (OSTI)

    NONE

    1997-03-10

    The Fiscal Year (FY) 1995 Performance Based Incentive (PBI) Program at the Department of Energy`s (DOE) Richland Operations Office (Richland) was initiated by Richland as one part of the broader DOE Contract Reform Initiative being implemented at the Hanford Site in FY 1995. This program was identified as an area of concern by the Office of Inspections as a result of previous inspection work. Specifically, during a limited review of the construction of an Effluent Treatment Facility at the Hanford Site, we were unable to identify any written policies describing PBI program controls or implementation procedures. We were told that Richland Operations Office Program Management personnel were not directly involved in the selection of the Effluent Treatment Facility project for the PBI Program, or in the determination that this particular PBI would be established with a potential fee of $1 million.

  11. Micro heat barrier

    DOE Patents [OSTI]

    Marshall, Albert C.; Kravitz, Stanley H.; Tigges, Chris P.; Vawter, Gregory A.

    2003-08-12

    A highly effective, micron-scale micro heat barrier structure and process for manufacturing a micro heat barrier based on semiconductor and/or MEMS fabrication techniques. The micro heat barrier has an array of non-metallic, freestanding microsupports with a height less than 100 microns, attached to a substrate. An infrared reflective membrane (e.g., 1 micron gold) can be supported by the array of microsupports to provide radiation shielding. The micro heat barrier can be evacuated to eliminate gas phase heat conduction and convection. Semi-isotropic, reactive ion plasma etching can be used to create a microspike having a cusp-like shape with a sharp, pointed tip (<0.1 micron), to minimize the tip's contact area. A heat source can be placed directly on the microspikes. The micro heat barrier can have an apparent thermal conductivity in the range of 10.sup.-6 to 10.sup.-7 W/m-K. Multiple layers of reflective membranes can be used to increase thermal resistance.

  12. Integrating preconcentrator heat controller

    DOE Patents [OSTI]

    Bouchier, Francis A. (Albuquerque, NM); Arakaki, Lester H. (Edgewood, NM); Varley, Eric S. (Albuquerque, NM)

    2007-10-16

    A method and apparatus for controlling the electric resistance heating of a metallic chemical preconcentrator screen, for example, used in portable trace explosives detectors. The length of the heating time-period is automatically adjusted to compensate for any changes in the voltage driving the heating current across the screen, for example, due to gradual discharge or aging of a battery. The total deposited energy in the screen is proportional to the integral over time of the square of the voltage drop across the screen. Since the net temperature rise, .DELTA.T.sub.s, of the screen, from beginning to end of the heating pulse, is proportional to the total amount of heat energy deposited in the screen during the heating pulse, then this integral can be calculated in real-time and used to terminate the heating current when a pre-set target value has been reached; thereby providing a consistent and reliable screen temperature rise, .DELTA.T.sub.s, from pulse-to-pulse.

  13. Economic Incentives for Cybersecurity: Using Economics to Design Technologies Ready for Deployment

    SciTech Connect (OSTI)

    Vishik, Claire; Sheldon, Frederick T; Ott, David

    2013-01-01

    Cybersecurity practice lags behind cyber technology achievements. Solutions designed to address many problems may and do exist but frequently cannot be broadly deployed due to economic constraints. Whereas security economics focuses on the cost/benefit analysis and supply/demand, we believe that more sophisticated theoretical approaches, such as economic modeling, rarely utilized, would derive greater societal benefits. Unfortunately, today technologists pursuing interesting and elegant solutions have little knowledge of the feasibility for broad deployment of their results and cannot anticipate the influences of other technologies, existing infrastructure, and technology evolution, nor bring the solutions lifecycle into the equation. Additionally, potentially viable solutions are not adopted because the risk perceptions by potential providers and users far outweighs the economic incentives to support introduction/adoption of new best practices and technologies that are not well enough defined. In some cases, there is no alignment with redominant and future business models as well as regulatory and policy requirements. This paper provides an overview of the economics of security, reviewing work that helped to define economic models for the Internet economy from the 1990s. We bring forward examples of potential use of theoretical economics in defining metrics for emerging technology areas, positioning infrastructure investment, and building real-time response capability as part of software development. These diverse examples help us understand the gaps in current research. Filling these gaps will be instrumental for defining viable economic incentives, economic policies, regulations as well as early-stage technology development approaches, that can speed up commercialization and deployment of new technologies in cybersecurity.

  14. PIA - Northeast Home Heating Oil Reserve System (Heating Oil...

    Energy Savers [EERE]

    Home Heating Oil Reserve System (Heating Oil) More Documents & Publications PIA - WEB Physical Security Major Application PIA - GovTrip (DOE data) PIA - WEB Unclassified...

  15. Heat Flow, Heat Transfer And Lithosphere Rheology In Geothermal...

    Open Energy Info (EERE)

    Heat Flow, Heat Transfer And Lithosphere Rheology In Geothermal Areas- Features And Examples Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article:...

  16. Condensing Heating and Water Heating Equipment Workshop Location...

    Energy Savers [EERE]

    Condensing Heating and Water Heating Equipment Workshop Location: Washington Gas Light Appliance Training Facility 6801 Industrial Road Springfield, VA Date: October 9, 2014 Time:...

  17. TRANSPARENT HEAT MIRRORS FOR PASSIVE SOLAR HEATING APPLICATIONS

    E-Print Network [OSTI]

    Selkowitz, S.

    2011-01-01

    advantage of light transmission through heat mirrors may notimportant but heat gain may not be, the transmission windowheat mirror coating alone (without substrate losses) is a solar transmission

  18. Low-Cost Gas Heat Pump for Building Space Heating

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Low-Cost Gas Heat Pump for Building Space Heating 2015 Building Technologies Office Peer Review Michael Garrabrant mgarrabrant@stonemtntechnologies.com Stone Mountain Technologies,...

