National Library of Energy BETA

Sample records for halogen spotlights reflector

  1. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTechtail.Theory ofDidDevelopment TopMetathesis and Oxidation ofSpotlight Mekena McGrew

  2. Employee Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee Headcount bySpotlight

  3. Employee Spotlight: Dances of India

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jobs Career Stories Employee Spotlight Alina Deshpande Alina Deshpande-Dances of India Lab scientist Alina Deshpande teaches classical Indian dance and writes, produces,...

  4. Spotlight, March 2012

    E-Print Network [OSTI]

    2012-03-01

    Danny "Numero Uno" Anderson. Page 3 KU Center for Sustainability Sustainability Spotlight March 2012 What do plush carpets, glossy lipsticks and artificial heart valves have in common? They are all made from crude oil. In fact, more than 10... help them optimize the entire life cycle of the product, from crop choice through production facilities and beyond. Clearly, a bio?based chemical industry has the potential to grow in fields across the Midwest. If we build clean technologies today, CEBC researchers...

  5. Nuclear reactor reflector

    DOE Patents [OSTI]

    Hopkins, Ronald J. (Pensacola, FL); Land, John T. (Pensacola, FL); Misvel, Michael C. (Pensacola, FL)

    1994-01-01

    A nuclear reactor reflector is disclosed that comprises a stack of reflector blocks with vertical water flow passages to cool the reflector. The interface between blocks is opposite support points for reactor fuel rods. Water flows between the reflector and the reactor barrel from passages in a bottom block. The top block contains a flange to limit this flow and the flange has a slot to receive an alignment pin that is welded to the barrel. The pin is held in the slot by two removable shims. Alignment bars extend the length of the stack in slots machined in each block when the stack is assembled.

  6. Nuclear reactor reflector

    DOE Patents [OSTI]

    Hopkins, R.J.; Land, J.T.; Misvel, M.C.

    1994-06-07

    A nuclear reactor reflector is disclosed that comprises a stack of reflector blocks with vertical water flow passages to cool the reflector. The interface between blocks is opposite support points for reactor fuel rods. Water flows between the reflector and the reactor barrel from passages in a bottom block. The top block contains a flange to limit this flow and the flange has a slot to receive an alignment pin that is welded to the barrel. The pin is held in the slot by two removable shims. Alignment bars extend the length of the stack in slots machined in each block when the stack is assembled. 12 figs.

  7. Spotlight: Jenna Casias

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect Photovoltaics -7541C.3 SpecialSponsor Guidelines Candidates f orSpotlight:

  8. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne NationalScientists In the Spotlight

  9. Scientist in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque| StanfordOffice ofTorus Experiment |Scientist in the Spotlight

  10. Advanced Manufacture of Reflectors

    Broader source: Energy.gov [DOE]

    The Advance Manufacture of Reflectors fact sheet describes a SunShot Initiative project being conducted research team led by the University of Arizona, which is working to develop a novel method for shaping float glass. The technique developed by this research team can drastically reduce the time required for the shaping step. By enabling mass production of solar concentrating mirrors at high speed, this project should lead to improved performance and as much as a 40% reduction in manufacturing costs for reflectors made in very high volume.

  11. Halogenated solvent remediation

    DOE Patents [OSTI]

    Sorenson, Jr., Kent S. (Windsor, CO)

    2008-11-11

    Methods for enhancing bioremediation of ground water contaminated with nonaqueous halogenated solvents are disclosed. An illustrative method includes adding an electron donor for microbe-mediated anaerobic reductive dehalogenation of the halogenated solvents, which electron donor enhances mass transfer of the halogenated solvents from residual source areas into the aqueous phase of the ground water. Illustrative electron donors include C.sub.2-C.sub.4 carboxylic acids and hydroxy acids, salts thereof, esters of C.sub.2-C.sub.4 carboxylic acids and hydroxy acids, and mixtures thereof, of which lactic acid, salts of lactic acid--such as sodium lactate, lactate esters, and mixtures thereof are particularly illustrative. The microbes are either indigenous to the ground water, or such microbes can be added to the ground water in addition to the electron donor.

  12. Halogenated solvent remediation

    DOE Patents [OSTI]

    Sorenson, Kent S.

    2004-08-31

    Methods for enhancing bioremediation of ground water contaminated with nonaqueous halogenated solvents are disclosed. A preferred method includes adding a composition to the ground water wherein the composition is an electron donor for microbe-mediated reductive dehalogenation of the halogenated solvents and enhances mass transfer of the halogenated solvents from residual source areas into the aqueous phase of the ground water. Illustrative compositions effective in these methods include surfactants such as C.sub.2 -C.sub.4 carboxylic acids and hydroxy acids, salts thereof, esters of C.sub.2 -C.sub.4 carboxylic acids and hydroxy acids, and mixtures thereof. Especially preferred compositions for use in these methods include lactic acid, salts of lactic acid, such as sodium lactate, lactate esters, and mixtures thereof. The microbes are either indigenous to the ground water, or such microbes can be added to the ground water in addition to the composition.

  13. Better Buildings: Workforce: Spotlight on Fayette County, Pennsylvania...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Workforce: Spotlight on Fayette County, Pennsylvania: Developing the Skills and Tools for Workforce Success Better Buildings: Workforce: Spotlight on Fayette County, Pennsylvania:...

  14. Better Buildings: Workforce, Spotlight on Maine: Contractor Sales...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Workforce, Spotlight on Maine: Contractor Sales Training Boosts Energy Upgrade Conversions Better Buildings: Workforce, Spotlight on Maine: Contractor Sales Training Boosts Energy...

  15. Better Buildings - Spotlight on Portland, Oregon; Financing and...

    Energy Savers [EERE]

    Program Work for Contractors Better Buildings: Financing and Incentives: Spotlight on Maine: Transition to a Sustainable Level of Incentives Spotlight on Maine: Transition to a...

  16. White House Spotlights Solar Innovation as Summit Registration...

    Energy Savers [EERE]

    White House Spotlights Solar Innovation as Summit Registration Continues White House Spotlights Solar Innovation as Summit Registration Continues April 23, 2014 - 10:38am Addthis...

  17. Better Buildings: Financing and Incentives: Spotlight on Maine...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    more successful and to read more from this Spotlight series, visit betterbuildings.energy.govneighborhoods. Spotlight on Maine: Transition to a Sustainable Level of...

  18. Spotlight on Austin, Texas: Best Offer Ever Produces Upgrades...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Upgrades in Record Time Spotlight on Austin, Texas: Best Offer Ever Produces Upgrades in Record Time Spotlight on Austin, Texas: Best Offer Ever Produces Upgrades in Record Time,...

  19. Better Buildings: Financing and Incentives: Spotlight on Maine...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to a Sustainable Level of Incentives More Documents & Publications Spotlight on Maine: Transition to a Sustainable Level of Incentives Better Buildings: Workforce, Spotlight on...

  20. Solar Decathlon Technology Spotlight: Structural Insulated Panels...

    Broader source: Energy.gov (indexed) [DOE]

    spotlights that introduces common technologies used in U.S. Department of Energy Solar Decathlon team houses. Structural insulated panels (SIPs) are prefabricated...

  1. Spotlight on Seattle, Washington: Community Partnerships Work...

    Energy Savers [EERE]

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings...

  2. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Revised July 2011 Version 2 Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach Getting Started 1 Seattle Moves the Needle With the Help of Its...

  3. Advanced Manufacture of Reflectors

    SciTech Connect (OSTI)

    Angel, Roger

    2014-12-17

    The main project objective has been to develop an advanced gravity sag method for molding large glass solar reflectors with either line or point focus, and with long or short focal length. The method involves taking standard sized squares of glass, 1.65 m x 1.65 m, and shaping them by gravity sag into precision steel molds. The method is designed for high volume manufacture when incorporated into a production line with separate pre-heating and cooling. The performance objectives for the self-supporting glass mirrors made by this project include mirror optical accuracy of 2 mrad root mean square (RMS), requiring surface slope errors <1 mrad rms, a target not met by current production of solar reflectors. Our objective also included development of new methods for rapidly shaping glass mirrors and coating them for higher reflectivity and soil resistance. Reflectivity of 95% for a glass mirror with anti-soil coating was targeted, compared to the present ~94% with no anti-soil coating. Our mirror cost objective is ~$20/m2 in 2020, a significant reduction compared to the present ~$35/m2 for solar trough mirrors produced for trough solar plants. During the first year a custom batch furnace was built to develop the method with high power radiative heating to simulate transfer of glass into a hot slumping zone in a production line. To preserve the original high polish of the float glass on both front and back surfaces, as required for a second surface mirror, the mold surface is machined to the required shape as grooves which intersect the glass at cusps, reducing the mold contact area to significantly less than 1%. The mold surface is gold-plated to reflect thermal radiation. Optical metrology of glass replicas made with the system has been carried out with a novel, custom-built test system. This test provides collimated, vertically-oriented parallel beams from a linear array of co-aligned lasers translated in a perpendicular direction across the reflector. Deviations of each reflected beam from the paraboloid focus give a direct measure of surface slope error. Key findings • A gravity sag method for large (2.5 m2) second surface glass solar reflectors has been developed and demonstrated to a uniquely high level of accuracy. Mirror surface slope accuracy of 0.65 mrad in one dimension, 0.85 mrad in 2 dimensions (point focus) has been demonstrated by commercial partner REhnu using this process. This accuracy exceeds by a factor of two current solar reflector accuracy. Our replicas meet the Sunshot accuracy objective of 2 mrad optical, which requires better than 1 mrad rms slope error. • Point-focus as well as line-focus mirrors have been demonstrated at 1.65 m x 1.65 m square – a unique capability. • The new process using simple molds is economical. The molds for the 1.65 m square reflectors are bent and machined steel plates on a counter-weighted flotation support. To minimize thermal coupling by radiative heat transfer, the mold surface is grooved and gilded. The molds are simple to manufacture, and have minimal thermal stresses and distortion in use. Lapping and bending techniques have been developed to obtain better than 1 mrad rms surface mold accuracy. Float glass is sagged into the molds by rapid radiative heating, using a custom high power (350 kW) furnace. The method of manufacture is well suited for small as well as large volume production, and as it requires little capital investment and no high technology, it could be used anywhere in the world to make solar concentrating reflectors. • A novel slope metrology method for full 1.65 aperture has been demonstrated, with 25 mm resolution across the face of the replicas. The method is null and therefore inherently accurate: it can easily be reproduced without high-tech equipment and does not need sophisticated calibration. We find by cross calibration with reference trough reflectors from RioGlass that our null-test laser system yields a measurement accuracy better than 0.4 mrad rms slope error. Our system is inexpensive and could have broad application for test

  4. MULTIPHOTON DISSOCIATION PRODUCTS FROM HALOGENATED HYDROCARBONS

    E-Print Network [OSTI]

    Sudbo, Aa. S.

    2011-01-01

    FROM HALOGENATED HYDROCARBONS RECE1VED Aa. S. Sudbo, P. A.FROM HALOGENATED HYDROCARBONS LBL-6966 Aa. S. Sudbo, t P. A.

  5. SPOTLIGHT on: Lindsay Freeman Chemical Engineering (Nanotechnology)

    E-Print Network [OSTI]

    Wang, Hai

    SPOTLIGHT on: Lindsay Freeman Chemical Engineering (Nanotechnology) Undergraduate Hometown.D. in chemical engineering with an emphasis in nanotechnology. Lindsay stands out as a very well-balanced student

  6. Spotlight on Rutland County, Vermont: How Local Ties Lead to...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Rutland County, Vermont: How Local Ties Lead to Local Wins Spotlight on Rutland County, Vermont: How Local Ties Lead to Local Wins Spotlight on Rutland County, Vermont: How Local...

  7. Spotlight on Austin, Texas: Let Your Contractor Be Your Guide...

    Energy Savers [EERE]

    Let Your Contractor Be Your Guide for Big Rewards Spotlight on Austin, Texas: Let Your Contractor Be Your Guide for Big Rewards Spotlight on Austin, Texas: Let Your Contractor Be...

  8. Reflector system for a lighting fixture

    DOE Patents [OSTI]

    Siminovitch, Michael J. (829 Manor Rd., El Sobrante, CA 94803); Page, Erik (Berkeley, CA); Gould, Carl T. (Medford, OR)

    2001-01-01

    Disclosed herein is a reflector system for a lighting fixture having a illumination source surrounded by an envelope. The reflector system includes a first reflector surrounding the illumination source. The reflector system also includes a second reflector which is non-contiguous with the first reflector and which surrounds the illumination source. The illumination source creates light rays which are reflected by the first and second reflectors. The first reflector directs light rays toward the center line of the fixture. However, the reflected rays despite being so reflected do not substantially intersect the envelope. The reflected light rays from the second reflector being directed so that they diverge from the center line of the fixture avoiding intersection with the semi-transparent envelope.

  9. Reflector system for a lighting fixture

    DOE Patents [OSTI]

    Siminovitch, M.J.; Page, E.; Gould, C.T.

    1998-09-08

    Disclosed herein is a reflector system for a lighting fixture having a illumination source surrounded by an envelope. The reflector system includes a first reflector surrounding the illumination source. The reflector system also includes a second reflector which is non-contiguous with the first reflector and which surrounds the illumination source. The illumination source creates light rays which are reflected by the first and second reflectors. The first reflector directs light rays toward the center line of the fixture. However, the reflected rays despite being so reflected do not substantially intersect the envelope. The reflected light rays from the second reflector being directed so that they diverge from the center line of the fixture avoiding intersection with the semi-transparent envelope. 5 figs.

  10. Reflector system for a lighting fixture

    DOE Patents [OSTI]

    Siminovitch, Michael J. (El Sobrante, CA); Page, Erik (Berkeley, CA); Gould, Carl T. (Medford, OR)

    1998-01-01

    Disclosed herein is a reflector system for a lighting fixture having a illumination source surrounded by an envelope. The reflector system includes a first reflector surrounding the illumination source. The reflector system also includes a second reflector which is non-contiguous with the first reflector and which surrounds the illumination source. The illumination source creates light rays which are reflected by the first and second reflectors. The first reflector directs light rays toward the center line of the fixture. However, the reflected rays despite being so reflected do not substantially intersect the envelope. The reflected light rays from the second reflector being directed so that they diverge from the center line of the fixture avoiding intersection with the semi-transparent envelope.

  11. Lamp bulb with integral reflector

    DOE Patents [OSTI]

    Levin, Izrail (Silver Spring, MD); Shanks, Bruce (Gaithersburg, MD); Sumner, Thomas L. (Wheaton, MD)

    2001-01-01

    An improved electrodeless discharge lamp bulb includes an integral ceramic reflector as a portion of the bulb envelope. The bulb envelope further includes two pieces, a reflector portion or segment is cast quartz ceramic and a light transmissive portion is a clear fused silica. In one embodiment, the cast quartz ceramic segment includes heat sink fins or stubs providing an increased outside surface area to dissipate internal heat. In another embodiment, the quartz ceramic segment includes an outside surface fused to eliminate gas permeation by polishing.

  12. SCHOLAR SPOTLIGHT TRAINING SCHOOL STAFF IN

    E-Print Network [OSTI]

    Illinois at Chicago, University of

    can student teachers and school social worker interns learn to support their students' social-service training in SEL for UIC students that focused on race and class. The group training occurred over sixMarch 2014 SCHOLAR SPOTLIGHT TRAINING SCHOOL STAFF IN SOCIAL-EMOTIONAL LEARNING Introduction How

  13. Children's School March 2012 Research Spotlight

    E-Print Network [OSTI]

    Children's School March 2012 Research Spotlight The Fish Game Dr. Anna Fisher is investigating, attention, processing speed, executive function, and language ability. In this "fish game", graduate children are presented with a series of fish similar to the ones pictured below. Children are told

  14. Oct. 29 Webinar to Spotlight DOE Energy Programs for Tribes and...

    Energy Savers [EERE]

    29 Webinar to Spotlight DOE Energy Programs for Tribes and First Tribally Owned Hydroelectric Facility Oct. 29 Webinar to Spotlight DOE Energy Programs for Tribes and First...

  15. Healthcare Energy: Spotlight on Lighting and Other Electric Loads...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Lighting and Other Electric Loads Healthcare Energy: Spotlight on Lighting and Other Electric Loads Compact fluorescent, light-emitting diode, and energy-saving incandescent light...

  16. Building America Research Teams: Spotlight on Alliance for Residential...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building America Research Teams: Spotlight on Alliance for Residential Building Innovation (ARBI) and Building America Research Alliance (BARA) Building America Research Teams:...

  17. Building America Research Teams: Spotlight on Alliance for Residential...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Alliance for Residential Building Innovation (ARBI) and Building America Research Alliance (BARA) Building America Research Teams: Spotlight on Alliance for Residential Building...

  18. Better Buildings: Financing and Incentives: Spotlight on Michigan...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Michigan: Experiment to Find the Right Mix of Incentives Better Buildings: Financing and Incentives: Spotlight on Michigan: Experiment to Find the Right Mix of Incentives Better...

  19. DOE Sustainability SPOtlight: Special Edition 2013 DOE Sustainability...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Awards Newsletter highlights the recipients of the U.S. Department of Energy (DOE) Sustainability Performance Office (SPO) 2013 Sustainability Awards. 2013spotlight.pdf...

  20. Better Buildings: Financing and Incentives: Spotlight on Michigan...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    betterbuildings.energy.govneighborhoods 1 Spotlight on Michigan: Experiment to Find the Right Mix of Incentives With support from the U.S. Energy Department's Better Buildings...

  1. Development and Testing of Solar Reflectors

    SciTech Connect (OSTI)

    Kennedy, C.; Terwilliger, K.; Milbourne, M.

    2005-01-01

    To make concentrating solar power technologies more cost competitive, it is necessary to develop advanced reflector materials that are low in cost and maintain high reflectance for extended lifetimes under severe outdoor environments. The Advanced Materials Team performs durability testing of candidate solar reflectors at outdoor test sites and in accelerated weathering chambers. Several materials being developed by industry have been submitted for evaluation. These include silvered glass mirrors, aluminized reflectors, and front-surface mirrors. In addition to industry-supplied materials, NREL is funding the development of new, innovative reflectors, including a new commercial laminate reflector and an advanced solar reflective mirror (ASRM). To help commercialize the ASRM, a cost analysis was performed; it shows the total production cost could meet the goal. The development, performance, and durability of these candidate solar reflectors and cost analysis results will be described.

  2. Lamp with a truncated reflector cup

    DOE Patents [OSTI]

    Li, Ming; Allen, Steven C.; Bazydola, Sarah; Ghiu, Camil-Daniel

    2013-10-15

    A lamp assembly, and method for making same. The lamp assembly includes first and second truncated reflector cups. The lamp assembly also includes at least one base plate disposed between the first and second truncated reflector cups, and a light engine disposed on a top surface of the at least one base plate. The light engine is configured to emit light to be reflected by one of the first and second truncated reflector cups.

  3. Distributed Bragg Reflectors With Reduced Optical Absorption

    DOE Patents [OSTI]

    Klem, John F. (Albuquerque, NM)

    2005-08-16

    A new class of distributed Bragg reflectors has been developed. These distributed Bragg reflectors comprise interlayers positioned between sets of high-index and low-index quarter-wave plates. The presence of these interlayers is to reduce photon absorption resulting from spatially indirect photon-assisted electronic transitions between the high-index and low-index quarter wave plates. The distributed Bragg reflectors have applications for use in vertical-cavity surface-emitting lasers for use at 1.55 .mu.m and at other wavelengths of interest.