  19. Low-Cost Gas Heat Pump for Building Space Heating

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Low-Cost Gas Heat Pump for Building Space Heating 2014 Building Technologies Office Peer Review Michael Garrabrant mgarrabrant@stonemtntechnologies.com Stone Mountain Technologies,...

  20. Molecular heat pump

    E-Print Network [OSTI]

    Dvira Segal; Abraham Nitzan

    2005-10-11

    We propose a novel molecular device that pumps heat against a thermal gradient. The system consists of a molecular element connecting two thermal reservoirs that are characterized by different spectral properties. The pumping action is achieved by applying an external force that periodically modulates molecular levels. This modulation affects periodic oscillations of the internal temperature of the molecule and the strength of its coupling to each reservoir resulting in a net heat flow in the desired direction. The heat flow is examined in the slow and fast modulation limits and for different modulation waveforms, thus making it possible to optimize the device performance.

  1. Heat treatment furnace

    DOE Patents [OSTI]

    Seals, Roland D; Parrott, Jeffrey G; DeMint, Paul D; Finney, Kevin R; Blue, Charles T

    2014-10-21

    A furnace heats through both infrared radiation and convective air utilizing an infrared/purge gas design that enables improved temperature control to enable more uniform treatment of workpieces. The furnace utilizes lamps, the electrical end connections of which are located in an enclosure outside the furnace chamber, with the lamps extending into the furnace chamber through openings in the wall of the chamber. The enclosure is purged with gas, which gas flows from the enclosure into the furnace chamber via the openings in the wall of the chamber so that the gas flows above and around the lamps and is heated to form a convective mechanism in heating parts.

  2. Stirling engine heating system

    SciTech Connect (OSTI)

    Johansson, L.N.; Houtman, W.H.; Percival, W.H.

    1988-06-28

    A hot gas engine is described wherein a working gas flows back and forth in a closed path between a relatively cooler compression cylinder side of the engine and a relatively hotter expansion cylinder side of the engine and the path contains means including a heat source and a heat sink acting upon the gas in cooperation with the compression and expansion cylinders to cause the gas to execute a thermodynamic cycle wherein useful mechanical output power is developed by the engine, the improvement in the heat source which comprises a plurality of individual tubes each forming a portion of the closed path for the working gas.

  3. Specifying Waste Heat Boilers

    E-Print Network [OSTI]

    Ganapathy, V.

    1992-01-01

    HEAT BOILERS V.Ganapathy.ABCO Industries Abilene,Texas ABSTRACT Waste heat boilers or Heat Recovery Steam 'Generators(HRSGs) as they are often called are used to recover energy from waste gas streams in chemical plants, refineries... stream_source_info ESL-IE-92-04-42.pdf.txt stream_content_type text/plain stream_size 11937 Content-Encoding ISO-8859-1 stream_name ESL-IE-92-04-42.pdf.txt Content-Type text/plain; charset=ISO-8859-1 SPECIFYING WASTE...

  4. Heating & Cooling | Department of Energy

    Energy Savers [EERE]

    Energy Saver Heating & Cooling Heating & Cooling Heating and cooling account for about 48% of the energy use in a typical U.S. home, making it the largest energy expense for...

  5. Energy 101: Geothermal Heat Pumps

    Broader source: Energy.gov [DOE]

    An energy-efficient heating and cooling alternative, the geothermal heat pump system moves heat from the ground to a building (or from a building to the ground) through a series of flexible pipe ...

  6. Complex Compound Chemical Heat Pumps

    E-Print Network [OSTI]

    Rockenfeller, U.; Langeliers, J.; Horn, G.

    1987-01-01

    Complex-compound solid-vapor fluid pairs can be used in heat of reaction heat pumps for temperature amplifier (TA) as well as heat amplifier (HA) cycle configurations. This report describes the conceptual hardware design for complex compound...

  7. Water Heating | Department of Energy

    Energy Savers [EERE]

    Water Heating Water Heating September 2, 2015 - 11:07am Addthis Low-flow fixtures will help you reduce your hot water use and save money on your water heating bills. | Photo...

  8. Photovoltaic roof heat flux

    E-Print Network [OSTI]

    Samady, Mezhgan Frishta

    2011-01-01

    e l Atmosphere ceiling, back panel roof, exposed roof insideSAN DIEGO Photovoltaic Roof Heat Flux A Thesis submitted i no n Convection Exposed Roof Temperature Seasonal Temperature

  9. Passive solar heating analysis

    SciTech Connect (OSTI)

    Balcomb, J.D.; Jones, R.W.; Mc Farland, R.D.; Wray, W.O.

    1984-01-01

    This book discusses about the design of solar heating systems. The terms and symbols are clearly defined. Step-by-step procedures are indicated. Worked examples are given with tables, graphs, appendixes.

  10. Heating Plant Emergency Instructions

    E-Print Network [OSTI]

    de Leon, Alex R.

    Heating Plant Emergency Instructions In the event of an EMERGENCY dial 403-220-5333 for Campus room, closet or hallway (ground floor, if possible) Stay away from outside walls, windows and doors

  11. Greywater heat exchanger

    SciTech Connect (OSTI)

    Holmberg, D.

    1983-11-21

    A kilowatt meter and water meter were installed to monitor pregreywater usage. The design considerations, the heat exchanger construction and installation, and the monitoring of usage levels are described.

  12. Heat Pump Strategies and Payoffs

    E-Print Network [OSTI]

    Gilbert, J. S.

    1982-01-01

    (Evaporator) Heat Source Heat Pump Turbine Compressor Compressed Vapor Pump IZl:G1 Type IV - Rankine Cycle (Waste Heat Driven) Heat Sink (Condenser) Fig. 3 Basic Heat Pump Categories 324 ESL-IE-82-04-66 Proceedings from the Fourth Industrial... payback. 500 450 400 Leas Than G:" ~ 2! 350 2-Vear Payback .a e 300 !. E ~ 250 Simple Waste Heat Boller 200 100 1.-........_-'-_.1.---1"---.1._..&0.._1.---'-_'-__ o 10 20 30 40 50 60 70 80 Heat Removed (%) 82291 Fig. 4 Heat...

  13. Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Public Services Homes Water Heating Water Heating Infographic: Water Heaters 101 Infographic: Water Heaters 101 Everything you need to know about saving money on water...

  14. NGNP Process Heat Utilization: Liquid Metal Phase Change Heat Exchanger

    SciTech Connect (OSTI)

    Piyush Sabharwall; Mike Patterson; Vivek Utgikar; Fred Gunnerson

    2008-09-01

    One key long-standing issue that must be overcome to fully realize the successful growth of nuclear power is to determine other benefits of nuclear energy apart from meeting the electricity demands. The Next Generation Nuclear Plant (NGNP) will most likely be producing electricity and heat for the production of hydrogen and/or oil retrieval from oil sands and oil shale to help in our national pursuit of energy independence. For nuclear process heat to be utilized, intermediate heat exchange is required to transfer heat from the NGNP to the hydrogen plant or oil recovery field in the most efficient way possible. Development of nuclear reactor - process heat technology has intensified the interest in liquid metals as heat transfer media because of their ideal transport properties. Liquid metal heat exchangers are not new in practical applications. An important rational for considering liquid metals is the potential convective heat transfer is among the highest known. Thus explains the interest in liquid metals as coolant for intermediate heat exchange from NGNP. For process heat it is desired that, intermediate heat exchangers (IHX) transfer heat from the NGNP in the most efficient way possible. The production of electric power at higher efficiency via the Brayton Cycle, and hydrogen production, requires both heat at higher temperatures and high effectiveness compact heat exchangers to transfer heat to either the power or process cycle. Compact heat exchangers maximize the heat transfer surface area per volume of heat exchanger; this has the benefit of reducing heat exchanger size and heat losses. High temperature IHX design requirements are governed in part by the allowable temperature drop between the outlet and inlet of the NGNP. In order to improve the characteristics of heat transfer, liquid metal phase change heat exchangers may be more effective and efficient. This paper explores the overall heat transfer characteristics and pressure drop of the phase change heat exchanger with Na as the heat exchanger coolant. In order to design a very efficient and effective heat exchanger one must optimize the design such that we have a high heat transfer and a lower pressure drop, but there is always a trade-off between them. Based on NGNP operational parameters, a heat exchanger analysis with the sodium phase change will be presented to show that the heat exchanger has the potential for highly effective heat transfer, within a small volume at reasonable cost.

  15. Heat exchange apparatus

    DOE Patents [OSTI]

    Degtiarenko, Pavel V.

    2003-08-12

    A heat exchange apparatus comprising a coolant conduit or heat sink having attached to its surface a first radial array of spaced-apart parallel plate fins or needles and a second radial array of spaced-apart parallel plate fins or needles thermally coupled to a body to be cooled and meshed with, but not contacting the first radial array of spaced-apart parallel plate fins or needles.

  16. Freezable heat pipe

    DOE Patents [OSTI]

    Ernst, Donald M. (Leola, PA); Sanzi, James L. (Lancaster, PA)

    1981-02-03

    A heat pipe whose fluid can be repeatedly frozen and thawed without damage to the casing. An additional part is added to a conventional heat pipe. This addition is a simple porous structure, such as a cylinder, self-supporting and free standing, which is dimensioned with its diameter not spanning the inside transverse dimension of the casing, and with its length surpassing the depth of maximum liquid.

  17. Integrated heat pump water heater

    SciTech Connect (OSTI)

    Robinson, G.P.; Blackshaw, A.L.

    1986-07-08

    An integrated heat pump water heater system is described for providing either heating or cooling of an interior space, and heating water in conjunction with either the heating or cooling cycle or independently, by means of a refrigerant flowing through the system. The system consists of: a compressor; a first heat exchanger means for providing heat to the interior space in the heating cycle and for removing heat during the cooling cycle by heat transfer with a refrigerant therein; a second heat exchanger means for transferring heat to or from a refrigerant therein by heat exchanger with an exterior medium; a third heat exchanger means for transferring heat from a refrigerant therein to water circulated therethrough; a first expansion device; a second expansion device; a third expansion device; refrigerant flow connection means connected between the compressor, the heat exchanger means, and the expansion devices which may be controllably connected in alternate configurations whereby. In a first configuration the refrigerant flow is sequentially from the compressor, through the third heat exchanger means, through the second heat exchanger means, through the first expansion device, through the first heat exchanger means, and back to the compressor. In a second configuration the refrigerant flow is sequentially from the compressor, through the third heat exchanger means, through the first heat exchanger means, through the second expansion device, through the second heat exchanger means, and back to the compressor. In a third configuration the refrigerant flow is sequentially from the compressor, through the third heat exchanger means, through the third expansion device, through the second heat exchanger means, and back to the compressor.

  18. Radial flow heat exchanger

    DOE Patents [OSTI]

    Valenzuela, Javier (Hanover, NH)

    2001-01-01

    A radial flow heat exchanger (20) having a plurality of first passages (24) for transporting a first fluid (25) and a plurality of second passages (26) for transporting a second fluid (27). The first and second passages are arranged in stacked, alternating relationship, are separated from one another by relatively thin plates (30) and (32), and surround a central axis (22). The thickness of the first and second passages are selected so that the first and second fluids, respectively, are transported with laminar flow through the passages. To enhance thermal energy transfer between first and second passages, the latter are arranged so each first passage is in thermal communication with an associated second passage along substantially its entire length, and vice versa with respect to the second passages. The heat exchangers may be stacked to achieve a modular heat exchange assembly (300). Certain heat exchangers in the assembly may be designed slightly differently than other heat exchangers to address changes in fluid properties during transport through the heat exchanger, so as to enhance overall thermal effectiveness of the assembly.

  19. Convective heat flow probe

    DOE Patents [OSTI]

    Dunn, J.C.; Hardee, H.C.; Striker, R.P.