  4. Nuclear Fuels & Materials Spotlight Volume 4

    SciTech Connect (OSTI)

    I. J. van Rooyen,; T. M. Lillo; Y. Q. WU; P.A. Demkowicz; L. Scott; D.M. Scates; E. L. Reber; J. H. Jackson; J. A. Smith; D.L. Cottle; B.H. Rabin; M.R. Tonks; S.B. Biner; Y. Zhang; R.L. Williamson; S.R. Novascone; B.W. Spencer; J.D. Hales; D.R. Gaston; C.J. Permann; D. Anders; S.L. Hayes; P.C. Millett; D. Andersson; C. Stanek; R. Ali; S.L. Garrett; J.E. Daw; J.L. Rempe; J. Palmer; B. Tittmann; B. Reinhardt; G. Kohse; P. Ramuhali; H.T. Chien; T. Unruh; B.M. Chase; D.W. Nigg; G. Imel; J. T. Harris

    2014-04-01

    As the nation's nuclear energy laboratory, Idaho National Laboratory brings together talented people and specialized nuclear research capability to accomplish our mission. This edition of the Nuclear Fuels and Materials Division Spotlight provides an overview of some of our recent accomplishments in research and capability development. These accomplishments include: • The first identification of silver and palladium migrating through the SiC layer in TRISO fuel • A description of irradiation assisted stress corrosion testing capabilities that support commercial light water reactor life extension • Results of high-temperature safety testing on coated particle fuels irradiated in the ATR • New methods for testing the integrity of irradiated plate-type reactor fuel • Description of a 'Smart Fuel' concept that wirelessly provides real time information about changes in nuclear fuel properties and operating conditions • Development and testing of ultrasonic transducers and real-time flux sensors for use inside reactor cores, and • An example of a capsule irradiation test. Throughout Spotlight, you'll find examples of productive partnerships with academia, industry, and government agencies that deliver high-impact outcomes. The work conducted at Idaho National Laboratory helps to spur innovation in nuclear energy applications that drive economic growth and energy security. We appreciate your interest in our work here at INL, and hope that you find this issue informative.

  5. Solar central receiver heliostat reflector assembly

    DOE Patents [OSTI]

    Horton, Richard H. (Schenectady, NY); Zdeb, John J. (Clifton Park, NY)

    1980-01-01

    A heliostat reflector assembly for a solar central receiver system comprises a light-weight, readily assemblable frame which supports a sheet of stretchable reflective material and includes mechanism for selectively applying tension to and positioning the sheet to stretch it to optical flatness. The frame is mounted on and supported by a pipe pedestal assembly that, in turn, is installed in the ground. The frame is controllably driven in a predetermined way by a light-weight drive system so as to be angularly adjustable in both elevation and azimuth to track the sun and efficiently continuously reflect the sun's rays to a focal zone, i.e. central receiver, which forms part of a solar energy utilization system, such as a solar energy fueled electrical power generation system. The frame may include a built-in system for testing for optical flatness of the reflector. The preferable geometric configuration of the reflector is octagonal; however, it may be other shapes, such as hexagonal, pentagonal or square. Several different embodiments of means for tensioning and positioning the reflector to achieve optical flatness are disclosed. The reflector assembly is based on the stretch frame concept which provides an extremely light-weight, simple, low-cost reflector assembly that may be driven for positioning and tracking by a light-weight, inexpensive drive system.

  6. Healthcare Energy: Spotlight on Fans and Pumps | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fans and Pumps Healthcare Energy: Spotlight on Fans and Pumps Chilled water pumps at a central plant. Image by Warren Gretz, NREL06196 Chilled water pumps at a central plant....

  7. SPOTLIGHT on: Jennifer Dowling Industrial and Systems Engineering

    E-Print Network [OSTI]

    Wang, Hai

    SPOTLIGHT on: Jennifer Dowling Industrial and Systems Engineering Hometown: La Mirada, CA Involvement at USC: Society of Women Engineers- Corporate Affairs Committee member, Institute of Industrial Engineers- President, Viterbi Graduate Admissions Office- student staff member, Song Girl 2007 Favorite

  8. Spotlight on Austin, Texas: Best Offer Ever Produces 564 Upgrades...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    564 Upgrades in Record Time Spotlight on Austin, Texas: Best Offer Ever Produces 564 Upgrades in Record Time This Better Buildings case study from April 2011 focuses on grantee...

  9. Spotlight on Austin, Texas: Let Your Contractor Be Your Guide...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 Spotlight on Austin, Texas: Let Your Contractor Be Your Guide for Big Rewards Workforce All About Contractors Austin Energy, a municipally owned utility, has a long history of...

  10. Photodissociation Dynamics of Halogen Oxide Species 

    E-Print Network [OSTI]

    Dooley, Kristin S.

    2010-07-14

    The focus of this dissertation is the study of the photodissociation dynamics of halogen oxide species (XO, X = Cl, Br, I). These radical species are known to be important in stratospheric and tropospheric ozone depletion ...

  11. Energy efficient alternatives to halogen torchieres

    SciTech Connect (OSTI)

    Siminovitch, M.; Marr, L.; Mitchell, J.; Page, E.

    1997-03-01

    A series of novel energy efficient torchiere systems have been developed using compact fluorescent lamps (CFLs). These systems were studied photometrically and compared with the performance of traditional commercially available tungsten halogen sources. Gonio-photometric data and power assessments indicate that significant lighting energy savings can be obtained by utilizing CFL sources instead of standard tungsten halogen sources. This energy savings is jointly due to the higher source efficacy of the CFLs and the surprisingly poor performance of the imported 300 Watt halogen lamps. Experimental data shows that a 50 to 60 Watt CFL will effectively lumen match a variety of 300 Watt tungsten halogen sources with 5 to 10 times the efficacy. CFL torchieres have additional benefits of higher power quality and cooler lamp operating temperature, making them safer fixtures.

  12. Building America Research Teams: Spotlight on ARIES and NorthernSTAR...

    Energy Savers [EERE]

    Building America Research Teams: Spotlight on ARIES and NorthernSTAR Building America Research Teams: Spotlight on ARIES and NorthernSTAR May 14, 2015 - 12:36pm Addthis This...

  13. Nuclear Transmutations in HFIR's Beryllium Reflector and Their Impact on Reactor Operation and Reflector Disposal

    SciTech Connect (OSTI)

    Chandler, David [ORNL; Maldonado, G Ivan [ORNL; Primm, Trent [ORNL; Proctor, Larry Duane [ORNL

    2012-01-01

    The High Flux Isotope Reactor located at the Oak Ridge National Laboratory utilizes a large cylindrical beryllium reflector that is subdivided into three concentric regions and encompasses the compact reactor core. Nuclear transmutations caused by neutron activation occur in the beryllium reflector regions, which leads to unwanted neutron absorbing and radiation emitting isotopes. During the past year, two topics related to the HFIR beryllium reflector were reviewed. The first topic included studying the neutron poison (helium-3 and lithium-6) buildup in the reflector regions and its affect on beginning-of-cycle reactivity. A new methodology was developed to predict the reactivity impact and estimated symmetrical critical control element positions as a function of outage time between cycles due to helium-3 buildup and was shown to be in better agreement with actual symmetrical critical control element position data than the current methodology. The second topic included studying the composition of the beryllium reflector regions at discharge as well as during decay to assess the viability of transporting, storing, and ultimately disposing the reflector regions currently stored in the spent fuel pool. The post-irradiation curie inventories were used to determine whether the reflector regions are discharged as transuranic waste or become transuranic waste during the decay period for disposal purposes and to determine the nuclear hazard category, which may affect the controls invoked for transportation and temporary storage. Two of the reflector regions were determined to be transuranic waste at discharge and the other region was determined to become transuranic waste in less than 2 years after being discharged due to the initial uranium content (0.0044 weight percent uranium). It was also concluded that all three of the reflector regions could be classified as nuclear hazard category 3 (potential for localized consequences only).

  14. Dual annular rotating "windowed" nuclear reflector reactor control system

    DOE Patents [OSTI]

    Jacox, Michael G. (Idaho Falls, ID); Drexler, Robert L. (Idaho Falls, ID); Hunt, Robert N. M. (Idaho Falls, ID); Lake, James A. (Idaho Falls, ID)

    1994-01-01

    A nuclear reactor control system is provided in a nuclear reactor having a core operating in the fast neutron energy spectrum where criticality control is achieved by neutron leakage. The control system includes dual annular, rotatable reflector rings. There are two reflector rings: an inner reflector ring and an outer reflector ring. The reflectors are concentrically assembled, surround the reactor core, and each reflector ring includes a plurality of openings. The openings in each ring are capable of being aligned or non-aligned with each other. Independent driving means for each of the annular reflector rings is provided so that reactor criticality can be initiated and controlled by rotation of either reflector ring such that the extent of alignment of the openings in each ring controls the reflection of neutrons from the core.

  15. Crystallographic studies on enzymatic halogenation of natural products

    E-Print Network [OSTI]

    Blasiak, Leah Cameron

    2008-01-01

    Halogenated natural products are common and serve roles as hormones, pesticides, antibiotics, and anti-tumor agents. The incorporation of a halogen atom into an organic scaffold can tune the molecule's potency and selectivity, ...

  16. Method and apparatus for low temperature destruction of halogenated hydrocarbons

    DOE Patents [OSTI]

    Reagen, William Kevin (Stillwater, MN); Janikowski, Stuart Kevin (Idaho Falls, ID)

    1999-01-01

    A method and apparatus for decomposing halogenated hydrocarbons are provided. The halogenated hydrocarbon is mixed with solvating agents and maintained in a predetermined atmosphere and at a predetermined temperature. The mixture is contacted with recyclable reactive material for chemically reacting with the recyclable material to create dehalogenated hydrocarbons and halogenated inorganic compounds. A feature of the invention is that the process enables low temperature destruction of halogenated hydrocarbons.

  17. MODELLING OF CAVITY RECEIVER HEAT TRANSFER COMPACT LINEAR FRESNEL REFLECTOR

    E-Print Network [OSTI]

    MODELLING OF CAVITY RECEIVER HEAT TRANSFER FOR THE COMPACT LINEAR FRESNEL REFLECTOR John D Pye receiver for the Compact Linear Fresnel Reflector is presented. Response to changes in ambient temperature equations are provided. 1. BACKGROUND The Compact Linear Fresnel Reflector (CLFR), shown in Figure 1

  18. Zevenhoven & Kilpinen Halogens, dioxins/furans 17.6.2001 7-1 Chapter 7 Halogens,

    E-Print Network [OSTI]

    Laughlin, Robert B.

    Zevenhoven & Kilpinen Halogens, dioxins/furans 17.6.2001 7-1 Chapter 7 Halogens, dioxins/furans 7 in Figure 7.1. The polychlorinated dibenzo -(p) dioxins and -furans (PCDD/Fs) that are found in PCBs and may, dioxins/furans 17.6.2001 7-2 2,3,7,8 tetrachloro dibenzo - p- dioxin PCB furan 2,3,7,8 tetrachlorodibenzo

  19. Contour mode resonators with acoustic reflectors

    DOE Patents [OSTI]

    Olsson, Roy H. (Albuquerque, NM); Fleming, James G. (Albuquerque, NM); Tuck, Melanie R. (Albuquerque, NM)

    2008-06-10

    A microelectromechanical (MEM) resonator is disclosed which has a linear or ring-shaped acoustic resonator suspended above a substrate by an acoustic reflector. The acoustic resonator can be formed with a piezoelectric material (e.g. aluminum nitride, zinc oxide or PZT), or using an electrostatically-actuated material. The acoustic reflector (also termed an acoustic mirror) uses alternating sections of a relatively low acoustic impedance Z.sub.L material and a relatively high acoustic impedance Z.sub.H material to isolate the acoustic resonator from the substrate. The MEM resonator, which can be formed on a silicon substrate with conventional CMOS circuitry, has applications for forming oscillators, rf filters, and acoustic sensors.

  20. Process for removal of hydrogen halides or halogens from incinerator gas

    DOE Patents [OSTI]

    Huang, H.S.; Sather, N.F.

    1987-08-21

    A process for reducing the amount of halogens and halogen acids in high temperature combustion gas and through their removal, the formation of halogenated organics at lower temperatures, with the reduction being carried out electrochemically by contacting the combustion gas with the negative electrode of an electrochemical cell and with the halogen and/or halogen acid being recovered at the positive electrode.

  1. #LabSpotlight - People of the National Labs | Department of Energy

    Office of Environmental Management (EM)

    Dawson, an award-winning theoretical physicist seeking to better understand the Higgs boson particle and our latest LabSpotlight. Through the Looking Glass: The Art and...

  2. Webinar: Hydrogen Production by Polymer Electrolyte Membrane (PEM) Electrolysis—Spotlight on Giner and Proton

    Broader source: Energy.gov [DOE]

    Video recording of the webinar, Hydrogen Production by Polymer Electrolyte Membrane (PEM) Electrolysis—Spotlight on Giner and Proton, originally presented on May 23, 2011.

  3. Recovery Act: Low-Cost, Highly Lambertian Reflector Composite...

    Office of Scientific and Technical Information (OSTI)

    Reflector Composite For Improved LED Fixture Efficiency and Lifetime Teather, Eric 32 ENERGY CONSERVATION, CONSUMPTION, AND UTILIZATION; 36 MATERIALS SCIENCE The overall...

  4. Project Profile: Advanced Polymeric Reflector for CSP Applications...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    48-inch wide roll coater. This technology is promising both for its potential lower cost to traditional reflectors, but also because the design flexibility and durability...

  5. Better Buildings- Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

    Broader source: Energy.gov [DOE]

    Better Buildings - Spotlight on Portland, Oregon; Financing and Incentives: Use Incentives to Get Attention and Encourage Deep Savings.

  6. Impact of HFIR LEU Conversion on Beryllium Reflector Degradation Factors

    SciTech Connect (OSTI)

    Ilas, Dan

    2013-10-01

    An assessment of the impact of low enriched uranium (LEU) conversion on the factors that may cause the degradation of the beryllium reflector is performed for the High Flux Isotope Reactor (HFIR). The computational methods, models, and tools, comparisons with previous work, along with the results obtained are documented and discussed in this report. The report documents the results for the gas and neutronic poison production, and the heating in the beryllium reflector for both the highly enriched uranium (HEU) and LEU HFIR configurations, and discusses the impact that the conversion to LEU may have on these quantities. A time-averaging procedure was developed to calculate the isotopic (gas and poisons) production in reflector. The sensitivity of this approach to different approximations is gauged and documented. The results show that the gas is produced in the beryllium reflector at a total rate of 0.304 g/cycle for the HEU configuration; this rate increases by ~12% for the LEU case. The total tritium production rate in reflector is 0.098 g/cycle for the HEU core and approximately 11% higher for the LEU core. A significant increase (up to ~25%) in the neutronic poisons production in the reflector during the operation cycles is observed for the LEU core, compared to the HEU case, for regions close to the core s horizontal midplane. The poisoning level of the reflector may increase by more than two orders of magnitude during long periods of downtime. The heating rate in the reflector is estimated to be approximately 20% lower for the LEU core than for the HEU core. The decrease is due to a significantly lower contribution of the heating produced by the gamma radiation for the LEU core. Both the isotopic (gas and neutronic poisons) production and the heating rates are spatially non-uniform throughout the beryllium reflector volume. The maximum values typically occur in the removable reflector and close to the midplane.

  7. Method of making reflecting film reflector

    DOE Patents [OSTI]

    Cottingham, James G. (Center Moriches, NY)

    1980-01-01

    A reflector of the reflecting film type is disclosed and which may be used in a heliostatic system for concentrating solar energy and comprising a reflecting film bonded to an appropriate rigid substrate in such a way that specularity of a very high order is achieved. A method of bonding the reflecting film to the substrate is also disclosed and comprises the steps of initially adhering the film to a smooth, clean flat rigid surface with a non-bonding liquid between the rigid surface and film, and then bonding the substrate and film. The non-bonding liquid has a molecular adhesion greater than any stresses due to handling or curing of the bonding agent which is applied between the film and the opposing surface of the rigid substrate.

  8. Optical Durability of Candidate Solar Reflectors for Concentrating Solar Power

    SciTech Connect (OSTI)

    Kennedy, C. E.; Terwilliger, K.

    2007-01-01

    Concentrating solar power (CSP) technologies use large mirrors to collect sunlight to convert thermal energy to electricity. The viability of CSP systems requires the development of advanced reflector materials that are low in cost and maintain high specular reflectance for extended lifetimes under severe outdoor environments. The long-standing goals for a solar reflector are specular reflectance above 90% into a 4 mrad half-cone angle for at least 10 years outdoors with a cost of less than $13.8/m{sup 2} (the 1992 $10.8/m{sup 2} goal corrected for inflation to 2002 dollars) when manufactured in large volumes. Durability testing of a variety of candidate solar reflector materials at outdoor test sites and in laboratory accelerated weathering chambers is the main activity within the Advanced Materials task of the CSP Program at the National Renewable Energy Laboratory (NREL) in Golden, Colorado. Test results to date for several candidate solar reflector materials will be presented. These include the optical durability of thin glass, thick glass, aluminized reflectors, front-surface mirrors, and silvered polymer mirrors. The development, performance, and durability of these materials will be discussed. Based on accelerated exposure testing the glass, silvered polymer, and front-surface mirrors may meet the 10 year lifetime goals, but at this time because of significant process changes none of the commercially available solar reflectors and advanced solar reflectors have demonstrated the 10 year or more aggressive 20 year lifetime goal.

  9. An Optical Reflector for the CANGAROO-II Telescope

    E-Print Network [OSTI]

    Kawachi, A; Dazeley, S A; Edwards, P G; Gunji, S; Hara, S; Hara, T; Jinbo, J; Kifune, T; Kubo, H; Matsubara, Y; Mizumoto, Y; Mori, M; Moriya, M; Muraishi, H; Muraki, Y; Naito, T; Nishijima, K; Patterson, J R; Roberts, M D; Rowell, G P; Sako, T; Sakurazawa, K; Sato, Y; Susukita, R; Tamura, T; Tanimori, T; Yanagita, S; Yoshida, T; Yoshikoshi, T; Yuki, A; Kawachi, Akiko

    1999-01-01

    We have been successful in developing light and durable mirrors made of CFRP (Carbon Fiber Reinforced Plastic) laminates for the reflector of the new CANGAROO-II 7 m telescope. The reflector has a parabolic shape (F/1.1) with a 30 m^2 effective area which consists of 60 small spherical mirrors of CFRP laminates. The orientation of each mirror can be remotely adjusted by stepping motors. After the first adjustment work, the reflector offers a point image of about $0.^\\circ 14$ (FWHM) on the optic axis.

  10. An Optical Reflector for the CANGAROO-II Telescope

    E-Print Network [OSTI]

    Akiko Kawachi; J. Kushida; S. A. Dazeley; S. A. Dazeley; P. G. Edwards; S. Gunji; S. Hara; T. Hara; J. Jinbo; T. Kifune; H. Kubo; Y. Matsubara; Y. Mizumoto; M. Mori; M. Moriya; H. Muraishi; Y. Muraki; T. Naito; K. Nishijima; J. R. Patterson; M. D. Roberts; G. P. Rowell; T. Sako; K. Sakurazawa; Y. Sato; R. Susukita; T. Tamura; T. Tanimori; S. Yanagita; T. Yoshida; T. Yoshikoshi; A. Yuki

    1999-06-04

    We have been successful in developing light and durable mirrors made of CFRP (Carbon Fiber Reinforced Plastic) laminates for the reflector of the new CANGAROO-II 7 m telescope. The reflector has a parabolic shape (F/1.1) with a 30 m^2 effective area which consists of 60 small spherical mirrors of CFRP laminates. The orientation of each mirror can be remotely adjusted by stepping motors. After the first adjustment work, the reflector offers a point image of about $0.^\\circ 14$ (FWHM) on the optic axis.

  11. Workers' Spotlight Newsletter - Issue 2 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers' Spotlight

  12. Workers' Spotlight Newsletter - Issue 3 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers' Spotlight3

  13. Workers' Spotlight Newsletter - Issue 4 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers' Spotlight34

  14. Workers' Spotlight Newsletter - Issue 5 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers' Spotlight345

  15. Promising Technology: Parabolic Aluminized Reflector Light-Emitting Diodes

    Broader source: Energy.gov [DOE]

    Parabolic aluminized reflectors, or PARs, are directional lamps typically used in recessed lighting. In contrast to CFLs, LEDs offer additional advantages including no warm up time, improved dimming and control capabilities, and for some products much greater efficacy ratings.

  16. The Effect of Reflectors and Delamping Upon Light Levels 

    E-Print Network [OSTI]

    Pashkevich, P. A.

    1989-01-01

    In the 1987 Georgia Institutional Conservation Program ICP), recommendations for installation of reflectors in fluorescent fixtures accompanied by delamping totaled $5.4 million. Concerned with that effects of these recommendations on light levels...

  17. Neutronic evaluation of GCFR core diluents and reflectors

    E-Print Network [OSTI]

    Yu, Kun, 1974-

    2003-01-01

    Materials are evaluated for use as in-core diluents and as peripheral reflectors for Gas-Cooled Fast Reactor (GFR) service, using coupled Monte Carlo (MCNP) and isotopics (ORIGEN) codes. The principal performance indices ...

  18. Solar cell comprising a plasmonic back reflector and method therefor

    DOE Patents [OSTI]

    Ding, I-Kang; Zhu, Jia; Cui, Yi; McGehee, Michael David

    2014-11-25

    A method for forming a solar cell having a plasmonic back reflector is disclosed. The method includes the formation of a nanoimprinted surface on which a metal electrode is conformally disposed. The surface structure of the nanoimprinted surface gives rise to a two-dimensional pattern of nanometer-scale features in the metal electrode enabling these features to collectively form the plasmonic back reflector.

  19. Photochemical reductive elimination of halogen from transition metal complexes

    E-Print Network [OSTI]

    Cook, Timothy R. (Timothy Raymond), 1982-

    2010-01-01

    This thesis is focused on the synthesis and study of transition metal complexes that undergo halogen elimination when irradiated with UV and visible light. This chemistry is relevant for solar energy storage schemes in ...

  20. Enhanced metabolism of halogenated hydrocarbons in transgenic plants containing mammalian

    E-Print Network [OSTI]

    Doty, Sharon Lafferty

    Enhanced metabolism of halogenated hydrocarbons in transgenic plants containing mammalian efficient remediation of many sites contaminated with haloge- nated hydrocarbons. Trichloroethylene (TCE hydrocarbon, ethylene dibromide (EDB; dibromoeth- ane), was used as a soil fumigant to kill nematodes

  1. Halogenated naphthyl methoxy piperidines for mapping serotonin transporter sites

    DOE Patents [OSTI]

    Goodman, M.M.; Faraj, B.

    1999-07-06

    Halogenated naphthyl methoxy piperidines having a strong affinity for the serotonin transporter are disclosed. Those compounds can be labeled with positron-emitting and/or gamma emitting halogen isotopes by a late step synthesis that maximizes the useable lifeterm of the label. The labeled compounds are useful for localizing serotonin transporter sites by positron emission tomography and/or single photon emission computed tomography.

  2. Treatment of halogen-containing waste and other waste materials

    DOE Patents [OSTI]

    Forsberg, Charles W. (Oak Ridge, TN); Beahm, Edward C. (Oak Ridge, TN); Parker, George W. (Concord, TN)

    1997-01-01

    A process for treating a halogen-containing waste material. The process provides a bath of molten glass containing a sacrificial metal oxide capable of reacting with a halogen in the waste material. The sacrificial metal oxide is present in the molten glass in at least a stoichiometric amount with respect to the halogen in the waste material. The waste material is introduced into the bath of molten glass to cause a reaction between the halogen in the waste material and the sacrificial metal oxide to yield a metal halide. The metal halide is a gas at the temperature of the molten glass. The gaseous metal halide is separated from the molten glass and contacted with an aqueous scrubber solution of an alkali metal hydroxide to yield a metal hydroxide or metal oxide-containing precipitate and a soluble alkali metal halide. The precipitate is then separated from the aqueous scrubber solution. The molten glass containing the treated waste material is removed from the bath as a waste glass. The process of the invention can be used to treat all types of waste material including radioactive wastes. The process is particularly suited for separating halogens from halogen-containing wastes.

  3. Treatment of halogen-containing waste and other waste materials

    DOE Patents [OSTI]

    Forsberg, C.W.; Beahm, E.C.; Parker, G.W.

    1997-03-18

    A process is described for treating a halogen-containing waste material. The process provides a bath of molten glass containing a sacrificial metal oxide capable of reacting with a halogen in the waste material. The sacrificial metal oxide is present in the molten glass in at least a stoichiometric amount with respect to the halogen in the waste material. The waste material is introduced into the bath of molten glass to cause a reaction between the halogen in the waste material and the sacrificial metal oxide to yield a metal halide. The metal halide is a gas at the temperature of the molten glass. The gaseous metal halide is separated from the molten glass and contacted with an aqueous scrubber solution of an alkali metal hydroxide to yield a metal hydroxide or metal oxide-containing precipitate and a soluble alkali metal halide. The precipitate is then separated from the aqueous scrubber solution. The molten glass containing the treated waste material is removed from the bath as a waste glass. The process of the invention can be used to treat all types of waste material including radioactive wastes. The process is particularly suited for separating halogens from halogen-containing wastes. 3 figs.

  4. Metal halogen battery system with multiple outlet nozzle for hydrate

    DOE Patents [OSTI]

    Bjorkman, Jr., Harry K. (Birmingham, MI)

    1983-06-21

    A metal halogen battery system, including at least one cell having a positive electrode and a negative electrode contacted by aqueous electrolyte containing the material of said metal and halogen, store means whereby halogen hydrate is formed and stored as part of an aqueous material, means for circulating electrolyte through the cell and to the store means, and conduit means for transmitting halogen gas formed in the cell to a hydrate former whereby the hydrate is formed in association with the store means, said store means being constructed in the form of a container which includes a filter means, said filter means being inoperative to separate the hydrate formed from the electrolyte, said system having, a hydrate former pump means associated with the store means and being operative to intermix halogen gas with aqueous electrolyte to form halogen hydrate, said hydrate former means including, multiple outlet nozzle means connected with the outlet side of said pump means and being operative to minimize plugging, said nozzle means being comprised of at least one divider means which is generally perpendicular to the rotational axes of gears within the pump means, said divider means acting to divide the flow from the pump means into multiple outlet flow paths.

  5. EECBG Success Story: The City of Los Angeles Has Its Spotlight...

    Energy Savers [EERE]

    World" -- now has its spotlight on energy efficiency. The city of Los Angeles held a press event to wrap up the Department of Energy's Energy Efficiency Community Block Grant...

  6. IUFRO Spotlight #19/ April 2014 / IUFRO World Congress `Citizen science': A way to fight invasive species?

    E-Print Network [OSTI]

    California at Berkeley, University of

    IUFRO Spotlight #19/ April 2014 / IUFRO World Congress `Citizen science': A way to fight invasive of a tree can mean to different social groups. The organizers see this "citizen science" (one definition

  7. Application of the OPTEX method for computing reflector parameters

    SciTech Connect (OSTI)

    Hebert, A. [Ecole Polytechnique de Montreal, C.P. 6079 suce. Centre-Ville, Montreal QC. H3C 3A7 (Canada); Leroyer, H. [EDF - R and D, SINETICS, 1 Avenue du General de Gaulle, 92141 Clamart (France)

    2013-07-01

    We are investigating the OPTEX reflector model for obtaining few-group reflector parameters consistent with a reference power distribution in the core. In our study, the reference power distribution is obtained using a 142,872-region calculation defined over a 2D eighth-of-core pressurized water reactor and performed with the method of characteristics. The OPTEX method is based on generalized perturbation theory and uses an optimization algorithm known as parametric linear complementarity pivoting. The proposed model leads to few-group diffusion coefficients or P1-weighted macroscopic total cross sections that can be used to represent the reflector in full-core calculations. These few-group parameters can be spatially heterogeneous in order to correctly represent steel baffles present in modern pressurized water reactors. The optimal reflector parameters are compared to those obtained with a flux-volume weighting of the reflector cross sections recovered from the reference calculation. Important improvements in full-core power distribution are observed when the optimal parameters are used. (authors)

  8. A powerful reflector in relativistic backward wave oscillator

    SciTech Connect (OSTI)

    Cao, Yibing, E-mail: caoyibing@nint.ac.cn; Sun, Jun; Teng, Yan; Zhang, Yuchuan; Zhang, Lijun; Shi, Yanchao; Ye, Hu; Chen, Changhua [Science and Technology on High Power Microwave Laboratory, Northwest Institute of Nuclear Technology, Xi'an, Shaanxi 710024 (China)

    2014-09-15

    An improved TM{sub 021} resonant reflector is put forward. Similarly with most of the slow wave structures used in relativistic backward wave oscillator, the section plane of the proposed reflector is designed to be trapezoidal. Compared with the rectangular TM{sub 021} resonant reflector, such a structure can depress RF breakdown more effectively by weakening the localized field convergence and realizing good electrostatic insulation. As shown in the high power microwave (HPM) generation experiments, with almost the same output power obtained by the previous structure, the improved structure can increase the pulse width from 25?ns to over 27?ns and no obvious surface damage is observed even if the generated HPM pulses exceed 1000 shots.

  9. An Optical Reflector System for the CANGAROO-II Telescope

    E-Print Network [OSTI]

    Akiko Kawachi

    1999-11-30

    We have developed light and durable mirrors made of CFRP (Carbon Fiber Reinforced Plastics) laminates for the reflector of the new CANGAROO-II 7 m telescope. The reflector has a parabolic shape (F/1.1) with a 30 m^2 effective area which consists of 60 small spherical mirrors. The attitude of each mirror can be remotely adjusted by stepping motors. After the first adjustment work, the re ector offers a point image of about 0.14 degree (FWHM) on the optic axis. The telescope has been in operation since May 1999 with an energy threshold of ~ 300 GeV.

  10. An Optical Reflector System for the CANGAROO-II Telescope

    E-Print Network [OSTI]

    Kawachi, A

    1999-01-01

    We have developed light and durable mirrors made of CFRP (Carbon Fiber Reinforced Plastics) laminates for the reflector of the new CANGAROO-II 7 m telescope. The reflector has a parabolic shape (F/1.1) with a 30 m^2 effective area which consists of 60 small spherical mirrors. The attitude of each mirror can be remotely adjusted by stepping motors. After the first adjustment work, the re ector offers a point image of about 0.14 degree (FWHM) on the optic axis. The telescope has been in operation since May 1999 with an energy threshold of ~ 300 GeV.

  11. Halogenated 1'-methyl-1,2'-bipyrroles (MBPs) in the Norwestern Atlantic

    E-Print Network [OSTI]

    Pangallo, Kristin C

    2009-01-01

    Halogenated 1'-methyl-1,2'-bipyrroles (MBPs) are a distinctive class of marine organic compounds. They are naturally produced, they have a unique carbon structure, they are highly halogenated, and they bioaccumulate in ...

  12. Dual annular rotating [open quotes]windowed[close quotes] nuclear reflector reactor control system

    DOE Patents [OSTI]

    Jacox, M.G.; Drexler, R.L.; Hunt, R.N.M.; Lake, J.A.

    1994-03-29

    A nuclear reactor control system is provided in a nuclear reactor having a core operating in the fast neutron energy spectrum where criticality control is achieved by neutron leakage. The control system includes dual annular, rotatable reflector rings. There are two reflector rings: an inner reflector ring and an outer reflector ring. The reflectors are concentrically assembled, surround the reactor core, and each reflector ring includes a plurality of openings. The openings in each ring are capable of being aligned or non-aligned with each other. Independent driving means for each of the annular reflector rings is provided so that reactor criticality can be initiated and controlled by rotation of either reflector ring such that the extent of alignment of the openings in each ring controls the reflection of neutrons from the core. 4 figures.

  13. CALiPER Benchmark Report: Performance of Halogen Incandescent MR16 Lamps and LED Replacement

    SciTech Connect (OSTI)

    None

    2008-11-01

    This benchmark report addresses the halogen MR16 lamp and its commercially available light-emitting diode (LED) replacements.

  14. Symmetric and asymmetric halogen-containing metallocarboranylporphyrins and uses thereof

    DOE Patents [OSTI]

    Miura, Michiko; Wu, Haitao

    2013-05-21

    The present invention is directed to low toxicity boronated compounds and methods for their use in the treatment, visualization, and diagnosis of tumors. More specifically, the present invention is directed to low toxicity halogenated, carborane-containing 5,10,15,20-tetraphenylporphyrin compounds and methods for their use particularly in boron neutron capture therapy (BNCT) and photodynamic therapy (PDT) for the treatment of tumors of the brain, head and neck, and surrounding tissue. The invention is also directed to using these halogenated, carborane-containing tetraphenylporphyrin compounds in methods of tumor imaging and/or diagnosis such as MRI, SPECT, or PET.

  15. Steam-circuit Model for the Compact Linear Fresnel Reflector , G. L. Morrison1

    E-Print Network [OSTI]

    Steam-circuit Model for the Compact Linear Fresnel Reflector Prototype J. D. Pye1 , G. L. Morrison1.pye@student.unsw.edu.au Abstract The Compact Linear Fresnel Reflector (CLFR) is a linear-concentrating solar thermal energy system The Compact Linear Fresnel Reflector (CLFR) was first conceived of in 1992-1993 and was patented in 1995

  16. Long-Life Self-Renewing Solar Reflector Stack

    DOE Patents [OSTI]

    Butler, Barry Lynn (Solana Beach, CA)

    1997-07-08

    A long-life solar reflector includes a solar collector substrate and a base layer bonded to a solar collector substrate. The first layer includes a first reflective layer and a first acrylic or transparent polymer layer covering the first reflective layer to prevent exposure of the first reflective layer. The reflector also includes at least one upper layer removably bonded to the first acrylic or transparent polymer layer of the base layer. The upper layer includes a second reflective layer and a second acrylic or transparent polymer layer covering the second reflective layer to prevent exposure of the second reflective layer. The upper layer may be removed from the base reflective layer to expose the base layer, thereby lengthening the useful life of the solar reflector. A method of manufacturing a solar reflector includes the steps of bonding a base layer to a solar collector substrate, wherein the base reflective layer includes a first reflective layer and a first transparent polymer or acrylic layer covering the first reflective layer; and removably bonding a first upper layer to the first transparent polymer or acrylic layer of the base layer. The first upper layer includes a second reflective layer and a second transparent polymer or acrylic layer covering the second reflective layer to prevent exposure of the second reflective layer.

  17. Step-Stress Accelerated Degradation Testing for Solar Reflectors: Preprint

    SciTech Connect (OSTI)

    Jones, W.; Elmore, R.; Lee, J.; Kennedy, C.

    2011-09-01

    To meet the challenge to reduce the cost of electricity generated with concentrating solar power (CSP) new low-cost reflector materials are being developed including metalized polymer reflectors and must be tested and validated against appropriate failure mechanisms. We explore the application of testing methods and statistical inference techniques for quantifying estimates and improving lifetimes of concentrating solar power (CSP) reflectors associated with failure mechanisms initiated by exposure to the ultraviolet (UV) part of the solar spectrum. In general, a suite of durability and reliability tests are available for testing a variety of failure mechanisms where the results of a set are required to understand overall lifetime of a CSP reflector. We will focus on the use of the Ultra-Accelerated Weathering System (UAWS) as a testing device for assessing various degradation patterns attributable to accelerated UV exposure. Depending on number of samples, test conditions, degradation and failure patterns, test results may be used to derive insight into failure mechanisms, associated physical parameters, lifetimes and uncertainties. In the most complicated case warranting advanced planning and statistical inference, step-stress accelerated degradation (SSADT) methods may be applied.

  18. Method for selective dehalogenation of halogenated polyaromatic compounds

    DOE Patents [OSTI]

    Farcasiu, Malvina (Pittsburgh, PA); Petrosius, Steven C. (Library, PA)

    1994-01-01

    A method for dehalogenating halogenated polyaromatic compounds is provided wherein the polyaromatic compounds are mixed with a hydrogen donor solvent and a carbon catalyst in predetermined proportions, the mixture is maintained at a predetermined pressure, and the mixture is heated to a predetermined temperature and for a predetermined time.

  19. Alkali and Halogen Chemistry in Volcanic Gases on Io

    E-Print Network [OSTI]

    Laura Schaefer; Bruce Fegley Jr

    2004-09-20

    We use chemical equilibrium calculations to model the speciation of alkalis and halogens in volcanic gases emitted on Io. The calculations cover wide temperature (500-2000 K) and pressure (10^-6 to 10^+1 bars) ranges, which overlap the nominal conditions at Pele (T = 1760 K, P = 0.01 bars). About 230 compounds of 11 elements (O, S, Li, Na, K, Rb, Cs, F, Cl, Br, I) are considered. We predict the major alkali and halogen species in a Pele-like volcanic gas and the major alklai and halogen condensates. We also model disequilibrium chemistry of the alkalis and halogens in the volcanic plume. Based on this work and our prior modeling for Na, K, and Cl in a volcanic plume, we predict the major loss processes for the alkali halide gases are photolysis and/or condensation onto grains. On the basis of elemental abundances and photochemical lifetimes, we recommend searching for gaseous KCl, NaF, LiF, LiCl, RbF, RbCl, CsF, and CsCl around volcanic vents during eruptions. Based on abundance considerations and observations of brown dwarfs, we also recommend a search of Io's extended atmosphere and the Io plasma torus for neutral and ionized Li, Cs, Rb, and F.

  20. Cube-corner reflectors with interference dielectric coating

    SciTech Connect (OSTI)

    Sokolov, A L; Murashkin, V V; Akent'ev, A S; Karaseva, E A

    2013-09-30

    The cube-corner reflectors (CCRs) with a special interference dielectric coating intended for ring retroreflector systems of space vehicles with uniaxial orientation are considered. The diffraction patterns of radiation reflected from the CCRs with different face coatings are studied. It is shown that the choice of the angle between the faces, the size and the coating of CCR faces allow essential variation in the diffraction pattern, thereby providing its optimisation for solving different navigation problems. (nanogradient dielectric coatings and metamaterials)

  1. RE@21 Spotlight: Most Influential Papers from the Requirements Engineering Conference

    E-Print Network [OSTI]

    Wieringa, Roel

    RE@21 Spotlight: Most Influential Papers from the Requirements Engineering Conference Martin Glinz, an award has been presented annually at the IEEE International Requirements Engineering Conference for the Most Influential Paper presented at the conference 10 years previously. In 2013, we celebrate 21 years

  2. Chem 115Lithium-Halogen ExchangeMyers RLi + R'X RX + R'Li

    E-Print Network [OSTI]

    Chem 115Lithium-Halogen ExchangeMyers RLi + R'X RX + R'Li Lithium-halogen exchange reactions are essentially inert. 2 t-BuLi t-BuI + RLi t-BuLi isobutene + isobutane + LiI Lithium-halogen exchange reactions, and lithium iodide. H OEtBr H H OEtLi H1.1 eq n-BuLi Et2O, !80 °C Lau, K. S.; Schlosser, M. J. Org. Chem. 1978

  3. Analysis and Characterization of Halogenated Transformation Products of Pharmaceuticals and Personal Care Products in Wastewater Effluent

    E-Print Network [OSTI]

    Bulloch, Daryl Neil

    2013-01-01

    for Halogenated Analogs of Bisphenol A. Environ. Healthof aqueous chlorination of bisphenol A and their estrogenicJ. L. ; Olea, N. , Bisphenol-A and chlorinated derivatives

  4. Optical device with low electrical and thermal resistance bragg reflectors

    DOE Patents [OSTI]

    Lear, Kevin L. (Albuquerque, NM)

    1996-01-01

    A compound-semiconductor optical device and method. The optical device is provided with one or more asymmetrically-graded heterojunctions between compound semiconductor layers for forming a distributed Bragg reflector mirror having an improved electrical and thermal resistance. Efficient light-emitting devices such as light-emitting diodes, resonant-cavity light-emitting diodes, and vertical-cavity surface-emitting lasers may be formed according to the present invention, which may be applied to the formation of resonant-cavity photodetectors.

  5. Reflector and Shield Material Properties for Project Prometheus

    SciTech Connect (OSTI)

    J. Nash

    2005-11-02

    This letter provides updated reflector and shield preliminary material property information to support reactor design efforts. The information provided herein supersedes the applicable portions of Revision 1 to the Space Power Program Preliminary Reactor Design Basis (Reference (a)). This letter partially answers the request in Reference (b) to provide unirradiated and irradiated material properties for beryllium, beryllium oxide, isotopically enriched boron carbide ({sup 11}B{sub 4}C) and lithium hydride. With the exception of {sup 11}B{sub 4}C, the information is provided in Attachments 1 and 2. At the time of issuance of this document, {sup 11}B{sub 4}C had not been studied.