    1984-01-09

    A convective heat flow probe device is provided which measures heat flow and fluid flow magnitude in the formation surrounding a borehole. The probe comprises an elongate housing adapted to be lowered down into the borehole; a plurality of heaters extending along the probe for heating the formation surrounding the borehole; a plurality of temperature sensors arranged around the periphery of the probe for measuring the temperature of the surrounding formation after heating thereof by the heater elements. The temperature sensors and heater elements are mounted in a plurality of separate heater pads which are supported by the housing and which are adapted to be radially expanded into firm engagement with the walls of the borehole. The heat supplied by the heater elements and the temperatures measured by the temperature sensors are monitored and used in providing the desired measurements. The outer peripheral surfaces of the heater pads are configured as segments of a cylinder and form a full cylinder when taken together. A plurality of temperature sensors are located on each pad so as to extend along the length and across the width thereof, with a heating element being located in each pad beneath the temperature sensors. An expansion mechanism driven by a clamping motor provides expansion and retraction of the heater pads and expandable packet-type seals are provided along the probe above and below the heater pads.

  20. Intrinsically irreversible heat engine

    DOE Patents [OSTI]

    Wheatley, J.C.; Swift, G.W.; Migliori, A.

    1984-12-25

    A class of heat engines based on an intrinsically irreversible heat transfer process is disclosed. In a typical embodiment the engine comprises a compressible fluid that is cyclically compressed and expanded while at the same time being driven in reciprocal motion by a positive displacement drive means. A second thermodynamic medium is maintained in imperfect thermal contact with the fluid and bears a broken thermodynamic symmetry with respect to the fluid. The second thermodynamic medium is a structure adapted to have a low fluid flow impedance with respect to the compressible fluid, and which is further adapted to be in only moderate thermal contact with the fluid. In operation, thermal energy is pumped along the second medium due to a phase lag between the cyclical heating and cooling of the fluid and the resulting heat conduction between the fluid and the medium. In a preferred embodiment the engine comprises an acoustical drive and a housing containing a gas which is driven at a resonant frequency so as to be maintained in a standing wave. Operation of the engine at acoustic frequencies improves the power density and coefficient of performance. The second thermodynamic medium can be coupled to suitable heat exchangers to utilize the engine as a simple refrigeration device having no mechanical moving parts. Alternatively, the engine is reversible in function so as to be utilizable as a prime mover by coupling it to suitable sources and sinks of heat. 11 figs.

  1. Intrinsically irreversible heat engine

    DOE Patents [OSTI]

    Wheatley, J.C.; Swift, G.W.; Migliori, A.

    1984-01-01

    A class of heat engines based on an intrinsically irreversible heat transfer process is disclosed. In a typical embodiment the engine comprises a compressible fluid that is cyclically compressed and expanded while at the same time being driven in reciprocal motion by a positive displacement drive means. A second thermodynamic medium is maintained in imperfect thermal contact with the fluid and bears a broken thermodynamic symmetry with respect to the fluid. The second thermodynamic medium is a structure adapted to have a low fluid flow impedance with respect to the compressible fluid, and which is further adapted to be in only moderate thermal contact with the fluid. In operation, thermal energy is pumped along the second medium due to a phase lag between the cyclical heating and cooling of the fluid and the resulting heat conduction between the fluid and the medium. In a preferred embodiment the engine comprises an acoustical drive and a housing containing a gas which is driven at a resonant frequency so as to be maintained in a standing wave. Operation of the engine at acoustic frequencies improves the power density and coefficient of performance. The second thermodynamic medium can be coupled to suitable heat exchangers to utilize the engine as a simple refrigeration device having no mechanical moving parts. Alternatively, the engine is reversible in function so as to be utilizable as a prime mover by coupling it to suitable sources and sinks of heat.

  2. Intrinsically irreversible heat engine

    DOE Patents [OSTI]

    Wheatley, John C. (Los Alamos, NM); Swift, Gregory W. (Los Alamos, NM); Migliori, Albert (Santa Fe, NM)

    1984-01-01

    A class of heat engines based on an intrinsically irreversible heat transfer process is disclosed. In a typical embodiment the engine comprises a compressible fluid that is cyclically compressed and expanded while at the same time being driven in reciprocal motion by a positive displacement drive means. A second thermodynamic medium is maintained in imperfect thermal contact with the fluid and bears a broken thermodynamic symmetry with respect to the fluid. the second thermodynamic medium is a structure adapted to have a low fluid flow impedance with respect to the compressible fluid, and which is further adapted to be in only moderate thermal contact with the fluid. In operation, thermal energy is pumped along the second medium due to a phase lag between the cyclical heating and cooling of the fluid and the resulting heat conduction between the fluid and the medium. In a preferred embodiment the engine comprises an acoustical drive and a housing containing a gas which is driven at a resonant frequency so as to be maintained in a standing wave. Operation of the engine at acoustic frequencies improves the power density and coefficient of performance. The second thermodynamic medium can be coupled to suitable heat exchangers to utilize the engine as a simple refrigeration device having no mechanical moving parts. Alternatively, the engine is reversible in function so as to be utilizable as a prime mover by coupling it to suitable sources and sinks of heat.

  3. Theory of Off Resonance Heat:ing J .C. SPROTI

    E-Print Network [OSTI]

    Sprott, Julien Clinton

    The heating rate for a cold, tenuous, unifonn plasma in a unifonn magnetic field can be written as (1) where E previously proved successful for calculating resonance heating rates. II. Upper off Resonance Heating, and the resulting heating rate is independent of the collision frequency v . It is often said that there can

  4. Solar air heating system for combined DHW and space heating

    E-Print Network [OSTI]

    Solar air heating system for combined DHW and space heating solar air collector PV-panel fannon-return valve DHW tank mantle cold waterhot water roof Solar Energy Centre Denmark Danish Technological Institute SEC-R-29 #12;Solar air heating system for combined DHW and space heating Sren stergaard Jensen

  5. Heat exchanger device and method for heat removal or transfer

    DOE Patents [OSTI]

    Koplow, Jeffrey P. (San Ramon, CA)

    2012-07-24

    Systems and methods for a forced-convection heat exchanger are provided. In one embodiment, heat is transferred to or from a thermal load in thermal contact with a heat conducting structure, across a narrow air gap, to a rotating heat transfer structure immersed in a surrounding medium such as air.