  6. Zinc halogen battery electrolyte composition with lead additive

    DOE Patents [OSTI]

    Henriksen, Gary L. (Troy, MI)

    1981-01-01

    This disclosure relates to a zinc halogen battery electrolyte composition containing an additive providing improved zinc-on-zinc recyclability. The improved electrolyte composition involves the use of a lead additive to inhibit undesirable irregular plating and reduce nodular or dendritic growth on the electrode surface. The lead-containing electrolyte composition of the present invention appears to influence not only the morphology of the base plate zinc, but also the morphology of the zinc-on-zinc replate. In addition, such lead-containing electrolyte compositions appear to reduce hydrogen formation.

  7. Halogen eAppraisal - Performance Appraisals | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFESOpportunitiesNERSCGrid-based29Hai Ah Nam Hai Ah Nam-TheHalogen

  8. DISSERTATION ELECTRON-REFLECTOR STRATEGY FOR CdTe THIN-FILM SOLAR CELLS

    E-Print Network [OSTI]

    Sites, James R.

    DISSERTATION ELECTRON-REFLECTOR STRATEGY FOR CdTe THIN-FILM SOLAR CELLS Submitted by Kuo-Jui Hsiao ELECTRON- REFLECTOR STRATEGY FOR CdTe THIN-FILM SOLAR CELLS BE ACCEPTED AS FULFILLING IN PART REQUIREMENTS-FILM SOLAR CELLS The CdTe thin-film solar cell has a large absorption coefficient and high theoretical

  9. Reflector for efficient coupling of a laser beam to air or other fluids

    DOE Patents [OSTI]

    Kare, J.T.

    1992-10-06

    A reflector array is disclosed herein that provides a controlled region or regions of plasma breakdowns from a laser beam produced at a remotely-based laser source. The plasma may be applied to produce thrust to propel a spacecraft, or to diagnose a laser beam, or to produce shock waves. The spacecraft propulsion system comprises a reflector array attached to the vehicle. The reflector array comprises a plurality of reflectors spaced apart on a reflective surface, with each reflector acting as an independent focusing mirror. The reflectors are spaced closely together to form a continuous or partially-continuous surface. The reflector array may be formed from a sheet of reflective material, such as copper or aluminum. In operation, a beam of electromagnetic energy, such as a laser beam, is directed at the reflectors which focus the reflected electromagnetic energy at a plurality of regions off the surface. The energy concentrated in the focal region causes a breakdown of the air or other fluid in the focal region, creating a plasma. Electromagnetic energy is absorbed in the plasma and it grows in volume, compressing and heating the adjacent fluid thereby providing thrust. Laser pulses may be applied repetitively. After each such thrust pulse, fresh air can be introduced next to the surface either laterally, or through a perforated surface. If air or some other gas or vapor is supplied, for example from a tank carried on board a vehicle, this invention may also be used to provide thrust in a vacuum environment. 10 figs.

  10. Reflector for efficient coupling of a laser beam to air or other fluids

    DOE Patents [OSTI]

    Kare, Jordin T. (Pleasanton, CA)

    1992-01-01

    A reflector array is disclosed herein that provides a controlled region or regions of plasma breakdowns from a laser beam produced at a remotely-based laser source. The plasma may be applied to produce thrust to propel a spacecraft, or to diagnose a laser beam, or to produce shockwaves. The spacecraft propulsion system comprises a reflector array attached to the vehicle. The reflector array comprises a plurality of reflectors spaced apart on a reflective surface, with each reflector acting as an independent focusing mirror. The reflectors are spaced closely together to form a continuous or partially-continuous surface. The reflector array may be formed from a sheet of reflective material, such as copper or aluminum. In operation, a beam of electromagnetic energy, such as a laser beam, is directed at the reflectors which focus the reflected electromagnetic energy at a plurality of regions off the surface. The energy concentrated in the focal region causes a breakdown of the air or other fluid in the focal region, creating a plasma. Electromagnetic energy is absorbed in the plasma and it grows in volume, compressing and heating the adjacent fluid thereby providing thrust. Laser pulses may be applied repetitively. After each such thrust pulse, fresh air can be introduced next to the surface either laterally, or through a perforated surface. If air or some other gas or vapor is supplied, for example from a tank carried on board a vehicle, this invention may also be used to provide thrust in a vacuum environment.

  11. Advanced Manufacture of Second-Surface, Silvered Glass Reflectors for High-Performance, Low-Cost CSP Collector Systems

    Broader source: Energy.gov [DOE]

    Advanced Manufacture of Second-Surface, Silvered Glass Reflectors for High-Performance, Low-Cost CSP Collector Systems

  12. AlGaAsSb/GaSb Distributed Bragg Reflectors Grown by Organometallic Vapor Phase Epitaxy

    SciTech Connect (OSTI)

    C.A. Wang; C.J. Vineis; D.R. Calawa

    2002-02-13

    The first AlGaAsSb/GaSb quarter-wave distributed Bragg reflectors grown by metallic vapor phase epitaxy are reported. The peak reflectance is 96% for a 10-period structure.

  13. Acoustic Bragg reflectors for Q-enhancement of unreleased MEMS resonators

    E-Print Network [OSTI]

    Wang, Wentao, S.M. Massachusetts Institute of Technology

    2011-01-01

    In this thesis, the author introduces the first fully unreleased Micro-Electro-Mechanical (MEM) resonator, and the design of acoustic Bragg reflectors (ABRs) for energy localization and quality factor (Q)- enhancement for ...

  14. Acoustic Bragg Reflectors for Q-Enhancement of Unreleased MEMS Resonators

    E-Print Network [OSTI]

    Wang, Wentao

    This work presents the design of acoustic Bragg reflectors (ABRs) for unreleased MEMS resonators through analysis and simulation. Two of the greatest challenges to the successful implementation of MEMS are those of packaging ...

  15. The optical reflector system for the CANGAROO-II imaging atmospheric Cherenkov telescope

    E-Print Network [OSTI]

    A. Kawachi; Y. Hayami; J. Jimbo; S. Kamei; T. Kifune; H. Kubo; J. Kushida; S. LeBohec; K. Miyawaki; M. Mori; K. Nishijima; J. R. Patterson; R. Suzuki; T. Tanimori; S. Yanagita; T. Yoshikoshi; A. Yuki

    2000-07-14

    A new imaging atmospheric Cherenkov telescope (CANGAROO-II) with a light-weight reflector has been constructed. Light, robust, and durable mirror facets of containing CFRP (Carbon Fiber Reinforced Plastic) laminates were developed for the telescope. The attitude of each facet can be adjusted by stepping motors. In this paper, we describe the design, manufacturing, alignment procedure, and the performance of the CANGAROO-II optical reflector system.

  16. The optical reflector system for the CANGAROO-II imaging atmospheric Cherenkov telescope

    E-Print Network [OSTI]

    Kawachi, A; Jimbo, J; Kamei, S; Kifune, T; Kubo, H; Kushida, J; Le Bohec, S; Miyawaki, K; Mori, M; Nishijima, K; Patterson, J R; Suzuki, R; Tanimori, T; Yanagita, S; Yoshikoshi, T; Yuki, A

    2001-01-01

    A new imaging atmospheric Cherenkov telescope (CANGAROO-II) with a light-weight reflector has been constructed. Light, robust, and durable mirror facets of containing CFRP (Carbon Fiber Reinforced Plastic) laminates were developed for the telescope. The attitude of each facet can be adjusted by stepping motors. In this paper, we describe the design, manufacturing, alignment procedure, and the performance of the CANGAROO-II optical reflector system.

  17. Photodetector with absorbing region having resonant periodic absorption between reflectors

    DOE Patents [OSTI]

    Bryan, R.P.; Olbright, G.R.; Brennan, T.M.; Tsao, J.Y.

    1995-02-14

    A photodetector is disclosed that is responsive to a wavelength or wavelengths of interest which have heretofore been unrealized. The photodetector includes a resonant cavity structure bounded by first and second reflectors, the resonant cavity structure being resonant at the wavelength or wavelengths of interest for containing a plurality of standing waves therein. The photodetector further includes a radiation absorbing region disposed within the resonant cavity structure, the radiation absorbing region including a plurality of radiation absorbing layers spaced apart from one another by a distance substantially equal to a distance between antinodes of adjacent ones of the standing waves. Each of radiation absorbing layers is spatially positioned at a location of one of the antinodes of one of the standing waves such that radiation absorption is enhanced. The radiation absorbing layers may be either bulk layers or quantum wells includes a plurality of layers, each of which is comprised of a strained layer of InGaAs. Individual ones of the InGaAs layers are spaced apart from one another by a GaAs barrier layer. 11 figs.

  18. Photodetector with absorbing region having resonant periodic absorption between reflectors

    DOE Patents [OSTI]

    Bryan, Robert P. (Boulder, CO); Olbright, Gregory R. (Boulder, CO); Brennan, Thomas M. (Albuquerque, NM); Tsao, Jeffrey Y. (Albuquerque, NM)

    1995-02-14

    A photodetector that is responsive to a wavelength or wavelengths of interest which have heretofore been unrealized. The photodetector includes a resonant cavity structure bounded by first and second reflectors, the resonant cavity structure being resonant at the wavelength or wavelengths of interest for containing a plurality of standing waves therein. The photodetector further includes a radiation absorbing region disposed within the resonant cavity structure, the radiation absorbing region including a plurality of radiation absorbing layers spaced apart from one another by a distance substantially equal to a distance between antinodes of adjacent ones of the standing waves. Each of radiation absorbing layers is spatially positioned at a location of one of the antinodes of one of the standing waves such that radiation absorption is enhanced. The radiation absorbing layers may be either bulk layers or quantum wells includes a plurality of layers, each of which is comprised of a strained layer of InGaAs. Individual ones of the InGaAs layers are spaced apart from one another by a GaAs barrier layer.

  19. Catalytic, Asymmetric r-Halogenation Harald Wack, Andrew E. Taggi, Ahmed M. Hafez,

    E-Print Network [OSTI]

    Lectka, Thomas

    reported "relay" deprotonation strategy,5 in which protons are shuttled from the chiral amine catalyst Phenylacetyl chloride 1a was used as a test substrate to screen the various halogenating agents using 10 mol

  20. C3E Spotlights Women Leaders in Clean Energy Careers | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room News PublicationsAudits &Bradbury Science Museum6 Shares of U.S.6Low-CostC3E Spotlights

  1. Spotlight: Two Los Alamos scientists honored with E.O. Lawrence Awards

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect Photovoltaics -7541C.3 SpecialSponsor Guidelines Candidates f orSpotlight:Two

  2. Replacing Incandescent Lightbulbs and Ballasts | Department of...

    Energy Savers [EERE]

    (R)or parabolic reflector (PAR) CFLs for flood and spotlighting. Some CFL fixtures have built-in electronic ballasts and polished metal reflectors. When used in recessed...

  3. Heavy reflector experiments in the IPEN/MB-01 reactor: Stainless steel, carbon steel and nickel

    SciTech Connect (OSTI)

    Santos, Adimir dos; Andrade e Silva, Graciete Simoes de; Jerez, Rogerio; Liambos Mura, Luis Felipe; Fuga, Rinaldo [Instituto de Pesquisas Energeticas e Nucleares - IPEN-CNEN/SP Av. Prof. Lineu Prestes 2242 - CEP 05508-000 Sao Paulo, SP (Brazil)

    2013-05-06

    New experiments devoted to the measurements of physical parameters of a light water core surrounded by a heavy reflector were performed in the IPEN/MB-01 research reactor facility. These experiments comprise three sets of heavy reflector (SS-304, Carbon Steel, and Nickel) in a form of laminates around 3 mm thick. Each set was introduced individually in the west face of the core of the IPEN/MB-01 reactor. The aim here is to provide high quality experimental data for the interpretation and validation of the SS-304 heavy reflector calculation methods. The experiments of Carbon Steel, which is composed mainly of iron, and Nickel were performed to provide a consistent and an interpretative check for the SS-304 reflector experiment. The experimental results comprise critical control bank positions, temperatures and reactivities as a function of the number of the plates. Particularly to the case of Nickel, the experimental data are unique of its kind. The theoretical analysis was performed by MCNP-5 with the nuclear data library ENDF/B-VII.0. It was shown that this nuclear data library has a very good performance up to thirteen plates and overestimates the reactivity for higher number of plates independently of the type of the reflector.

  4. Analysis of Halogen-Mercury Reactions in Flue Gas

    SciTech Connect (OSTI)

    Paula Buitrago; Geoffrey Silcox; Constance Senior; Brydger Van Otten

    2010-01-01

    Oxidized mercury species may be formed in combustion systems through gas-phase reactions between elemental mercury and halogens, such as chorine or bromine. This study examines how bromine species affect mercury oxidation in the gas phase and examines the effects of mixtures of bromine and chlorine on extents of oxidation. Experiments were conducted in a bench-scale, laminar flow, methane-fired (300 W), quartz-lined reactor in which gas composition (HCl, HBr, NO{sub x}, SO{sub 2}) and temperature profile were varied. In the experiments, the post-combustion gases were quenched from flame temperatures to about 350 C, and then speciated mercury was measured using a wet conditioning system and continuous emissions monitor (CEM). Supporting kinetic calculations were performed and compared with measured levels of oxidation. A significant portion of this report is devoted to sample conditioning as part of the mercury analysis system. In combustion systems with significant amounts of Br{sub 2} in the flue gas, the impinger solutions used to speciate mercury may be biased and care must be taken in interpreting mercury oxidation results. The stannous chloride solution used in the CEM conditioning system to convert all mercury to total mercury did not provide complete conversion of oxidized mercury to elemental, when bromine was added to the combustion system, resulting in a low bias for the total mercury measurement. The use of a hydroxylamine hydrochloride and sodium hydroxide solution instead of stannous chloride showed a significant improvement in the measurement of total mercury. Bromine was shown to be much more effective in the post-flame, homogeneous oxidation of mercury than chlorine, on an equivalent molar basis. Addition of NO to the flame (up to 400 ppmv) had no impact on mercury oxidation by chlorine or bromine. Addition of SO{sub 2} had no effect on mercury oxidation by chlorine at SO{sub 2} concentrations below about 400 ppmv; some increase in mercury oxidation was observed at SO{sub 2} concentrations of 400 ppmv and higher. In contrast, SO{sub 2} concentrations as low as 50 ppmv significantly reduced mercury oxidation by bromine, this reduction could be due to both gas and liquid phase interactions between SO{sub 2} and oxidized mercury species. The simultaneous presence of chlorine and bromine in the flue gas resulted in a slight increase in mercury oxidation above that obtained with bromine alone, the extent of the observed increase is proportional to the chlorine concentration. The results of this study can be used to understand the relative importance of gas-phase mercury oxidation by bromine and chlorine in combustion systems. Two temperature profiles were tested: a low quench (210 K/s) and a high quench (440 K/s). For chlorine the effects of quench rate were slight and hard to characterize with confidence. Oxidation with bromine proved sensitive to quench rate with significantly more oxidation at the lower rate. The data generated in this program are the first homogeneous laboratory-scale data on bromine-induced oxidation of mercury in a combustion system. Five Hg-Cl and three Hg-Br mechanisms, some published and others under development, were evaluated and compared to the new data. The Hg-halogen mechanisms were combined with submechanisms from Reaction Engineering International for NO{sub x}, SO{sub x}, and hydrocarbons. The homogeneous kinetics under-predicted the levels of mercury oxidation observed in full-scale systems. This shortcoming can be corrected by including heterogeneous kinetics in the model calculations.

  5. Process for removing halogenated aliphatic and aromatic compounds from petroleum products

    DOE Patents [OSTI]

    Googin, John M. (Oak Ridge, TN); Napier, John M. (Oak Ridge, TN); Travaglini, Michael A. (Oliver Springs, TN)

    1983-01-01

    A process for removing halogenated aliphatic and aromatic compounds, e.g., polychlorinated biphenyls, from petroleum products by solvent extraction. The halogenated aliphatic and aromatic compounds are extracted from a petroleum product into a polar solvent by contacting the petroleum product with the polar solvent. The polar solvent is characterized by a high solubility for the extracted halogenated aliphatic and aromatic compounds, a low solubility for the petroleum product and considerable solvent power for polyhydroxy compound. The preferred polar solvent is dimethylformamide. A miscible compound, such as, water or a polyhydroxy compound, is added to the polar extraction solvent to increase the polarity of the polar extraction solvent. The halogenated aliphatic and aromatic compounds are extracted from the highly-polarized mixture of water or polyhydroxy compound and polar extraction solvent into a low polar or nonpolar solvent by contacting the water or polyhydroxy compound-polar solvent mixture with the low polar or nonpolar solvent. The halogenated aliphatic and aromatic compounds and the low polar or nonpolar solvent are separated by physical means, e.g., vacuum evaporation. The polar and nonpolar solvents are recovered from recycling. The process can easily be designed for continuous operation. Advantages of the process include that the polar solvent and a major portion of the nonpolar solvent can be recycled, the petroleum products are reclaimable and the cost for disposing of waste containing polychlorinated biphenyls is significantly reduced.

  6. Process for removing halogenated aliphatic and aromatic compounds from petroleum products

    DOE Patents [OSTI]

    Googin, J.M.; Napier, J.M.; Travaglini, M.A.

    1983-09-20

    A process is described for removing halogenated aliphatic and aromatic compounds, e.g., polychlorinated biphenyls, from petroleum products by solvent extraction. The halogenated aliphatic and aromatic compounds are extracted from a petroleum product into a polar solvent by contacting the petroleum product with the polar solvent. The polar solvent is characterized by a high solubility for the extracted halogenated aliphatic and aromatic compounds, a low solubility for the petroleum product and considerable solvent power for polyhydroxy compound. The preferred polar solvent is dimethylformamide. A miscible compound, such as, water or a polyhydroxy compound, is added to the polar extraction solvent to increase the polarity of the polar extraction solvent. The halogenated aliphatic and aromatic compounds are extracted from the highly-polarized mixture of water or polyhydroxy compound and polar extraction solvent into a low polar or nonpolar solvent by contacting the water or polyhydroxy compound-polar solvent mixture with the low polar or nonpolar solvent. The halogenated aliphatic and aromatic compounds and the low polar or nonpolar solvent are separated by physical means, e.g., vacuum evaporation. The polar and nonpolar solvents are recovered from recycling. The process can easily be designed for continuous operation. Advantages of the process include that the polar solvent and a major portion of the nonpolar solvent can be recycled, the petroleum products are reclaimable and the cost for disposing of waste containing polychlorinated biphenyls is significantly reduced. 1 fig.

  7. Long-range, full-duplex, modulated-reflector cell phone for voice/data transmission

    DOE Patents [OSTI]

    Neagley, Daniel L. (Albuquerque, NM); Briles, Scott D. (Los Alamos, NM); Coates, Don M. (Santa Fe, NM); Freund, Samuel M. (Los Alamos, NM)

    2002-01-01

    A long-range communications apparatus utilizing modulated-reflector technology is described. The apparatus includes an energy-transmitting base station and remote units that do not emit radiation in order to communicate with the base station since modulated-reflector technology is used whereby information is attached to an RF carrier wave originating from the base station which is reflected by the remote unit back to the base station. Since the remote unit does not emit radiation, only a low-power power source is required for its operation. Information from the base station is transmitted to the remote unit using a transmitter and receiver, respectively. The range of such a communications system is determined by the properties of a modulated-reflector half-duplex link.

  8. Design and performance of a low-cost acrylic reflector for a ~7x concentrating photovoltaic module

    E-Print Network [OSTI]

    Rollins, Andrew M.

    Design and performance of a low-cost acrylic reflector for a ~7x concentrating photovoltaic module OH 44106 ABSTRACT Replex Plastics aims to develop a low-cost, low-concentration photovoltaic module concentrator; CPC; low concentration photovoltaics, CPV, LCPV, acrylic reflector 1. INTRODUCTION The recent

  9. Study on differences between high contrast grating reflectors for TM and TE polarizations and their impact on VCSEL designs

    E-Print Network [OSTI]

    Chung, Il-Sug

    2015-01-01

    A theoretical study of differences in broadband high-index-contrast grating (HCG) reflectors for TM and TE polarizations is presented, covering various grating parameters and properties of HCGs. It is shown that the HCG reflectors for TM polarization (TM HCG reflectors) have much thicker grating thicknesses and smaller grating periods than the TE HCG reflectors. This difference is found to originate from the different boundary conditions met for the electric field of each polarization. Due to this difference, the TM HCG reflectors have much shorter evanescent extension of HCG modes into low-refractive-index media surrounding the HCG. This enables to achieve a very short effective cavity length for VCSELs, which is essential for ultrahigh speed VCSELs and MEMS-tunable VCSELs. The obtained understandings on polarization dependences will be able to serve as important design guidelines for various HCG-based devices.

  10. An Advanced Computational Scheme for the Optimization of 2D Radial Reflectors in Pressurized Water Reactors

    E-Print Network [OSTI]

    Thomas Clerc; Alain Hébert; Hadrien Leroyer; Jean-Philippe Argaud; Bertrand Bouriquet; Agélique Ponçot

    2014-05-12

    This paper presents a computational scheme for the determination of equivalent 2D multi-group heterogeneous reflectors in a Pressurized Water Reactor (PWR). The proposed strategy is to define a full-core calculation consistent with a reference lattice code calculation such as the Method Of Characteristics (MOC) as implemented in APOLLO2 lattice code. The computational scheme presented here relies on the data assimilation module known as "Assimilation de donn\\'{e}es et Aide \\`{a} l'Optimisation (ADAO)" of the SALOME platform developed at \\'{E}lectricit\\'{e} De France (EDF), coupled with the full-core code COCAGNE and with the lattice code APOLLO2. A first validation of the computational scheme is made using the OPTEX reflector model developed at \\'{E}cole Polytechnique de Montr\\'{e}al (EPM). As a result, we obtain 2D multi-group, spatially heterogeneous 2D reflectors, using both diffusion or $\\text{SP}_{\\text{N}}$ operators. We observe important improvements of the power discrepancies distribution over the core when using reflectors computed with the proposed computational scheme, and the $\\text{SP}_{\\text{N}}$ operator enables additional improvements.

  11. A SOLAR STILL AUGMENTED WITH A FLAT-PLATE COLLECTOR AND A REFLECTOR

    E-Print Network [OSTI]

    A SOLAR STILL AUGMENTED WITH A FLAT-PLATE COLLECTOR AND A REFLECTOR A. Saleh A. Badran Mechanical ­ Jordan Amman ­ Jordan e-mail: asaleh@philadelphia.edu.jo e-mail: badran@ju.edu.jo ABSTRACT A solar distillation system was built and tested to study the effect of increasing the solar radiation incident

  12. A Generalized Adjoint Approach for Quantifying Reflector Assembly Discontinuity Factor Uncertainties

    SciTech Connect (OSTI)

    Yankov, Artem [University of Michigan] [University of Michigan; Collins, Benjamin [University of Michigan] [University of Michigan; Jessee, Matthew Anderson [ORNL] [ORNL; Downar, Thomas [University of Michigan] [University of Michigan

    2012-01-01

    Sensitivity-based uncertainty analysis of assembly discontinuity factors (ADFs) can be readily performed using adjoint methods for infinite lattice models. However, there is currently no adjoint-based methodology to obtain uncertainties for ADFs along an interface between a fuel and reflector region. To accommodate leakage effects in a reflector region, a 1D approximation is usually made in order to obtain the homogeneous interface flux required to calculate the ADF. Within this 1D framework an adjoint-based method is proposed that is capable of efficiently calculating ADF uncertainties. In the proposed method the sandwich rule is utilized to relate the covariance of the input parameters of 1D diffusion theory in the reflector region to the covariance of the interface ADFs. The input parameters covariance matrix can be readily obtained using sampling-based codes such as XSUSA or adjoint-based codes such as TSUNAMI. The sensitivity matrix is constructed using a fixed-source adjoint approach for inputs characterizing the reflector region. An analytic approach is then used to determine the sensitivity of the ADFs to fuel parameters using the neutron balance equation. A stochastic approach is used to validate the proposed adjoint-based method.

  13. Analysis of large reflector antennas using CSP fringe formulation and higher-order diffraction

    E-Print Network [OSTI]

    Nehorai, Arye

    Analysis of large reflector antennas using CSP fringe formulation and higher-order diffraction- tric conductor (PEC) objects when illuminated by a Complex Source Points (CSP) beam expansion (S of a CSP-expansion illumination. In this work we discuss an application of the CSP fringe formulation

  14. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of NIF: Advanced Radiographic Capability (ARC) Project: Created a Single-shot, Second Harmonic Generation Frequency Resolved Optical Gating (SHG FROG) system for damage testing...

  15. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Name: Image Analysis Classification algorithm to automatically classify NIF optics damage sites Project Description: Develop a classification system of potential damage...

  16. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque|SensitiveAprilPhotonStructure ofStructures of

  17. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque|SensitiveAprilPhotonStructure ofStructures ofCzapla Nick Czapla

  18. Student Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque|SensitiveAprilPhotonStructure ofStructures ofCzapla Nick

  19. Spotlights Archive

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 Special Report:405-01ToolsProgram,

  20. Photovoltaic generator with a spherical imaging lens for use with a paraboloidal solar reflector

    DOE Patents [OSTI]

    Angel, Roger P

    2013-01-08

    The invention is a generator for photovoltaic conversion of concentrated sunlight into electricity. A generator according to the invention incorporates a plurality of photovoltaic cells and is intended for operation near the focus of a large paraboloidal reflector pointed at the sun. Within the generator, the entering concentrated light is relayed by secondary optics to the cells arranged in a compact, concave array. The light is delivered to the cells at high concentration, consistent with high photovoltaic conversion efficiency and low cell cost per unit power output. Light enters the generator, preferably first through a sealing window, and passes through a field lens, preferably in the form of a full sphere or ball lens centered on the paraboloid focus. This lens forms a concentric, concave and wide-angle image of the primary reflector, where the intensity of the concentrated light is stabilized against changes in the position of concentrated light entering the generator. Receiving the stabilized light are flat photovoltaic cells made in different shapes and sizes and configured in a concave array corresponding to the concave image of a given primary reflector. Photovoltaic cells in a generator are also sized and interconnected so as to provide a single electrical output that remains high and stable, despite aberrations in the light delivered to the generator caused by, for example, mispointing or bending of the primary reflector. In some embodiments, the cells are set back from the image formed by the ball lens, and part of the light is reflected onto each cell small secondary reflectors in the form of mirrors set around its perimeter.

  1. Laser photochemical etching of molybdenum and tungsten thin films by surface halogenation

    SciTech Connect (OSTI)

    Rothschild, M.; Sedlacek, J.H.; Ehrlich, D.J.

    1986-12-01

    Laser direct-write etching of the refractory metals Mo and W was developed using reactions in chlorine and nitrogen trifluoride vapors. Rate and high spatial resolution are simultaneously optimized using a two-vapor halogenation/development sequence, based on surface modification. Local-area laser chlorination of the metal surface is used to predispose areas to subsequent bulk etching.

  2. An improved suppression method of the transverse-electromagnetic mode leakage with two reflectors in the triaxial klystron amplifier

    SciTech Connect (OSTI)

    Qi, Zumin; Zhang, Jun; Zhong, Huihuang; Zhang, Qiang; Zhu, Danni [College of Optoelectric Science and Engineering, National University of Defense Technology, Changsha, Hunan 410073 (China)

    2014-07-15

    Suppression of the transverse-electromagnetic (TEM) mode leakage is crucial in the design of a triaxial klystron amplifier with high gain, because a small microwave leakage from the buncher or the output cavity could overwhelm the input signal with low power. In this paper, a specially designed reflector is proposed to suppress the TEM mode leakage, whose axial electric field is approximately zero at the beam radial position. Theoretical analysis indicates that the reflector introduces little influence on the normal modulation of the beam while keeping a high reflection coefficient. By using two such reflectors with different eigen frequencies located in front of the buncher cavity and the output cavity, respectively, an improved triaxial klystron amplifier is presented. The simulation results show that the reflectors substantially decrease the TEM mode leakage power and achieve very good isolation among the cavities. The improved triaxial klystron amplifier can operate normally with 10's kW microwave injection without self-oscillations.

  3. Solar receiver heliostat reflector having a linear drive and position information system

    DOE Patents [OSTI]

    Horton, Richard H. (Schenectady, NY)

    1980-01-01

    A heliostat for a solar receiver system comprises an improved drive and control system for the heliostat reflector assembly. The heliostat reflector assembly is controllably driven in a predetermined way by a light-weight drive system so as to be angularly adjustable in both elevation and azimuth to track the sun and efficiently continuously reflect the sun's rays to a focal zone, i.e., heat receiver, which forms part of a solar energy utilization system, such as a solar energy fueled electrical power generation system. The improved drive system includes linear stepping motors which comprise low weight, low cost, electronic pulse driven components. One embodiment comprises linear stepping motors controlled by a programmed, electronic microprocessor. Another embodiment comprises a tape driven system controlled by a position control magnetic tape.

  4. Advanced ultraviolet-resistant silver mirrors for use in solar reflectors

    DOE Patents [OSTI]

    Jorgensen, Gary J. (Pine, CO); Gee, Randy (Arvada, CO)

    2009-11-03

    A silver mirror construction that maintains a high percentage of hemispherical reflectance throughout the UV and visible spectrum when used in solar reflectors, comprising:a) a pressure sensitive adhesive layer positioned beneath a silver overlay;b) a polymer film disposed on the silver overlay;c) an adhesive layer positioned on the polymer film; andd) a UV screening acrylic film disposed on the adhesive layer.

  5. Halogens in the coastal snow pack near Barrow, Alaska: Evidence for active bromine air-snow chemistry during springtime

    E-Print Network [OSTI]

    Domine, Florent

    . Frost flowers have been proposed as an important intermediate step in halogen activation [Rankin et al with organic compounds, such as aldehydes, leading to HBr and HCl. These acids are then scavenged by snow

  6. Multiple-shot laser damage thresholds of ultraviolet reflectors at 248 and 308 nanometers

    SciTech Connect (OSTI)

    Foltyn, S.R.; Newnam, B.E.

    1980-01-01

    Multiple-shot damage thresholds of dielectric reflectors have been measured at 248 and 308 nm. Standard irradiation conditions were a 10-ns pulsewidth, 0.6-mm spot diameter and 35-Hz pulse repetition frequency. The reflectors, from various sources, were composed of oxide and fluoride films. Although damage was generally initiated at visible film defects, there was no correlation between damage susceptibility and the appearance of these defects. At levels near threshold, damage was most often observed as an increase in white-light scatter of a site with no growth upon continued irradiation; at higher levels, the damage site grew with successive shots. Test sites were subjected to at least 10/sup 3/ shots and some sites received as many as 2.5 x 10/sup 4/ shots; however, with only one exception damage was found to occur within the first few shots or not at all. Reflectors at 248 nm typically had damage thresholds in the 1.0 to 1.8 J/cm/sup 2/ range with two samples exhibiting unexpectedly high thresholds of 2.8 and 3.0 J/cm/sup 2/. In some cases, a subthreshold pre-irradiation treatment resulted in a 20 to 25% enhancement in damage resistance.

  7. Design of Semiconductor-Based Back Reflectors for High Voc Monolithic Multijunction Solar Cells: Preprint

    SciTech Connect (OSTI)

    Garcia, I.; Geisz, J.; Steiner, M.; Olson, J.; Friedman, D.; Kurtz, S.

    2012-06-01

    State-of-the-art multijunction cell designs have the potential for significant improvement before going to higher number of junctions. For example, the Voc can be substantially increased if the photon recycling taking place in the junctions is enhanced. This has already been demonstrated (by Alta Devices) for a GaAs single-junction cell. For this, the loss of re-emitted photons by absorption in the underlying layers or substrate must be minimized. Selective back surface reflectors are needed for this purpose. In this work, different architectures of semiconductor distributed Bragg reflectors (DBR) are assessed as the appropriate choice for application in monolithic multijunction solar cells. Since the photon re-emission in the photon recycling process is spatially isotropic, the effect of the incident angle on the reflectance spectrum is of central importance. In addition, the DBR structure must be designed taking into account its integration into the monolithic multijunction solar cells, concerning series resistance, growth economics, and other issues. We analyze the tradeoffs in DBR design complexity with all these requirements to determine if such a reflector is suitable to improve multijunction solar cells.

  8. Multijunction GaInP/GaInAs/Ge solar cells with Bragg reflectors

    SciTech Connect (OSTI)

    Emelyanov, V. M. Kalyuzhniy, N. A.; Mintairov, S. A.; Shvarts, M. Z.; Lantratov, V. M.

    2010-12-15

    Effect of subcell parameters on the efficiency of GaInP/Ga(In)As/Ge tandem solar cells irradiated with 1-MeV electrons at fluences of up to 3 x 10{sup 15} cm{sup -2} has been theoretically studied. The optimal thicknesses of GaInP and GaInAs subcells, which provide the best photocurrent matching at various irradiation doses in solar cells with and without built-in Bragg reflectors, were determined. The dependences of the photoconverter efficiency on the fluence of 1-MeV electrons and on the time of residence in the geostationary orbit were calculated for structures optimized to the beginning and end of their service lives. It is shown that the optimization of the subcell heterostructures for a rated irradiation dose and the introduction of Bragg reflectors into the structure provide a 5% overall increase in efficiency for solar cells operating in the orbit compared with unoptimized cells having no Bragg reflector.

  9. Method of manufacturing large dish reflectors for a solar concentrator apparatus

    DOE Patents [OSTI]

    Angel, Roger P (Tucson, AZ); Olbert, Blain H (Tucson, AZ)

    2011-12-27

    A method of manufacturing monolithic glass reflectors for concentrating sunlight in a solar energy system is disclosed. The method of manufacturing allows large monolithic glass reflectors to be made from float glass in order to realize significant cost savings on the total system cost for a solar energy system. The method of manufacture includes steps of heating a sheet of float glass positioned over a concave mold until the sheet of glass sags and stretches to conform to the shape of the mold. The edges of the dish-shaped glass are rolled for structural stiffening around the periphery. The dish-shaped glass is then silvered to create a dish-shaped mirror that reflects solar radiation to a focus. The surface of the mold that contacts the float glass preferably has a grooved surface profile comprising a plurality of cusps and concave valleys. This grooved profile minimizes the contact area and marring of the specular glass surface, reduces parasitic heat transfer into the mold and increases mold lifetime. The disclosed method of manufacture is capable of high production rates sufficiently fast to accommodate the output of a conventional float glass production line so that monolithic glass reflectors can be produced as quickly as a float glass production can make sheets of float glass to be used in the process.

  10. Spectral irradiance model for tungsten halogen lamps in 340-850 nm wavelength range

    SciTech Connect (OSTI)

    Ojanen, Maija; Kaerhae, Petri; Ikonen, Erkki

    2010-02-10

    We have developed a physical model for the spectral irradiance of 1 kW tungsten halogen incandescent lamps for the wavelength range 340-850 nm. The model consists of the Planck's radiation law, published values for the emissivity of tungsten, and a residual spectral correction function taking into account unknown factors of the lamp. The correction function was determined by measuring the spectra of a 1000 W, quartz-halogen, tungsten coiled filament (FEL) lamp at different temperatures. The new model was tested with lamps of types FEL and 1000 W, 120 V quartz halogen (DXW). Comparisons with measurements of two national standards laboratories indicate that the model can account for the spectral irradiance values of lamps with an agreement better than 1% throughout the spectral region studied. We further demonstrate that the spectral irradiance of a lamp can be predicted with an expanded uncertainty of 2.6% if the color temperature and illuminance values for the lamp are known with expanded uncertainties of 20 K and 2%, respectively. In addition, it is suggested that the spectral irradiance may be derived from resistance measurements of the filament with lamp on and off.

  11. 3/30/10 10:43 AMElectrospinning self-healing polymer coating systems Page 1 of 2http://www.nanowerk.com/spotlight/spotid=15547.php

    E-Print Network [OSTI]

    Braun, Paul

    machining to 3D nanotechnology fabrication Posted: Mar 26th, 2010 Nanoscale investigation advances://www.nanowerk.com/spotlight/spotid=15547.php Article Tools Printer-friendly E-mail this article Daily News Email Digest Subscribe into medical and industrial applications Posted: Mar 17th, 2010 Future bio-nanotechnology will use computer

  12. Lamp system with conditioned water coolant and diffuse reflector of polytetrafluorethylene(PTFE)

    DOE Patents [OSTI]

    Zapata, Luis E. (Livermore, CA); Hackel, Lloyd (Livermore, CA)

    1999-01-01

    A lamp system with a very soft high-intensity output is provided over a large area by water cooling a long-arc lamp inside a diffuse reflector of polytetrafluorethylene (PTFE) and titanium dioxide (TiO.sub.2) white pigment. The water is kept clean and pure by a one micron particulate filter and an activated charcoal/ultraviolet irradiation system that circulates and de-ionizes and biologically sterilizes the coolant water at all times, even when the long-arc lamp is off.

  13. Damage thresholds of thin film materials and high reflectors at 248 nm

    SciTech Connect (OSTI)

    Rainer, F.; Lowdermilk, W.H.; Milam, D.; Carniglia, C.K.; Hart, T.T.; Lichtenstein, T.L.

    1982-01-01

    Twenty-ns, 248-nm KrF laser pulses were used to measure laser damage thresholds for halfwave-thick layers of 15 oxide and fluoride coating materials, and for high reflectance coatings made with 13 combinations of these materials. The damage thresholds of the reflectors and single-layer films were compared to measurements of several properties of the halfwave-thick films to determine whether measurements of these properties of single-layer films to determine whether measurements of these properties of single-layer films were useful for identifying materials for fabrication of damage resistant coatings.

  14. Process for removing halogenated aliphatic and aromatic compounds from petroleum products. [Polychlorinated biphenyls; methylene chloride; perchloroethylene; trichlorofluoroethane; trichloroethylene; chlorobenzene

    DOE Patents [OSTI]

    Googin, J.M.; Napier, J.M.; Travaglini, M.A.

    1982-03-31

    A process for removing halogenated aliphatic and aromatic compounds, e.g., polychlorinated biphenyls, from petroleum products by solvent extraction. The halogenated aliphatic and aromatic compounds are extracted from a petroleum product into a polar solvent by contracting the petroleum product with the polar solvent. The polar solvent is characterized by a high solubility for the extracted halogenated aliphatic and aromatic compounds, a low solubility for the petroleum product and considerable solvent power for polyhydroxy compound. The preferred polar solvent is dimethylformamide. A miscible polyhydroxy compound, such as, water, is added to the polar extraction solvent to increase the polarity of the polar extraction solvent. The halogenated aliphatic and aromatic compounds are extracted from the highly-polarized mixture of polyhydroxy compound and polar extraction solvent into a low polar or nonpolar solvent by contacting the polyhydroxy compound-polar solvent mixture with the low polar or nonpolar solvent. The halogenated aliphatic and aromatic compounds in the low polar or nonpolar solvent by physical means, e.g., vacuum evaporation. The polar and nonpolar solvents are recovered for recycling. The process can easily be designed for continuous operation. Advantages of the process include that the polar solvent and a major portion of the nonpolar solvent can be recycled, the petroleum products are reclaimable and the cost for disposing of waste containing polychlorinated biphenyls is significantly reduced. 2 tables.

  15. See-through amorphous silicon solar cells with selectively transparent and conducting photonic crystal back reflectors for building integrated photovoltaics

    SciTech Connect (OSTI)

    Yang, Yang; O’Brien, Paul G.; Materials Chemistry Research Group, Department of Chemistry, University of Toronto, 80 St. George Street, Toronto, Ontario M5S 3H6 ; Ozin, Geoffrey A. E-mail: kherani@ecf.utoronto.ca; Kherani, Nazir P. E-mail: kherani@ecf.utoronto.ca

    2013-11-25

    Thin semi-transparent hydrogenated amorphous silicon (a-Si:H) solar cells with selectively transparent and conducting photonic crystal (STCPC) back-reflectors are demonstrated. Short circuit current density of a 135?nm thick a-Si:H cell with a given STCPC back-reflector is enhanced by as much as 23% in comparison to a reference cell with an ITO film functioning as its rear contact. Concurrently, solar irradiance of 295?W/m{sup 2} and illuminance of 3480 lux are transmitted through the cell with a given STCPC back reflector under AM1.5 Global tilt illumination, indicating its utility as a source of space heating and lighting, respectively, in building integrated photovoltaic applications.