  6. Heat exchanger device and method for heat removal or transfer

    DOE Patents [OSTI]

    Koplow, Jeffrey P.

    2015-12-08

    Systems and methods for a forced-convection heat exchanger are provided. In one embodiment, heat is transferred to or from a thermal load in thermal contact with a heat conducting structure, across a narrow air gap, to a rotating heat transfer structure immersed in a surrounding medium such as air.

  7. Heat exchanger device and method for heat removal or transfer

    DOE Patents [OSTI]

    Koplow, Jeffrey P

    2013-12-10

    Systems and methods for a forced-convection heat exchanger are provided. In one embodiment, heat is transferred to or from a thermal load in thermal contact with a heat conducting structure, across a narrow air gap, to a rotating heat transfer structure immersed in a surrounding medium such as air.

  8. PECO Energy (Gas)- Heating Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    The PECO Smart Natural Gas Efficiency Upgrade Program offers rebates and incentives to commercial or residential customers that install an ENERGY STAR qualified high-efficiency natural gas furna...

  9. Combined Heat and Power Loan Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment up to five megawatts at ...

  10. Combined Heat and Power Grant Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment up to five megawatts at ...

  11. Extension and improvement of Central Station District heating budget period 1 and 2, Krakow Clean Fossil Fuels and Energy Efficiency Program. Final report

    SciTech Connect (OSTI)

    NONE

    1997-07-01

    Project aim was to reduce pollution levels in the City of Krakow through the retirement of coal-fired (hand and mechanically-stoked) boiler houses. This was achieved by identifying attractive candidates and connecting them to the Krakow district heating system, thus permitting them to eliminate boiler operations. Because coal is less costly than district hot water, the district heating company Miejskie Przedsiebiorstwo Energetyki Cieplnej S.A., henceforth identified as MPEC, needed to provide potential customers with incentives for purchasing district heat. These incentives consisted of offerings which MPEC made to the prospective client. The offerings presented the economic and environmental benefits to district heating tie-in and also could include conservation studies of the facilities, so that consumption of energy could be reduced and the cost impact on operations mitigated. Because some of the targeted boiler houses were large, the capacity of the district heating network required enhancement at strategic locations. Consequently, project construction work included both enhancement to the district piping network as well as facility tie-ins. The process of securing new customers necessitated the strengthening of MPEC`s competitive position in Krakow`s energy marketplace, which in turn required improvements in marketing, customer service, strategic planning, and project management. Learning how US utilities address these challenges became an integral segment of the project`s scope.

  12. Toolbox Safety Talk Heat Stress

    E-Print Network [OSTI]

    Pawlowski, Wojtek

    Toolbox Safety Talk Heat Stress Environmental Health & Safety Facilities Safety & Health Section for inducing heat stress. When the body is unable to cool itself by sweating, several heat-induced illnesses Stress Know signs/symptoms of heat-related illnesses; monitor yourself and coworkers. Block out

  13. Guide to Geothermal Heat Pumps

    SciTech Connect (OSTI)

    None

    2011-02-01

    Geothermal heat pumps, also known as ground source heat pumps, geoexchange, water-source, earth-coupled, and earth energy heat pumps, take advantage of this resource and represent one of the most efficient and durable options on the market to heat and cool your home.

  14. Heat exchanger-accumulator

    DOE Patents [OSTI]

    Ecker, Amir L. (Dallas, TX)

    1980-01-01

    What is disclosed is a heat exchanger-accumulator for vaporizing a refrigerant or the like, characterized by an upright pressure vessel having a top, bottom and side walls; an inlet conduit eccentrically and sealingly penetrating through the top; a tubular overflow chamber disposed within the vessel and sealingly connected with the bottom so as to define an annular outer volumetric chamber for receiving refrigerant; a heat transfer coil disposed in the outer volumetric chamber for vaporizing the liquid refrigerant that accumulates there; the heat transfer coil defining a passageway for circulating an externally supplied heat exchange fluid; transferring heat efficiently from the fluid; and freely allowing vaporized refrigerant to escape upwardly from the liquid refrigerant; and a refrigerant discharge conduit penetrating sealingly through the top and traversing substantially the length of the pressurized vessel downwardly and upwardly such that its inlet is near the top of the pressurized vessel so as to provide a means for transporting refrigerant vapor from the vessel. The refrigerant discharge conduit has metering orifices, or passageways, penetrating laterally through its walls near the bottom, communicating respectively interiorly and exteriorly of the overflow chamber for controllably carrying small amounts of liquid refrigerant and oil to the effluent stream of refrigerant gas.

  15. Heat distribution ceramic processing method

    DOE Patents [OSTI]

    Tiegs, Terry N. (Lenoir City, TN); Kiggans, Jr., James O. (Oak Ridge, TN)

    2001-01-01

    A multi-layered heat distributor system is provided for use in a microwave process. The multi-layered heat distributors includes a first inner layer of a high thermal conductivity heat distributor material, a middle insulating layer and an optional third insulating outer layer. The multi-layered heat distributor system is placed around the ceramic composition or article to be processed and located in a microwave heating system. Sufficient microwave energy is applied to provide a high density, unflawed ceramic product.

  16. Electrochemical heat engine

    DOE Patents [OSTI]

    Elliott, Guy R. B. (Los Alamos, NM); Holley, Charles E. (Alcalde, NM); Houseman, Barton L. (Cockeysville, MD); Sibbitt, Jr., Wilmer L. (Albuquerque, NM)

    1978-01-01

    Electrochemical heat engines produce electrochemical work, and mechanical motion is limited to valve and switching actions as the heat-to-work cycles are performed. The electrochemical cells of said heat engines use molten or solid electrolytes at high temperatures. One or more reactions in the cycle will generate a gas at high temperature which can be condensed at a lower temperature with later return of the condensate to electrochemical cells. Sodium, potassium, and cesium are used as the working gases for high temperature cells (above 600 K) with halogen gases or volatile halides being used at lower temperature. Carbonates and halides are used as molten electrolytes and the solid electrolyte in these melts can also be used as a cell separator.

  17. Social Media: Heat #HeatSafety #BeatTheHeat #SummerSafety

    E-Print Network [OSTI]

    ; Facebook: Did you know the air temperature can actually feel hotter than what the thermometer reads to help the NWS build a WeatherReady Nation. Facebook: Heat is typically the leading cause.weather.gov/heat #HeatSafety #12; Facebook: Heat waves can be deadly! They can also happen anywhere in the U

  18. Optical heat flux gauge

    DOE Patents [OSTI]

    Noel, Bruce W. (Espanola, NM); Borella, Henry M. (Santa Barbara, CA); Cates, Michael R. (Oak Ridge, TN); Turley, W. Dale (Santa Barbara, CA); MacArthur, Charles D. (Clayton, OH); Cala, Gregory C. (Dayton, OH)

    1991-01-01

    A heat flux gauge comprising first and second thermographic phosphor layers separated by a layer of a thermal insulator, wherein each thermographic layer comprises a plurality of respective thermographic sensors in a juxtaposed relationship with respect to each other. The gauge may be mounted on a surface with the first thermographic phosphor in contact with the surface. A light source is directed at the gauge, causing the phosphors to luminesce. The luminescence produced by the phosphors is collected and its spectra analyzed in order to determine the heat flux on the surface. First and second phosphor layers must be different materials to assure that the spectral lines collected will be distinguishable.

  19. Solar industrial process heat

    SciTech Connect (OSTI)

    Lumsdaine, E.

    1981-04-01

    The aim of the assessment reported is to candidly examine the contribution that solar industrial process heat (SIPH) is realistically able to make in the near and long-term energy futures of the United States. The performance history of government and privately funded SIPH demonstration programs, 15 of which are briefly summarized, and the present status of SIPH technology are discussed. The technical and performance characteristics of solar industrial process heat plants and equipment are reviewed, as well as evaluating how the operating experience of over a dozen SIPH demonstration projects is influencing institutional acceptance and economoc projections. Implications for domestic energy policy and international implications are briefly discussed. (LEW)

  20. Air heating system

    DOE Patents [OSTI]

    Primeau, John J. (19800 Seminole Rd., Euclid, OH 44117)

    1983-03-01

    A self-starting, fuel-fired, air heating system including a vapor generator, a turbine, and a condenser connected in a closed circuit such that the vapor output from the vapor generator is conducted to the turbine and then to the condenser where it is condensed for return to the vapor generator. The turbine drives an air blower which passes air over the condenser for cooling the condenser. Also, a condensate pump is driven by the turbine. The disclosure is particularly concerned with the provision of heat exchanger and circuitry for cooling the condensed fluid output from the pump prior to its return to the vapor generator.

  1. Acoustical heat pumping engine

    DOE Patents [OSTI]

    Wheatley, J.C.; Swift, G.W.; Migliori, A.

    1983-08-16

    The disclosure is directed to an acoustical heat pumping engine without moving seals. A tubular housing holds a compressible fluid capable of supporting an acoustical standing wave. An acoustical driver is disposed at one end of the housing and the other end is capped. A second thermodynamic medium is disposed in the housing near to but spaced from the capped end. Heat is pumped along the second thermodynamic medium toward the capped end as a consequence both of the pressure oscillation due to the driver and imperfect thermal contact between the fluid and the second thermodynamic medium. 2 figs.

  2. Laboratory Heat Recovery System

    E-Print Network [OSTI]

    Burrows, D. B.; Mendez, F. J.

    1981-01-01

    that they will be considerable. The system has been in successful operation since October 1979. 724 ESL-IE-81-04-123 Proceedings from the Third Industrial Energy Technology Conference Houston, TX, April 26-29, 1981 Conoco R&D West The award-winning laboratory heat-recovery... stream_source_info ESL-IE-81-04-123.pdf.txt stream_content_type text/plain stream_size 11112 Content-Encoding ISO-8859-1 stream_name ESL-IE-81-04-123.pdf.txt Content-Type text/plain; charset=ISO-8859-1 LABORATORY HEAT...

  3. Acoustical heat pumping engine

    DOE Patents [OSTI]

    Wheatley, John C. (Los Alamos, NM); Swift, Gregory W. (Los Alamos, NM); Migliori, Albert (Santa Fe, NM)

    1983-08-16

    The disclosure is directed to an acoustical heat pumping engine without moving seals. A tubular housing holds a compressible fluid capable of supporting an acoustical standing wave. An acoustical driver is disposed at one end of the housing and the other end is capped. A second thermodynamic medium is disposed in the housing near to but spaced from the capped end. Heat is pumped along the second thermodynamic medium toward the capped end as a consequence both of the pressure oscillation due to the driver and imperfect thermal contact between the fluid and the second thermodynamic medium.

  4. Development of High Efficiency Carbon Dioxide Commercial Heat Pump Water Heater

    SciTech Connect (OSTI)

    Michael PETERSEN; Chad D. BOWERS; Stefan ELBEL; Pega HRNJAK

    2012-07-01

    Although heat pump water heaters are today widely accepted in both Japan and Europe, where energy costs are high and government incentives for their use exist, acceptance of such products in the US has been limited. While this trend is slowly changing with the introduction of heat pump water heaters into the residential market, but acceptance remains low in the commercial sector. The objective of the presented work is the development of a high efficiency R744 heat pump water heater for commercial applications with effective utilization of the cooling capability for air conditioning and/or refrigeration. The ultimate goal is to achieve total system COP of up to 8. This unit will be targeted at commercial use where some cooling load is typically needed year round, such as restaurants, hotels, nursing homes, and hospitals. This paper presents the performance results from the development of four R744 commercial heat pump water heater packages of approximately 35 kW and comparison to a commercially available baseline R134a unit of the same capacity and footprint. In addition, the influences of an internal heat exchanger and an enhanced evaporator on the system performance are described and recommendations are made for further improvements of the R744 system.