  16. Application of ITO/Al reflectors for increasing the efficiency of single-crystal silicon solar cells

    SciTech Connect (OSTI)

    Kopach, V. R.; Kirichenko, M. V. Khrypunov, G. S.; Zaitsev, R. V.

    2010-06-15

    It is shown that an increase in the efficiency and manufacturability of single-junction single-crystal silicon photoelectric converters of solar energy requires the use of a back-surface reflector based on conductive transparent indium-tin oxide (ITO) 0.25-2 {mu}m thick. To increase the efficiency and reduce the sensitivity to the angle of light incidence on the photoreceiving surface of multijunction photoelectric converters with vertical diode cells based on single-crystal silicon, ITO/Al reflectors with an ITO layer >1 {mu}m thick along vertical boundaries of diode cells should be fabricated. The experimental study of multijunction photoelectric converters with ITO/Al reflectors at diode cell boundaries shows the necessity of modernizing the used technology of ITO layers to achieve their theoretically calculated thickness.

  17. Sensitivity of Tropospheric Chemical Composition to Halogen-Radical Chemistry Using a Fully Coupled Size-Resolved Multiphase Chemistry-Global Climate System: Halogen Distributions, Aerosol Composition, and Sensitivity of Climate-Relevant Gases

    SciTech Connect (OSTI)

    Long, M.; Keene, W. C.; Easter, Richard C.; Sander, Rolf; Liu, Xiaohong; Kerkweg, A.; Erickson, D.

    2014-04-07

    Observations and model studies suggest a significant but highly non-linear role for halogens, primarily Cl and Br, in multiphase atmospheric processes relevant to tropospheric chemistry and composition, aerosol evolution, radiative transfer, weather, and climate. The sensitivity of global atmospheric chemistry to the production of marine aerosol and the associated activation and cycling of inorganic Cl and Br was tested using a size-resolved multiphase coupled chemistry/global climate model (National Center for Atmospheric Research’s Community Atmosphere Model (CAM); v3.6.33). Simulation results showed strong meridional and vertical gradients in Cl and Br species. The simulation reproduced most available observations with reasonable confidence permitting the formulation of potential mechanisms for several previously unexplained halogen phenomena including the enrichment of Br- in submicron aerosol, and the presence of a BrO maximum in the polar free troposphere. However, simulated total volatile Br mixing ratios were generally high in the troposphere. Br in the stratosphere was lower than observed due to the lack of long-lived organobromine species in the simulation. Comparing simulations using chemical mechanisms with and without reactive Cl and Br species demonstrated a significant temporal and spatial sensitivity of primary atmospheric oxidants (O3, HOx, NOx), CH4, and non-methane hydrocarbons (NMHC’s) to halogen cycling. Simulated O3 and NOx were globally lower (65% and 35%, respectively, less in the planetary boundary layer based on median values) in simulations that included halogens. Globally, little impact was seen in SO2 and non-sea-salt SO42- processing due to halogens. Significant regional differences were evident: The lifetime of nss-SO42- was extended downwind of large sources of SO2. The burden and lifetime of DMS (and its oxidation products) were lower by a factor of 5 in simulations that included halogens, versus those without, leading to a 20% reduction in nss-SO42- in the southern hemisphere planetary boundary layer based on median values.

  18. MHD compressor---expander conversion system integrated with GCR inside a deployable reflector

    SciTech Connect (OSTI)

    Tuninetti, G. . Research Div.); Botta, E.; Criscuolo, C.; Riscossa, P. . Nuclear Div.); Giammanco, F. . Dipt. di Fisica); Rosa-Clot, M. . Dipt. di Fisica)

    1989-04-20

    This work originates from the proposal MHD Compressor-Expander Conversion System Integrated with a GCR Inside a Deployable Reflector''. The proposal concerned an innovative concept of nuclear, closed-cycle MHD converter for power generation on space-based systems in the multi-megawatt range. The basic element of this converter is the Power Conversion Unit (PCU) consisting of a gas core reactor directly coupled to an MHD expansion channel. Integrated with the PCU, a deployable reflector provides reactivity control. The working fluid could be either uranium hexafluoride or a mixture of uranium hexafluoride and helium, added to enhance the heat transfer properties. The original Statement of Work, which concerned the whole conversion system, was subsequently redirected and focused on the basic mechanisms of neutronics, reactivity control, ionization and electrical conductivity in the PCU. Furthermore, the study was required to be inherently generic such that the study was required to be inherently generic such that the analysis an results can be applied to various nuclear reactor and/or MHD channel designs''.

  19. Quantum spin coherence in halogen-modified Cr$_7$Ni molecular nanomagnets

    E-Print Network [OSTI]

    Danielle Kaminski; Amy L. Webber; Christopher J. Wedge; Junjie Liu; Grigore A. Timco; Inigo J. Vitorica-Yrezabal; Eric J. L. McInnes; Richard E. P. Winpenny; Arzhang Ardavan

    2014-10-30

    Among the factors determining the quantum coherence of the spin in molecular magnets is the presence and the nature of nuclear spins in the molecule. We have explored modifying the nuclear spin environment in Cr$_7$Ni-based molecular nanomagnets by replacing hydrogen atoms with deuterium or the halogen atoms, fluorine or chlorine. We find that the spin coherence, studied at low temperatures by pulsed electron spin resonance, is modified by a range of factors, including nuclear spin and magnetic moment, changes in dynamics owing to nuclear mass, and molecular morphology changes.

  20. Roles of Oxygen and Water Vapor in the Oxidation of Halogen Terminated Ge(111) Surfaces

    SciTech Connect (OSTI)

    Sun, Shiyu; /Stanford U., Phys. Dept.; Sun, Yun; Liu, Zhi; Lee, Dong-Ick; Pianette, Piero; /SLAC, SSRL

    2006-12-18

    The initial stage of the oxidation of Cl and Br terminated Ge(111) surfaces is studied using photoelectron spectroscopy. The authors perform controlled experiments to differentiate the effects of different factors in oxidation, and find that water vapor and oxygen play different roles. Water vapor effectively replaces the halogen termination layers with the hydroxyl group, but does not oxidize the surfaces further. In contrast, little oxidation is observed for Cl and Br terminated surfaces with dry oxygen alone. However, with the help of water vapor, oxygen oxidizes the surface by breaking the Ge-Ge back bonds instead of changing the termination layer.

  1. TRANSMISSION ELECTRON MICROSCOPY OF THE TEXTURED SILVER BACK REFLECTOR OF A THIN FILM SILICON SOLAR CELL: FROM CRYSTALLOGRAPHY TO OPTICAL ABSORPTION

    E-Print Network [OSTI]

    Dunin-Borkowski, Rafal E.

    in amorphous, microcrystalline and micromorph thin-film Si solar cells is an important and active field-reflector of thin-film Si solar cells. 1 INTRODUCTION The study of light trapping in thin-film Si solar cells for an optimized back reflector structure in a microcrystalline thin film Si solar cell, when compared with the use

  2. Process for the solvent extraction for the radiolysis and dehalogenation of halogenated organic compounds in soils, sludges, sediments and slurries

    DOE Patents [OSTI]

    Golden, Jeffry

    2007-02-13

    A process of extracting halogenated organic compounds, and particularly PCBs, from soil, sediment, slurry, sludge and dehalogenating the compounds contacts a contaminated soil sample with an extraction medium of a mixture of an alkane and a water miscible alcohol. The organic compounds dissolve in the extraction medium which is separated from the soil by passing water upwardly through the soil. The extraction medium floats to the surface of the water and is separated. Thereafter, the extraction medium containing the halogenated organic contaminants is subjected to ionizing radiation to radiolytically dehalogenate the compounds.

  3. Process for the solvent extraction for the radiolysis and dehalogenation of halogenated organic compounds in soils, sludges, sediments and slurries

    DOE Patents [OSTI]

    Mincher, Bruce J. (3705 Creekside Dr., Idaho Falls, ID 83404); Curry, Randy Dale (1104 Merrill Ct., Columbia, MO 65203); Clevenger, Thomas E. (2512 Bluff Blvd., Columbia, MO 65201); Golden, Jeffry (12612 Cedarbrook La., Laurel, MD 20708)

    2000-01-01

    A process of extracting halogenated organic compounds, and particularly PCBs, from soil, sediment, slurry, sludge and dehalogenating the compounds contacting a contaminated soil sample with an extraction medium of a mixture of an alkane and a water miscible alcohol. The organic compounds dissolve in the extraction medium which is separated from the soil by passing water upwardly through the soil. The extraction medium floats to the surface of the water and is separated. Thereafter, the extraction medium containing the halogenated organic contaminants is subjected to ionizing radiation to radiolytically dehalogenate the compounds.

  4. Process for the solvent extraction for the radiolysis and dehalogenation of halogenated organic compounds in soils, sludges, sediments and slurries

    DOE Patents [OSTI]

    Mincher, Bruce J.; Curry, Randy Dale; Clevenger, Thomas E.; Golden, Jeffry

    2003-05-27

    A process of extracting halogenated organic compounds, and particularly PCBs, from soil, sediment, slurry, sludge and dehalogenating the compounds contacts a contaminated soil sample with an extraction medium of a mixture of an alkane and a water miscible alcohol. The organic compounds dissolve in the extraction medium which is separated from the soil by passing water upwardly through the soil. The extraction medium floats to the surface of the water and is separated. Thereafter, the extraction medium containing the halogenated organic contaminants is subjected to ionizing radiation to radiolytically dehalogenate the compounds.

  5. Optical and Durability Evaluation for Silvered Polymeric Mirrors and Reflectors: Cooperative Research and Development Final Report, CRADA Number, CRD-08-316

    SciTech Connect (OSTI)

    Gray, M.

    2014-08-01

    3M is currently developing silvered polymeric mirror reflectors as low-cost replacements for glass mirrors in concentrating solar power (CSP) systems. This effort is focused on development of reflectors comprising both metallized polymeric mirror films based on improved versions of ECP-305+ or other durable mirror film concepts and appropriate mechanically robust substrates. The objectives for this project are to reduce the system capital and operating costs and to lower the levelized cost of energy for CSP installations. The development of mirror reflectors involves work on both full reflectors and mirror films with and without coatings. Mirror reflectors must meet rigid optical specifications in terms of radius of curvature, slope errors and specularity. Mirror films must demonstrate long-term durability and maintain high reflectivity. 3M would like to augment internal capabilities to validate product performance with methods and tools developed at NREL to address these areas.

  6. A Review of the Reflector Compact Fluorescent Lights Technology Procurement Program: Conclusions and Results

    SciTech Connect (OSTI)

    Sandahl, Linda J.; Gilbride, Theresa L.; Ledbetter, Marc R.; McCullough, Jeffrey J.

    2008-05-19

    This report describes a project sponsored by the U.S. Department of Energy (DOE) and implemented by the Pacific Northwest National Laboratory (PNNL), from 2000 to 2007 to improve the performance of reflector type (R-lamp) compact fluorescent lamps (CFLs) and increase their availability throughout the United States by means of a technology development and procurement strategy. In 2000, at the request of the U.S. Department of Energy’s Emerging Technologies Program and its predecessors, the Pacific Northwest National Laboratory undertook a technology procurement seeking R-CFLs that were specifically designed for use in ICAT recessed can fixtures and that met other minimum performance criteria including minimum light output and size restrictions (to ensure they fit in standard residential recessed cans). The technology procurement included two phases. In Phase I, requests for proposals (RFPs) were issued in October 2002 and five manufacturers responded with 12 lamp models. Eight of these models met the minimum requirements and passed the 6-hour short-term test in a simulated ICAT environment. These eight models were subjected to long-term tests of 6,000 or more hours in a simulated ICAT environment. Three of these models passed the short- and long-term tests and were promoted through the program website (www.pnl.gov/rlamps), press releases, and fliers. To increase the number of qualifying models, a second RFP was issued in June 2005. In April 2007, DOE announced that 16 reflector CFL (R-CFL) models by four manufacturers had met all the minimum requirements of Phase 2 of the R-CFL Technology Innovation Competition. PNNL developed both the criteria and the test apparatus design for Elevated Temperature Life Testing (ETLT), which has been included by DOE in its draft ENERGY STAR specifications for the reflector category of CFLs. PNNL promoted the winning lamps through a program website, press releases, and fliers as well as through program partners. PNNL also helped engage distributors including Costco, the Home Depot, Bonneville Power Administration, and utility organizations.

  7. Improved red-response in thin film a-Si:H solar cells with soft-imprinted plasmonic back reflectors

    E-Print Network [OSTI]

    Polman, Albert

    Improved red-response in thin film a-Si:H solar cells with soft-imprinted plasmonic back reflectors is a critical component of solar cell development. In typical thin film cells the thickness of the absorbing of photovoltaic power. Thin film Si solar cells using hydrogenated amorphous Si a-Si:H and nano- crystalline Si nc

  8. New Method to Characterize Degradation of First Surface Aluminum Reflectors: Preprint

    SciTech Connect (OSTI)

    Sutter, F.; Heller, P.; Meyen, S.; Pitz-Paal, R.; Kennedy, C.; Fernandez-Garcia, A.; Schmucker, M.

    2010-10-01

    This paper reports the development of a new optical instrument capable of characterizing the aging process of enhanced first surface aluminum reflectors for concentrating solar power (CSP) application. Samples were exposed outdoors at different sites and in accelerated exposure tests. All samples exposed outdoors showed localized corrosion spots. Degradation originated from points of damage in the protective coating, but propagated underneath the protective coating. The degraded samples were analyzed with a microscope and with a newly designed space-resolved specular reflectometer (SR)2 that is capable of optically detecting and characterizing the corrosion spots. The device measures the specular reflectance at three acceptance angles and the wavelengths with spatial resolution using a digital camera's CMOS sensor. It can be used to measure the corrosion growth rate during outdoor and accelerated exposure tests. These results will allow a correlation between the degraded mirror surface and its specular reflectance.

  9. Reactivity Accountability Attributed to Reflector Poisons in the High Flux Isotope Reactor

    SciTech Connect (OSTI)

    Chandler, David [ORNL; Maldonado, G Ivan [ORNL; Primm, Trent [ORNL

    2009-12-01

    The objective of this study is to develop a methodology to predict the reactivity impact as a function of outage time between cycles of 3He, 6Li, and other poisons in the High Flux Isotope Reactor s (HFIR) beryllium reflector. The reactivity worth at startup of the HFIR has been incorrectly predicted in the past after the reactor has been shut-down for long periods of time. The incorrect prediction was postulated to be due to the erroneous calculation of 3He buildup in the beryllium reflector. It is necessary to develop a better estimate of the start-of-cycle symmetric critical control element positions since if the estimated and actual symmetrical critical control element positions differ by more than $1.55 in reactivity (approximately one-half inch in control element startup position), HFIR is to be shutdown and a technical evaluation is performed to resolve the discrepancy prior to restart. 3He is generated and depleted during operation, but during an outage, the depletion of 3He ceases because it is a stable isotope. 3He is born from the radioactive decay of tritium, and thus the concentration of 3He increases during shutdown. SCALE, specifically the TRITON and CSAS5 control modules including the KENO V.A, COUPLE, and ORIGEN functional modules were utilized in this study. An equation relating the down time (td) to the change in symmetric control element position was generated and validated against measurements for approximately 40 HFIR operating cycles. The newly-derived correlation was shown to improve accuracy of predictions for long periods of down time.

  10. High energy halogen atom reactions activated by nuclear transformations. Progress report, February 15, 1980-February 14, 1981

    SciTech Connect (OSTI)

    Not Available

    1981-02-01

    The stereochemistry of high energy /sup 18/F, /sup 34m/Cl, and /sup 76/Br substitution reactions involving enantiomeric molecules in the gas and condensed phase is studied. The gas to condensed state transition in halogen high energy chemistry, involving chlorine, bromine, and iodine activated by the (n,..gamma..) and (I.T.) processes in halomethanes, saturated and unsaturated hydrocarbons is being investigated in more detail. Special attention is given to defining the nature of the enhancement yields in the condensed phase. High energy halogen reactions in liquid and frozen aqueous solutions of organic and biomolecular solutes are studied in an attempt to learn more about these reactions. The applications of high energy chemistry techniques and theory to neutron activation analysis of biological systems are being continued. Special attention is given to developing procedures for trace molecular determinations in biological systems. The applications of hot halogen atoms as indicators of solute-solute interactions in liquid and frozen aqueous solutions of halogenated bases and nucleosides are being developed. Experiments are designed to explain the mechanisms of the radioprotection offered biomolecular solutes trapped within the frozen ice lattice. Reactions of bromine and iodine activated by isomeric transition with halogenated biomolecular solutes in liquid and frozen aqueous solutions are studied. The high energy reactions of iodine with the isomers of pentene have been studied in low pressure gaseous systems employing additives and rare gas moderators and liquid systems. Reactivity of excited complex formation and structural effects of electrophilic iodine attack on the pi-bond systems are studied.

  11. In situ thermally enhanced biodegradation of petroleum fuel hydrocarbons and halogenated organic solvents

    DOE Patents [OSTI]

    Taylor, R.T.; Jackson, K.J.; Duba, A.G.; Chen, C.I.

    1998-05-19

    An in situ thermally enhanced microbial remediation strategy and a method for the biodegradation of toxic petroleum fuel hydrocarbon and halogenated organic solvent contaminants are described. The method utilizes nonpathogenic, thermophilic bacteria for the thermal biodegradation of toxic and carcinogenic contaminants, such as benzene, toluene, ethylbenzene and xylenes, from fuel leaks and the chlorinated ethenes, such as trichloroethylene, chlorinated ethanes, such as 1,1,1-trichloroethane, and chlorinated methanes, such as chloroform, from past solvent cleaning practices. The method relies on and takes advantage of the pre-existing heated conditions and the array of delivery/recovery wells that are created and in place following primary subsurface contaminant volatilization efforts via thermal approaches, such as dynamic underground steam-electrical heating. 21 figs.

  12. In situ thermally enhanced biodegradation of petroleum fuel hydrocarbons and halogenated organic solvents

    DOE Patents [OSTI]

    Taylor, Robert T. (Livermore, CA); Jackson, Kenneth J. (San Leandro, CA); Duba, Alfred G. (Livermore, CA); Chen, Ching-I (Danville, CA)

    1998-01-01

    An in situ thermally enhanced microbial remediation strategy and a method for the biodegradation of toxic petroleum fuel hydrocarbon and halogenated organic solvent contaminants. The method utilizes nonpathogenic, thermophilic bacteria for the thermal biodegradation of toxic and carcinogenic contaminants, such as benzene, toluene, ethylbenzene and xylenes, from fuel leaks and the chlorinated ethenes, such as trichloroethylene, chlorinated ethanes, such as 1,1,1-trichloroethane, and chlorinated methanes, such as chloroform, from past solvent cleaning practices. The method relies on and takes advantage of the pre-existing heated conditions and the array of delivery/recovery wells that are created and in place following primary subsurface contaminant volatilization efforts via thermal approaches, such as dynamic underground steam-electrical heating.

  13. Mechanism of the Initial Oxidation of Hydrogen andHalogen Terminated Ge(111) Surfaces in Air

    SciTech Connect (OSTI)

    Sun, Shiyu; /Stanford U., Phys. Dept.; Sun, Yun; Liu, Zhi; Lee, Dong-Ick; Pianetta, Piero; /SLAC, SSRL

    2006-08-23

    The initial stage of the oxidation of Ge(111) surfaces etched by HF, HCl and HBr solutions is systematically studied using synchrotron radiation photoelectron spectroscopy (SR-PES). We perform controlled experiments to differentiate the effects of different oxidation factors. SR-PES results show that both moisture and oxygen contribute to the oxidation of the surfaces; however, they play different roles in the oxidation process. Moisture effectively replaces the hydrogen and halogen termination layers with hydroxyl (OH), but hardly oxidizes the surfaces further. On the other hand, dry oxygen does not replace the termination layers, but breaks the Ge-Ge back bonds and oxidizes the substrates with the aid of moisture. In addition, room light enhances the oxidation rate significantly.