  5. Absorption Heat Pumps | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Absorption Heat Pumps Absorption Heat Pumps June 24, 2012 - 2:11pm Addthis Absorption heat pumps are essentially air-source heat pumps driven not by electricity, but by a heat...

  6. Tips: Heat Pumps | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pumps Tips: Heat Pumps July 20, 2014 - 5:48pm Addthis Heat pumps can be a cost-effective choice in moderate climates, especially if you heat your home with electricity. Heat...

  7. Reference Models and Incentive Regulation of Electricity Distribution Networks: An Evaluation of Swedens Network Performance Assessment Model (NPAM)

    E-Print Network [OSTI]

    Jamasb, Tooraj; Pollitt, Michael G.

    (Capex), quality of service, and network losses in a single model. Aggregation of these important elements into a single model has useful efficiency and incentive properties. Firms can adjust their inputs and outputs more efficiently by weighting... long-term benchmarking model, the NPAM incorporates the main inputs and outputs of regulatory concern such as operating and maintenance expenditures (Opex), capital expenditures (Capex), service quality, and network energy losses. It is generally...

  8. Re-thinking incentives and penalties: Economic aspects of waste management in Italy

    SciTech Connect (OSTI)

    Cossu, R. [IMAGE, Department of Hydraulic, Maritime, Environmental and Geotechnical Engineering, University of Padua, Via Loredan, 35131 Padua (Italy); Masi, S., E-mail: salvatore.masi@unibas.it [DIFA, Department of Environmental Engineering and Physics, University of Basilicata, Via dellAteneo 10, 85100 Potenza (Italy)

    2013-11-15

    Highlights: We focused on the dynamics the formation of operational costs of waste management. We provide the basic elements to compose a picture of economic management. We present a reflection on the last hidden costs associated with the consumption of goods and packaging. Reduction of waste production. - Abstract: This paper focuses on the dynamics the formation of operational costs of waste management in Italy and the effect of economic measures. Currently incentives and penalties have been internalized by the system no differently from other cost items and revenues. This has greatly influenced the system directing it towards solutions that are often distant from the real environmental objectives. Based on an analysis of disaggregated costs of collection treatment and recovery, we provide the basic elements to compose a picture of economic management in various technicalorganizational scenarios. In the light of the considerations contained in the paper it is proposed, e.g. for controlled landfills, that the ecotax, currently based on weight, could be replaced by one based on the volume consumption. Likewise, for tax reduction on disposal system, instead a pre-treatment might ask an environmental balance of the overall system. The article presents a reflection on the last hidden costs associated with the consumption of goods and packaging, and how to reduce waste production is the necessary path to be followed in ecological and economic perspectives.

  9. Heat Transfer Characteristics of a Generalized Divided Flow Heat Exchanger

    E-Print Network [OSTI]

    Singh, K. P.

    1979-01-01

    CHARACTERISTICS OF A GENERALIZED DIVIDED FLrnJ HEAT EXCHANGER KRISHNA P. SINGH, CHIEF ENGINEER JOSEPH OAT CORPORATION 2500 Broadway, Camden, New Jersey 08104 ,l\\bstract The concept of a "Di vi ded-fl O~I" heat exchanger is general i zed by 1oca t i n...-Pass Split-Flow Shell Trans. of the ASME, Journal of Heat Transfer, pp 408-416, Aug. 1964. (4) Singh, K. P. and Holtz, ~I.J., "Generalization of the Split Flow Heat Exchanger - Geometry for Enhanced Heat Transfer", 18th National ASME/AICHE Heat Transfer...

  10. Wastewater heat recovery apparatus

    DOE Patents [OSTI]

    Kronberg, J.W.

    1992-09-01

    A heat recovery system is described with a heat exchanger and a mixing valve. A drain trap includes a heat exchanger with an inner coiled tube, baffle plate, wastewater inlet, wastewater outlet, cold water inlet, and preheated water outlet. Wastewater enters the drain trap through the wastewater inlet, is slowed and spread by the baffle plate, and passes downward to the wastewater outlet. Cold water enters the inner tube through the cold water inlet and flows generally upward, taking on heat from the wastewater. This preheated water is fed to the mixing valve, which includes a flexible yoke to which are attached an adjustable steel rod, two stationary zinc rods, and a pivoting arm. The free end of the arm forms a pad which rests against a valve seat. The rods and pivoting arm expand or contract as the temperature of the incoming preheated water changes. The zinc rods expand more than the steel rod, flexing the yoke and rotating the pivoting arm. The pad moves towards the valve seat as the temperature of the preheated water rises, and away as the temperature falls, admitting a variable amount of hot water to maintain a nearly constant average process water temperature. 6 figs.

  11. Industrial Waste Heat Recovery

    E-Print Network [OSTI]

    Ward, M. E.; Solomon, N. G.; Tabb, E. S.

    1980-01-01

    was that the upper material temperature limit of 1500oF is state-of-the-art for recuperators operating in an oxidizing environment produced by the com-bustion of Diesel No.2. A full size counter axial flow metal heat exchanger test module has successfully completed...

  12. Wastewater heat recovery apparatus

    DOE Patents [OSTI]

    Kronberg, James W. (108 Independent Blvd., Aiken, SC 29801)

    1992-01-01

    A heat recovery system with a heat exchanger and a mixing valve. A drain trap includes a heat exchanger with an inner coiled tube, baffle plate, wastewater inlet, wastewater outlet, cold water inlet, and preheated water outlet. Wastewater enters the drain trap through the wastewater inlet, is slowed and spread by the baffle plate, and passes downward to the wastewater outlet. Cold water enters the inner tube through the cold water inlet and flows generally upward, taking on heat from the wastewater. This preheated water is fed to the mixing valve, which includes a flexible yoke to which are attached an adjustable steel rod, two stationary zinc rods, and a pivoting arm. The free end of the arm forms a pad which rests against a valve seat. The rods and pivoting arm expand or contract as the temperature of the incoming preheated water changes. The zinc rods expand more than the steel rod, flexing the yoke and rotating the pivoting arm. The pad moves towards the valve seat as the temperature of the preheated water rises, and away as the temperature falls, admitting a variable amount of hot water to maintain a nearly constant average process water temperature.

  13. Heat exchange assembly

    DOE Patents [OSTI]

    Lowenstein, Andrew; Sibilia, Marc; Miller, Jeffrey; Tonon, Thomas S.

    2004-06-08

    A heat exchange assembly comprises a plurality of plates disposed in a spaced-apart arrangement, each of the plurality of plates includes a plurality of passages extending internally from a first end to a second end for directing flow of a heat transfer fluid in a first plane, a plurality of first end-piece members equaling the number of plates and a plurality of second end-piece members also equaling the number of plates, each of the first and second end-piece members including a recessed region adapted to fluidly connect and couple with the first and second ends of the plate, respectively, and further adapted to be affixed to respective adjacent first and second end-piece members in a stacked formation, and each of the first and second end-piece members further including at least one cavity for enabling entry of the heat transfer fluid into the plate, exit of the heat transfer fluid from the plate, or 180.degree. turning of the fluid within the plate to create a serpentine-like fluid flow path between points of entry and exit of the fluid, and at least two fluid conduits extending through the stacked plurality of first and second end-piece members for providing first fluid connections between the parallel fluid entry points of adjacent plates and a fluid supply inlet, and second fluid connections between the parallel fluid exit points of adjacent plates and a fluid discharge outlet so that the heat transfer fluid travels in parallel paths through each respective plate.

  14. TRANSPARENT HEAT MIRRORS FOR PASSIVE SOLAR HEATING APPLICATIONS

    E-Print Network [OSTI]

    Selkowitz, S.

    2011-01-01

    surfaces in a passive solar-heated building is to maximizeBuildings and Community Systems. -i- TRANSPARENT HEATING MIRRORS FOR PASSIVEpassive solar systems. Architecturally, a window is a very complex building

  15. Low Level Heat Recovery Through Heat Pumps and Vapor Recompression

    E-Print Network [OSTI]

    Gilbert, J.

    1980-01-01

    The intent of this paper is to examine the methods and economics of recovering low level heat through heat pumps and vapor recompression. Actual commercially available equipment is considered to determine the near-term and future economic viability...

  16. Modeling of Heat Transfer in Geothermal Heat Exchangers

    E-Print Network [OSTI]

    Cui, P.; Man, Y.; Fang, Z.

    2006-01-01

    Ground-coupled heat pump (GCHP) systems have been gaining increasing popularity for space conditioning in residential and commercial buildings. The geothermal heat exchanger (GHE) is devised for extraction or injection of thermal energy from...

  17. Influence of Heat Transmission Mode on Heating Rates and on the Selection of Patches for Heating in a Mediterranean Lizard

    E-Print Network [OSTI]

    Carrascal, Luis M.

    369 Influence of Heat Transmission Mode on Heating Rates and on the Selection of Patches the role of heat trans- mission modes on heating rates and on the selection of sites for heating a significant effect on the heating rate, with heat gain per unit of time being faster at the higher operative

  18. Fast reactor power plant design having heat pipe heat exchanger

    DOE Patents [OSTI]

    Huebotter, P.R.; McLennan, G.A.

    1984-08-30

    The invention relates to a pool-type fission reactor power plant design having a reactor vessel containing a primary coolant (such as liquid sodium), and a steam expansion device powered by a pressurized water/steam coolant system. Heat pipe means are disposed between the primary and water coolants to complete the heat transfer therebetween. The heat pipes are vertically oriented, penetrating the reactor deck and being directly submerged in the primary coolant. A U-tube or line passes through each heat pipe, extended over most of the length of the heat pipe and having its walls spaced from but closely proximate to and generally facing the surrounding walls of the heat pipe. The water/steam coolant loop includes each U-tube and the steam expansion device. A heat transfer medium (such as mercury) fills each of the heat pipes. The thermal energy from the primary coolant is transferred to the water coolant by isothermal evaporation-condensation of the heat transfer medium between the heat pipe and U-tube walls, the heat transfer medium moving within the heat pipe primarily transversely between these walls.

  19. Fast reactor power plant design having heat pipe heat exchanger

    DOE Patents [OSTI]

    Huebotter, Paul R. (Western Springs, IL); McLennan, George A. (Downers Grove, IL)

    1985-01-01

    The invention relates to a pool-type fission reactor power plant design having a reactor vessel containing a primary coolant (such as liquid sodium), and a steam expansion device powered by a pressurized water/steam coolant system. Heat pipe means are disposed between the primary and water coolants to complete the heat transfer therebetween. The heat pipes are vertically oriented, penetrating the reactor deck and being directly submerged in the primary coolant. A U-tube or line passes through each heat pipe, extended over most of the length of the heat pipe and having its walls spaced from but closely proximate to and generally facing the surrounding walls of the heat pipe. The water/steam coolant loop includes each U-tube and the steam expansion device. A heat transfer medium (such as mercury) fills each of the heat pipes. The thermal energy from the primary coolant is transferred to the water coolant by isothermal evaporation-condensation of the heat transfer medium between the heat pipe and U-tube walls, the heat transfer medium moving within the heat pipe primarily transversely between these walls.

  20. ELECTRIC CO-HEATING: A METHOD FOR EVALUATING SEASONAL HEATING EFFICIENCIES AND HEAT LOSS RATES IN DWELLINGS

    E-Print Network [OSTI]

    Modera, M.P.

    2012-01-01

    the measured values for heat transmission and air leakagethe contribution by heat transmission alone through theheating efficiency, heat transmission coefficient and air