  14. Reflector Technology Development and System Design for Concentrating Solar Power Technologies

    SciTech Connect (OSTI)

    Adam Schaut Philip Smith

    2011-12-30

    Alcoa began this program in March of 2008 with the goal of developing and validating an advanced CSP trough design to lower the levelized cost of energy (LCOE) as compared to existing glass based, space-frame trough technology. In addition to showing a pathway to a significant LCOE reduction, Alcoa also desired to create US jobs to support the emerging CSP industry. Alcoa's objective during Phase I: Concept Feasibility was to provide the DOE with a design approach that demonstrates significant overall system cost savings without sacrificing performance. Phase I consisted of two major tasks; reflector surface development and system concept development. Two specific reflective surface technologies were investigated, silver metallized lamination, and thin film deposition both applied on an aluminum substrate. Alcoa prepared samples; performed test validation internally; and provided samples to the NREL for full-spectrum reflectivity measurements. The final objective was to report reflectivity at t = 0 and the latest durability results as of the completion of Phase 1. The target criteria for reflectance and durability were as follows: (1) initial (t = 0), hemispherical reflectance >93%, (2) initial spectral reflectance >90% for 25-mrad reading and >87% for 7-mrad reading, and (3) predicted 20 year durability of less than 5% optical performance drop. While the results of the reflective development activities were promising, Alcoa was unable to down-select on a reflective technology that met the target criteria. Given the progress and potential of both silver film and thin film technologies, Alcoa continued reflector surface development activities in Phase II. The Phase I concept development activities began with acquiring baseline CSP system information from both CSP Services and the DOE. This information was used as the basis to develop conceptual designs through ideation sessions. The concepts were evaluated based on estimated cost and high-level structural performance. The target criteria for the concept development was to achieve a solar field cost savings of 25%-50% thereby meeting or exceeding the DOE solar field cost savings target of $350/m2. After evaluating various structural design approaches, Alcoa down-selected to a monocoque, dubbed Wing Box, design that utilizes the reflective surface as a structural, load carrying member. The cost and performance potential of the Wing Box concept was developed via initial finite element analysis (FEA) and cost modeling. The structural members were sized through material utilization modeling when subjected to representative loading conditions including wind loading. Cost modeling was utilized to refine potential manufacturing techniques that could be employed to manufacture the structural members. Alcoa concluded that an aluminum intensive collector design can achieve significant cost savings without sacrificing performance. Based on the cost saving potential of this Concept Feasibility study, Alcoa recommended further validation of this CSP approach through the execution of Phase II: Design and Prototype Development. Alcoa Phase II objective was to provide the DOE with a validated CSP trough design that demonstrates significant overall system cost savings without sacrificing performance. Phase II consisted of three major tasks; Detail System Design, Prototype Build, and System Validation. Additionally, the reflector surface development that began in Phase I was continued in Phase II. After further development work, Alcoa was unable to develop a reflective technology that demonstrated significant performance or cost benefits compared to commercially available CSP reflective products. After considering other commercially available reflective surfaces, Alcoa selected Alano's MIRO-SUN product for use on the full scale prototype. Although MIRO-SUN has a lower specular reflectivity compared to other options, its durability in terms of handling, cleaning, and long-term reflectivity was deemed the most important attribute to successfully validate Alcoa's advanced trough archi

  15. Midtemperature solar systems test facility predictions for thermal performance based on test data. Polisolar Model POL solar collector with glass reflector surface

    SciTech Connect (OSTI)

    Harrison, T.D.

    1981-05-01

    Thermal performance predictions based on test data are presented for the Polisolar Model POL solar collector, with glass reflector surfaces, for three output temperatures at five cities in the United States.

  16. Transmission comb of a distributed Bragg reflector induced by two surface dielectric gratings

    E-Print Network [OSTI]

    Zhao, Xiaobo; Zhang, Yongyou

    2015-01-01

    With transfer matrix theory, we study the transmission of a distributed Bragg reflector (DBR) with two dielectric gratings on top and on the bottom. Owing to the diffraction of the two gratings, the transmission shows a comb-like spectrum which red shifts with increasing the grating period during the forbidden band of the DBR. The number density of the comb peaks increases with increasing the number of the DBR cells, while the ratio of the average full width at half maximum (FWHM) of the transmission peaks in the transmission comb to the corresponding average free spectral range, being about 0.04 and 0.02 for the TE and TM incident waves, is almost invariant. The average FWHM of the TM waves is about half of the TE waves, and both they could be narrower than 0.1 nm. In addition, the transmission comb peaks of the TE and TM waves can be fully separated during certain waveband. We further prove that the transmission comb is robust against the randomness of the heights of the DBR layers, even when a 15\\% randomn...

  17. Correlated-intensity velocimeter for arbitrary reflector for laser-produced plasma experiments

    SciTech Connect (OSTI)

    Wang Zhehui; Luo Shengnian; Barnes, Cris W.; Briggs, Matthew E.; Paisley, Dennis L.; Paul, Stephen F.

    2006-10-15

    A laser-based technique, called correlated-intensity velocimeter for arbitrary reflector (CIVAR), is described for velocity measurement of reflecting surfaces in real time. Velocity versus time is an important measurement in laser-produced high-energy density plasma experiments because the motion of the surface depends on both the equation of the state of the surface material and laser-produced plasma. The physics and working principle of CIVAR are the same as those of a previous concept that resolves Doppler shift of plasma light emission using a pair of narrow passband interference filters. One unique feature of CIVAR is that a reflected laser beam is used instead of plasma emission. Therefore, CIVAR is applicable to both emitting and nonemitting reflecting surfaces. Other advantages of CIVAR include its simplicity, lower cost, and unambiguous data analysis that can be fully automated. The design of a single-point CIVAR is described in detail with emphasis on laser wavelength selection and signal-to-noise ratio. The single-point CIVAR system can be expanded into a multiple-point system straightforwardly. It is possible to use CIVAR concept to construct a two-dimensional imaging system for a nonuniform velocity field of a large reflecting surface; such a velocity imaging system may have applications beyond laser-produced plasma experiments, for example, in shock compression of condensed matter.

  18. Graphite and Beryllium Reflector Critical Assemblies of UO2 (Benchmark Experiments 2 and 3)

    SciTech Connect (OSTI)

    Margaret A. Marshall; John D. Bess

    2012-11-01

    INTRODUCTION A series of experiments was carried out in 1962-65 at the Oak Ridge National Laboratory Critical Experiments Facility (ORCEF) for use in space reactor research programs. A core containing 93.2 wt% enriched UO2 fuel rods was used in these experiments. The first part of the experimental series consisted of 252 tightly-packed fuel rods (1.27-cm triangular pitch) with graphite reflectors [1], the second part used 252 graphite-reflected fuel rods organized in a 1.506-cm triangular-pitch array [2], and the final part of the experimental series consisted of 253 beryllium-reflected fuel rods in a 1.506-cm-triangular-pitch configuration and in a 7-tube-cluster configuration [3]. Fission rate distribution and cadmium ratio measurements were taken for all three parts of the experimental series. Reactivity coefficient measurements were taken for various materials placed in the beryllium reflected core. All three experiments in the series have been evaluated for inclusion in the International Reactor Physics Experiment Evaluation Project (IRPhEP) [4] and the International Criticality Safety Benchmark Evaluation Project (ICSBEP) Handbooks, [5]. The evaluation of the first experiment in the series was discussed at the 2011 ANS Winter meeting [6]. The evaluations of the second and third experiments are discussed below. These experiments are of interest as benchmarks because they support the validation of compact reactor designs with similar characteristics to the design parameters for a space nuclear fission surface power systems [7].

  19. Separation of toxic metal ions, hydrophilic hydrocarbons, hydrophobic fuel and halogenated hydrocarbons and recovery of ethanol from a process stream

    DOE Patents [OSTI]

    Kansa, E.J.; Anderson, B.L.; Wijesinghe, A.M.; Viani, B.E.

    1999-05-25

    This invention provides a process to tremendously reduce the bulk volume of contaminants obtained from an effluent stream produced subsurface remediation. The chemicals used for the subsurface remediation are reclaimed for recycling to the remediation process. Additional reductions in contaminant bulk volume are achieved by the ultra-violet light destruction of halogenated hydrocarbons, and the complete oxidation of hydrophobic fuel hydrocarbons and hydrophilic hydrocarbons. The contaminated bulk volume will arise primarily from the disposal of the toxic metal ions. The entire process is modular, so if there are any technological breakthroughs in one or more of the component process modules, such modules can be readily replaced. 3 figs.

  20. Separation of toxic metal ions, hydrophilic hydrocarbons, hydrophobic fuel and halogenated hydrocarbons and recovery of ethanol from a process stream

    DOE Patents [OSTI]

    Kansa, Edward J. (Livermore, CA); Anderson, Brian L. (Lodi, CA); Wijesinghe, Ananda M. (Tracy, CA); Viani, Brian E. (Oakland, CA)

    1999-01-01

    This invention provides a process to tremendously reduce the bulk volume of contaminants obtained from an effluent stream produced subsurface remediation. The chemicals used for the subsurface remediation are reclaimed for recycling to the remediation process. Additional reductions in contaminant bulk volume are achieved by the ultra-violet light destruction of halogenated hydrocarbons, and the complete oxidation of hydrophobic fuel hydrocarbons and hydrophilic hydrocarbons. The contaminated bulk volume will arise primarily from the disposal of the toxic metal ions. The entire process is modular, so if there are any technological breakthroughs in one or more of the component process modules, such modules can be readily replaced.

  1. Effect of non-uniform slow wave structure in a relativistic backward wave oscillator with a resonant reflector

    SciTech Connect (OSTI)

    Chen, Changhua; Xiao, Renzhen; Sun, Jun; Song, Zhimin; Huo, Shaofei; Bai, Xianchen; Shi, Yanchao; Liu, Guozhi

    2013-11-15

    This paper provides a fresh insight into the effect of non-uniform slow wave structure (SWS) used in a relativistic backward wave oscillator (RBWO) with a resonant reflector. Compared with the uniform SWS, the reflection coefficient of the non-uniform SWS is higher, leading to a lower modulating electric field in the resonant reflector and a larger distance to maximize the modulation current. Moreover, for both types of RBWOs, stronger standing-wave field takes place at the rear part of the SWS. In addition, besides Cerenkov effects, the energy conversion process in the RBWO strongly depends on transit time effects. Thus, the matching condition between the distributions of harmonic current and standing wave field provides a profound influence on the beam-wave interaction. In the non-uniform RBWO, the region with a stronger standing wave field corresponds to a higher fundamental harmonic current distribution. Particle-in-cell simulations show that with a diode voltage of 1.02 MV and beam current of 13.2 kA, a microwave power of 4 GW has been obtained, compared to that of 3 GW in the uniform RBWO.

  2. ZnO/a-Si Distributed Bragg Reflectors for Light Trapping in Thin Film Solar Cells from Visible to Infrared Range

    E-Print Network [OSTI]

    Chen, Aqing; Zhu, Kaigui

    2015-01-01

    Distributed bragg reflectors (DBRs) consisting of ZnO and amorphous silicon (a-Si) were prepared by magnetron sputtering method for selective light trapping. The quarter-wavelength ZnO/a-Si DBRs with only 6 periods exhibit a peak reflectance of above 99% and have a full width at half maximum that is greater than 347 nm in the range of visible to infrared. The 6-pair reversed quarter-wavelength ZnO/a-Si DBRs also have a peak reflectance of 98%. Combination of the two ZnO/a-Si DBRs leads to a broader stopband from 686 nm to 1354 nm. Using the ZnO/a-Si DBRs as the rear reflector of a-Si thin film solar cells significantly increases the photocurrent in the spectrum range of 400 nm to 1000 nm, in comparison with that of the cells with Al reflector. The obtained results suggest that ZnO/a-Si DBRs are promising reflectors of a-Si thin-film solar cells for light trapping.

  3. 2014-04-11 Issuance: Energy Conservation Standards for General Service Fluorescent Lamps and Incandescent Reflector Lamps; Notice of Proposed Rulemaking

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of proposed rulemaking regarding energy conservation standards for general service fluorescent lamps and incandescent reflectors lamps, as issued by the Assistant Secretary for Energy Efficiency and Renewable Energy on April 11, 2014.

  4. Electromagnetic modeling of the energy distribution of a metallic cylindrical parabolic reflector covered with a magnetized plasma layer

    SciTech Connect (OSTI)

    Niknam, A. R. Khajehmirzaei, M. R.; Davoudi-Rahaghi, B.; Rahmani, Z.; Jazi, B.; Abdoli-Arani, A.

    2014-07-15

    The energy distribution along the focal axis of a long metallic cylindrical parabolic reflector with a plasma layer on its surface in the presence of an external magnetic field is investigated. The effects of some physical parameters, such as the plasma frequency, the wave frequency and the thickness of plasma layer on the energy distribution and the reflected and transmitted electromagnetic fields, are simulated. These investigations for both S- and P-polarizations have been done separately. It is found that the maximum value of the reflected intensity increases by increasing the incident wave frequency and by decreasing the plasma layer thickness and the plasma frequency for both polarizations. Furthermore, the results show that the increase of the magnetic field strength can cause an increase in the reflected intensity for S-polarization and a slight decrease for P-polarization.

  5. STARTUP REACTIVITY ACCOUNTABILITY ATTRIBUTED TO ISOTOPIC TRANSMUTATIONS IN THE IRRADIATED BERYLLIUM REFLECTOR OF THE HIGH FLUX ISTOTOPE REACTOR

    SciTech Connect (OSTI)

    Chandler, David [ORNL] [ORNL; Maldonado, G Ivan [ORNL] [ORNL; Primm, Trent [ORNL] [ORNL

    2010-01-01

    The objective of this study is to develop a methodology to predict the reactivity impact as a function of outage time between cycles of 3He, 6Li, and other poisons in the High Flux Isotope Reactor s (HFIR) beryllium reflector. The reactivity worth at startup of the HFIR has been incorrectly predicted in the past after the reactor has been shut-down for long periods of time. The incorrect prediction was postulated to be due to the erroneous calculation of 3He buildup in the beryllium reflector. It is necessary to develop a better estimate of the start-of-cycle symmetric critical control element positions since if the estimated and actual symmetrical critical control element positions differ by more than $1.55 in reactivity (approximately one-half inch in control element startup position), HFIR is to be shutdown and a technical evaluation is performed to resolve the discrepancy prior to restart. 3He is generated and depleted during operation, but during an outage, the depletion of 3He ceases because it is a stable isotope. 3He is born from the radioactive decay of tritium, and thus the concentration of 3He increases during shutdown. The computer program SCALE, specifically the TRITON and CSAS5 control modules including the KENO V.A, COUPLE, and ORIGEN functional modules were utilized in this study. An equation relating the down time (td) to the change in symmetric control element position was generated and validated against measurements for approximately 40 HFIR operating cycles. The newly-derived correlation was shown to improve accuracy of predictions for long periods of down time.

  6. Spotlight -Language and Literacy

    E-Print Network [OSTI]

    McQuade, D. Tyler

    To be recognized as a major national source of research and personnel development in early intervention/ education community, and 5. Develop and maintain model programs for research and and professional development. 2014 graduate program, these four scholars are participating in a specialized seminar on prevention

  7. Spotlight, October 2012

    E-Print Network [OSTI]

    2012-10-01

    . downtown, at the Arts Center, and in the Community Health Building. We’ve installed solar panels at the County Fairgrounds, and our retrofit of the Library’s heating and cooling system is using 21% less energy than before. Economic Development: A... economically efficient, is slow and susceptible to the addition of impurities from environmental exposure. For this project, it may be possible to use the environment effectively, including wind and solar sustainable energies, to accelerate drying...

  8. Spotlight, November 2012

    E-Print Network [OSTI]

    2012-11-01

    -free, sustainable, technologically advanced architecture, walkable communities, and landscapes incorporating nature. Domer explained how emphasis on the nuclear family in an age- segregated society disconnects the young and old and how a proposed...-free, sustainable, technologically advanced architecture, walkable communities, and landscapes incorporating nature. Domer explained how emphasis on the nuclear family in an age- segregated society disconnects the young and old and how a proposed...

  9. Spotlight, April 2013

    E-Print Network [OSTI]

    2013-04-01

    AUDITORIUM Sponsored by: KU Environs, KU Environmental Studies Program, KU Student Senate, KU School of Architecture and Urban Planning, KU Climate Change IGERT Program, & the KU Center for Sustainability KU & Lawre nce Earth Day 2013 ANNUAL SPEAKER DAVID... AUDITORIUM Sponsored by: KU Environs, KU Environmental Studies Program, KU Student Senate, KU School of Architecture and Urban Planning, KU Climate Change IGERT Program, & the KU Center for Sustainability KU & Lawre nce Earth Day 2013 ANNUAL SPEAKER DAVID...

  10. Employee Spotlight: Ann Schlenker

    ScienceCinema (OSTI)

    Ann Schlenker

    2013-06-10

    Ann Schlenker, Director for the Center for Transportation Research, discusses mentoring and working at Argonne.

  11. DOE Sustainability SPOtlight

    Broader source: Energy.gov [DOE]

    Newsletter highlights the recipients of the U.S. Department of Energy (DOE) Sustainability Performance Office (SPO) 2014 Sustainability Awards.

  12. Robot learning [TC Spotlight

    E-Print Network [OSTI]

    Tedrake, Russell Louis

    Creating autonomous robots that can learn to act in unpredictable environments has been a long-standing goal of robotics, artificial intelligence, and the cognitive sciences. In contrast, current commercially available ...

  13. Spotlight, March 2013

    E-Print Network [OSTI]

    2013-03-01

    -wide initiative.” 5 Page 5 KU Center for Sustainability 3/26 Empowering & Sustaining Malawi: Africa Windmill Project with John Drake, 7:30 PM Dole Institute of Politics 3/28 3rd Annual Spring Symposium on the Scholarship of Diversity, 8:30 AM to 1...-wide initiative.” 5 Page 5 KU Center for Sustainability 3/26 Empowering & Sustaining Malawi: Africa Windmill Project with John Drake, 7:30 PM Dole Institute of Politics 3/28 3rd Annual Spring Symposium on the Scholarship of Diversity, 8:30 AM to 1...

  14. Spotlight, May 2013

    E-Print Network [OSTI]

    2013-05-01

    emissions responsible for climate change. To gauge our food’s climate impact, we can ask questions like: How much energy and water were used to produce it? What was the scale of production? And, how low is it on the food chain? As long as the food... emissions responsible for climate change. To gauge our food’s climate impact, we can ask questions like: How much energy and water were used to produce it? What was the scale of production? And, how low is it on the food chain? As long as the food...

  15. Spotlight, June 2012

    E-Print Network [OSTI]

    2012-06-01

    hard fought weeks have yielded a winner in the Lights Out! energy conservation competition held at the University of Kansas. The faculty and staff in Bailey Hall nudged out the victory by just 1.6%, fending off Green and Summerfield Halls... their buildings and encouraged their fellow students, faculty, and staff to do their part. They helped create a great model we can use moving forward with energy conservation at KU.” Greening the Crimson and Blue Bailey Hall Wins Lights Out! Competition...

  16. Spotlight, August 2012

    E-Print Network [OSTI]

    2012-08-01

    on the road means lower CO2 emissions, and all the Hertz on Demand vehicles are EPA SmartWay certified, ensuring fewer air pollutants and greenhouse gases are emitted into the air. Using Hertz on Demand is also more energy efficient than owning a car..., or ride a bus to campus a new choice. KU Parking & Transit has partnered with Hertz on Demand to bring rental cars by the hour to the KU Lawrence Campus. After signing up for a free membership, you only pay for a car when and where you need it...

  17. Employee Spotlight: Alessandro Cattaneo

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee Headcount

  18. Employee Spotlight: Bryant Roybal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryant Roybal Bryant

  19. Employee Spotlight: Dave Keller

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryant RoybalDave

  20. Employee Spotlight: James Hunter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryant

  1. Employee Spotlight: Janice Lovato

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryantCareers, Jobs

  2. Employee Spotlight: Jason Halladay

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryantCareers,

  3. Employee Spotlight: Jeff Martin

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryantCareers,Jeff

  4. Employee Spotlight: Jonathan Engle

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon Engle Jonathan

  5. Employee Spotlight: Kristen Honig

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon Engle JonathanJosé

  6. Employee Spotlight: Michael Torrez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon Engle JonathanJoséMichael

  7. Employee Spotlight: Michelle Ferran

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon Engle

  8. Employee Spotlight: Monika Bittman

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonika Bittman Monika

  9. Employee Spotlight: Ron Barber

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonika

  10. Employee Spotlight: Sim Balkey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonikaCareer Jobs»

  11. Spotlight: Bryant Roybal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect Photovoltaics -7541C.3 SpecialSponsor Guidelines Candidates f or t

  12. Spotlight: Christopher Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect Photovoltaics -7541C.3 SpecialSponsor Guidelines Candidates f or tChristopher

  13. Spotlight: Claudia Mora

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect Photovoltaics -7541C.3 SpecialSponsor Guidelines Candidates f or

  14. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National Laboratory gain

  15. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National Laboratory gainScientists

  16. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National Laboratory

  17. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National LaboratoryScientists In

  18. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National LaboratoryScientists

  19. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust, High-ThroughputUpcomingmagnetoresistance | Argonne National

  20. Employee Spotlight: Alessandro Cattaneo

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.Emilio SegrèDepartment

  1. Employee Spotlight: Bryant Roybal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.Emilio

  2. Employee Spotlight: Dave Keller

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2, 2014 It's 2

  3. Employee Spotlight: Janice Lovato

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2, 2014 It's

  4. Employee Spotlight: Jonathan Engle

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2,Jonathan Engle

  5. Employee Spotlight: Kristen Honig

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June

  6. Employee Spotlight: Michael Torrez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller JuneMichael Torrez

  7. Employee Spotlight: Monika Bittman

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller JuneMichael

  8. Employee Spotlight: Ron Barber

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller JuneMichaelRon Barber

  9. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque| StanfordOffice ofTorus Experiment |Scientist inScientists

  10. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque| StanfordOffice ofTorus Experiment |Scientist

  11. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque| StanfordOffice ofTorus Experiment |ScientistScientists In the

  12. Scientists in the Spotlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservation ofAlbuquerque| StanfordOffice ofTorus Experiment |ScientistScientists In

  13. DC power supply for charging of a 12 KV 200 KJ energy storage capacitor battery of a 500 KA pulse system for the magnetic horn and reflectors of the CERN neutrino beam

    E-Print Network [OSTI]

    Langeseth, B

    1968-01-01

    DC power supply for charging of a 12 KV 200 KJ energy storage capacitor battery of a 500 KA pulse system for the magnetic horn and reflectors of the CERN neutrino beam

  14. Fiber optic sensor employing successively destroyed coupled points or reflectors for detecting shock wave speed and damage location

    DOE Patents [OSTI]

    Weiss, Jonathan D. (Albuquerque, NM)

    1995-01-01

    A shock velocity and damage location sensor providing a means of measuring shock speed and damage location. The sensor consists of a long series of time-of-arrival "points" constructed with fiber optics. The fiber optic sensor apparatus measures shock velocity as the fiber sensor is progressively crushed as a shock wave proceeds in a direction along the fiber. The light received by a receiving means changes as time-of-arrival points are destroyed as the sensor is disturbed by the shock. The sensor may comprise a transmitting fiber bent into a series of loops and fused to a receiving fiber at various places, time-of-arrival points, along the receiving fibers length. At the "points" of contact, where a portion of the light leaves the transmitting fiber and enters the receiving fiber, the loops would be required to allow the light to travel backwards through the receiving fiber toward a receiving means. The sensor may also comprise a single optical fiber wherein the time-of-arrival points are comprised of reflection planes distributed along the fibers length. In this configuration, as the shock front proceeds along the fiber it destroys one reflector after another. The output received by a receiving means from this sensor may be a series of downward steps produced as the shock wave destroys one time-of-arrival point after another, or a nonsequential pattern of steps in the event time-of-arrival points are destroyed at any point along the sensor.

  15. Fiber optic sensor employing successively destroyed coupled points or reflectors for detecting shock wave speed and damage location

    DOE Patents [OSTI]

    Weiss, J.D.

    1995-08-29

    A shock velocity and damage location sensor providing a means of measuring shock speed and damage location is disclosed. The sensor consists of a long series of time-of-arrival ``points`` constructed with fiber optics. The fiber optic sensor apparatus measures shock velocity as the fiber sensor is progressively crushed as a shock wave proceeds in a direction along the fiber. The light received by a receiving means changes as time-of-arrival points are destroyed as the sensor is disturbed by the shock. The sensor may comprise a transmitting fiber bent into a series of loops and fused to a receiving fiber at various places, time-of-arrival points, along the receiving fibers length. At the ``points`` of contact, where a portion of the light leaves the transmitting fiber and enters the receiving fiber, the loops would be required to allow the light to travel backwards through the receiving fiber toward a receiving means. The sensor may also comprise a single optical fiber wherein the time-of-arrival points are comprised of reflection planes distributed along the fibers length. In this configuration, as the shock front proceeds along the fiber it destroys one reflector after another. The output received by a receiving means from this sensor may be a series of downward steps produced as the shock wave destroys one time-of-arrival point after another, or a nonsequential pattern of steps in the event time-of-arrival points are destroyed at any point along the sensor. 6 figs.

  16. Extreme ultraviolet reflector

    DOE Patents [OSTI]

    Newnam, Brian E. (Los Alamos, NM)

    1990-01-01

    A multi-faceted mirror forms a retroreflector for a resonator loop in a free electron laser (FEL) operating in the XUV (.lambda.=10-100 nm). The number of facets is determined by the angle-of-incidence needed to obtain total external reflectance (TER) from the facet surface and the angle through which the FEL beam is to be turned. Angles-of-incidence greater than the angle for TER may be used to increase the area of the beam incident on the surface and reduce energy absorption density. Suitable surface films having TER in the 10-100 nm range may be formed from a variety of materials, including Al, single-crystal Si, Ag, and Rh. One of the facets is formed as an off-axis conic section to collimate the output beam with minimum astigmatism.

  17. Metal halogen electrochemical cell

    SciTech Connect (OSTI)

    Walsh, F.M.

    1986-06-03

    An electrochemical cell is described having a metal anode selected from the group consisting of zinc and cadmium; a bromine cathode; and, an aqueous electrolyte containing a metal bromide, the metal having the same metal as the metal of the anode, the improvement comprising: a bromine complexing agent in the aqueous metal bromide electrolyte consisting solely of a tetraorgano substituted ammonium salt, which salt is soluble of water and forms and substantially water immiscible liquid bromine complex at temperatures in the range of about 10/sup 0/C. to about 60/sup 0/C. and wherein the tetraorgano substituted ammonium salt is selected from asymmetric quaternary ammonium compounds.

  18. Manufacturing Spotlight: Boosting American Competitiveness

    Office of Energy Efficiency and Renewable Energy (EERE)

    Find out how the Energy Department is helping bring new clean energy technologies to the marketplace and make manufacturing processes more energy efficient.

  19. Employee Spotlight: Dances of India

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee HeadcountBryant Roybal

  20. Employee Spotlights | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonikaCareer Jobs»

  1. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 Special Report:405-01ToolsProgram,July

  2. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 Special

  3. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014

  4. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014April 9, 2014

  5. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014April 9,

  6. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014April 9,April 17,

  7. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014April 9,April

  8. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 SpecialOctober 14, 2014April 9,AprilJuly

  9. Spotlights Archive | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative FuelsofProgram: Report AppendicesAVideoSolarSpace-Based Solar Power1Agreements

  10. Applications of Cu{sub 2}O octahedral particles on ITO glass in photocatalytic degradation of dye pollutants under a halogen tungsten lamp

    SciTech Connect (OSTI)

    Zhai, Wei; Sun, Fengqiang; Chen, Wei; Zhang, Lihe; Min, Zhilin; Li, Weishan

    2013-11-15

    Graphical abstract: - Highlights: • Photocatalytic activity of Cu{sub 2}O octahedral microcrystals on ITO glass was studied. • They showed high abilities in degradation of methylene blue in the presence of H{sub 2}O{sub 2}. • H{sub 2}O{sub 2} amount could affect the degradation efficiency. • Such particles could be easily recycled and still kept high activity. • Many dye pollutants and their mixtures could be efficiently degraded. - Abstract: Cu{sub 2}O octahedral microcrystals were prepared on the ITO glass by galvanostatic electrodeposition in CuSO{sub 4} solution with poly(vinylpryrrolidone) as the surfactant. By controlling the electrodeposition time, the microcrystals could be randomly distributed on the ITO glass and separated from each other, resulting in as many as possible (1 1 1) crystalline planes were exposed. Such microcrystals immobilized on ITO glass were employed in photodegradation of dye pollutants in the presence of H{sub 2}O{sub 2} under a 150 W halogen tungsten lamp. The photodegradation of methylene blue was taken as an example to evaluate the photocatalytic activities of the octahedral Cu{sub 2}O microcrystals. Effects of electrodeposition time and H{sub 2}O{sub 2} amount on the degradation efficiency was discussed, giving the optimum conditions and the corresponding degradation mechanism. The catalyst showed high ability in degradation of methylene blue, methyl orange, rhodamine B, eosin B and their mixtures under identical conditions.

  11. Doe Sustainability SPOtlight - 2014 Sustainability Awards

    Office of Environmental Management (EM)

    The joint collaboration between LLNL's Weapons and Complex Integration's High Performance Computing data center and the laboratory's Operations & Business' enterprise data center...

  12. In this issue. . . Linguistics Alum Spotlight

    E-Print Network [OSTI]

    Capecchi, Mario R.

    their language. Funded by a Volkswagen Foundation Grant and an NSF Grant, Khvtisiashvili and her colleagues

  13. Healthcare Energy: Spotlight on Medical Equipment

    Broader source: Energy.gov [DOE]

    The Building Technologies Office conducted a healthcare energy end-use monitoring project for two sites. Read details about large medical imaging equipment energy results.

  14. Sambamurti Memorial Lecture: Spotlight on the Gluon

    ScienceCinema (OSTI)

    Michael Begelas

    2010-09-01

    Begel uses results from the Fermilab D0 and E706 experiments to explain how the production rate and energy spectrum of photons produced during proton collisions helped to clarify how the energy inside the proton is shared between quarks and gluons.

  15. Children's School January 2013 Undergraduate Spotlight

    E-Print Network [OSTI]

    York City, earned a Master of Arts in Early Childhood General Education and Early Childhood Special' perception and assessment of early childhood inclusive special education; early childhood learning at the Children's School for the rest of her undergraduate career and then continuing her education in psychology

  16. Employee Spotlight: Beth Drewniak | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contest --Science Careers in Search of Women -Site environmental protection --Site waste management -Site sustainability Operations -Business diversity -Technology transfer...

  17. High Performance Builder Spotlight: Green Coast Enterprises ...

    Energy Savers [EERE]

    - New Orleans, Louisiana Building America Whole-House Solutions for New Homes: Green Coast Enterprises, New Orleans, Louisiana Building America Best Practices Series...

  18. Healthcare Energy: Spotlight on Chiller Plants

    Broader source: Energy.gov [DOE]

    The Building Technologies Office conducted a healthcare energy end-use monitoring project for two sites. Read details about the chiller plant energy results.

  19. SPRING 2015 10 Spotlight on Dimitris Chorafas

    E-Print Network [OSTI]

    read about a major area of new emphasis, nuclear magnetic resonance research. This area is enabling of politics and leading to new achievements for the benefit of humankind--and, remarkably, so soon after World of the International Board Science Feature 40 Major league magnets: Nuclear magnetic resonance in the service

  20. griculture is in the spotlight as a

    E-Print Network [OSTI]

    Mukhtar, Saqib

    . These "crite- ria pollutants" are ozone (O3), carbon monoxide (CO), nitrogen dioxide (NO2), sulfur dioxide (SO2 to a particle of water. Equivalent spherical diameter (ESD) -- A term that categorizes the properties

  1. Shining a spotlight on intact proteins

    SciTech Connect (OSTI)

    Pasa-Tolic, Ljiljana; Masselon, Christophe

    2014-05-01

    Cells react to cues from their environment using various mechanisms that include changes in metabolites, gene expression, protein binding partners, protein localization, and protein posttranslational modifications (PTMs), all of which contribute to altered cellular signatures that enable appropriate cellular responses. Given the seemingly infinite number of mechanisms available to affect protein function and modulate biological processes, the question arises as to how cells manage to interpret protein readouts to accomplish the appropriate cell-type specific response to a particular stimulus.

  2. North Slope action holds West Coast spotlight

    SciTech Connect (OSTI)

    Wilson, H.M.

    1981-05-25

    The first oil from a North Slope reservoir outside Prudhoe Bay will begin flowing next year at rate of 80,000 bpd from Kuparuk field now under development by Atlantic Richfield Co. west of Prudhoe Bay. Just north of the Kuparuk development, Conoco Inc. has found a commercial reservoir in the Milne Point unit and will be drilling confirmation and delineation wells later this year and in 1982. Another area which very likely will be developed for production is located northeast of Prudhoe Bay, where Sohio Alaska Petroleum Co. has announced discoveries in 2 Sag Delta wells. In California's San Joaquin Valley, 3 Kern County fields - South Belridge, Elk Hills, and Lost Hills - are the sites of intensive drilling. Seven rigs are working in the Santa Barbara Channel, 3 of them developing known fields from permanent platforms.

  3. High Performance Builder Spotlight: Baldwin Homes Inc.

    SciTech Connect (OSTI)

    2011-01-01

    Baldwin Homes of Arnold, Maryland, built a HERS 55 Builders Challenge-certified house as an “Eco-Model” home to showcase 69 green and energy-efficient features.

  4. High Performance Builder Spotlight: Clifton View Homes

    SciTech Connect (OSTI)

    2011-01-01

    Clifton View Homes’s remodel of a 1962 rambler, on Whidbey Island in Washington State, cut energy costs by two-thirds.

  5. High Performance Builder Spotlight: Imagine Homes

    SciTech Connect (OSTI)

    2011-01-01

    Imagine Homes, working with the DOE's Building America research team member IBACOS, has developed a system that can be replicated by other contractors to build affordable, high-performance homes. Imagine Homes has used the system to produce more than 70 Builders Challenge-certified homes per year in San Antonio over the past five years.

  6. High Performance Builder Spotlight: Treasure Homes Inc.

    SciTech Connect (OSTI)

    2011-01-01

    Treasure Homes, Inc., achieved a HERS rating of 46 without PV on its prototype “Gem” home, located on the shores of Lake Michigan in northern Indiana, thanks in part to training received from a Building America partner, the National Association of Home Builders Research Center.

  7. spotlight1115 | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTechtail.Theory ofDidDevelopmentatabout Who Works for NIFYuccaPagesSRSCROto Perform

  8. Employee Spotlight: José Valdez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon Engle JonathanJosé Valdez

  9. Employee Spotlight: Muge Acik | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonika Bittman

  10. Employee Spotlight: Peter Friedman | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployeeJon EngleMonika Bittman(Click

  11. Spotlighting Howard University | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime |ofProgram Reach

  12. DOE Sustainability SPOtlight | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based| Department8, 2015 GATEWAY Takes onandField | DepartmentAirSavesofDOE

  13. Intern Spotlight: Elise Burton | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACT EVALUATION PLANIsProcess Relevant toIntergovernmentalAs(Click image to

  14. Intern Spotlight: Gabrielle Kane | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACT EVALUATION PLANIsProcess Relevant toIntergovernmentalAs(Click image

  15. Intern Spotlight: Kevin Banks | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACT EVALUATION PLANIsProcess Relevant toIntergovernmentalAs(Click

  16. Solar Decathlon Technology Spotlight: Structural Insulated Panels |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann JacksonDepartment ofOffice|inWestMayBuilding K-25 cleanup atDepartmentCompetition on

  17. In The Spotlight | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation CurrentHenry Bellamy,Impact AssessmentsImprovingIn Case ofIn SituIn The News

  18. Workers' Spotlight Newsletters | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuelWeatherize »EvePlant | Department ofJuly 27,

  19. Employee Spotlight: Ali Erdemir | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.Emilio SegrèDepartmentEmployee

  20. Employee Spotlight: Ali Erdemir | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.Emilio SegrèDepartmentEmployeeAli

  1. Employee Spotlight: Ann Schlenker | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.Emilio SegrèDepartmentEmployeeAliAnn

  2. Employee Spotlight: Jennifer Hogan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2, 2014

  3. Employee Spotlight: Jennifer Hogan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2, 2014Jennifer

  4. Employee Spotlight: José Valdez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2,Jonathan

  5. Employee Spotlight: Sarah Soltau | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller JuneMichaelRon

  6. Advanced Manufacture of Reflectors (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-09-01

    The University of Arizona is one of the 2012 SunShot CSP R&D awardees for their advanced collectors. This fact sheet explains the motivation, description, and impact of the project.

  7. Project Profile: Advanced Manufacture of Reflectors | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    that creates very precise mirrors in a variety of shapes. The Photo of a man standing next to a table holding a large silver, square-shaped reflective material. focus is...

  8. Optical Reflectance Measurements for Commonly Used Reflectors

    E-Print Network [OSTI]

    Janecek, Petr Martin

    2009-01-01

    for polytetrafluoroethylene (PTFE) tape and titanium dioxidetypes of polytetrafluoroethylene (PTFE) tapes, a well-knownIL] and a 90 µm thick glossy PTFE tape (unknown origin). We

  9. Solar module having reflector between cells

    DOE Patents [OSTI]

    Kardauskas, Michael J. (Billerica, MA)

    1999-01-01

    A photovoltaic module comprising an array of electrically interconnected photovoltaic cells disposed in a planar and mutually spaced relationship between a light-transparent front cover member in sheet form and a back sheet structure is provided with a novel light-reflecting means disposed between adjacent cells for reflecting light falling in the areas between cells back toward said transparent cover member for further internal reflection onto the solar cells. The light-reflecting comprises a flexible plastic film that has been embossed so as to have a plurality of small V-shaped grooves in its front surface, and a thin light-reflecting coating on said front surface, the portions of said coating along the sides of said grooves forming light-reflecting facets, said grooves being formed so that said facets will reflect light impinging thereon back into said transparent cover sheet with an angle of incidence greater than the critical angle, whereby substantially all of the reflected light will be internally reflected from said cover sheet back to said solar modules, thereby increasing the current output of the module.

  10. Optical Reflectance Measurements for Commonly Used Reflectors

    E-Print Network [OSTI]

    Janecek, Petr Martin

    2009-01-01

    by the National Nuclear Security Administration, Office ofby the National Nuclear Security Administration, Office of

  11. The Sandia Wave Reflector - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effectWorking With U.S.Week Day Year(activeInforumMILC&inDepartmentReport) |The

  12. ZPR-3 Assembly 11 : A cylindrical sssembly of highly enriched uranium and depleted uranium with an average {sup 235}U enrichment of 12 atom % and a depleted uranium reflector.

    SciTech Connect (OSTI)

    Lell, R. M.; McKnight, R. D.; Tsiboulia, A.; Rozhikhin, Y.; National Security; Inst. of Physics and Power Engineering

    2010-09-30

    Over a period of 30 years, more than a hundred Zero Power Reactor (ZPR) critical assemblies were constructed at Argonne National Laboratory. The ZPR facilities, ZPR-3, ZPR-6, ZPR-9 and ZPPR, were all fast critical assembly facilities. The ZPR critical assemblies were constructed to support fast reactor development, but data from some of these assemblies are also well suited for nuclear data validation and to form the basis for criticality safety benchmarks. A number of the Argonne ZPR/ZPPR critical assemblies have been evaluated as ICSBEP and IRPhEP benchmarks. Of the three classes of ZPR assemblies, engineering mockups, engineering benchmarks and physics benchmarks, the last group tends to be most useful for criticality safety. Because physics benchmarks were designed to test fast reactor physics data and methods, they were as simple as possible in geometry and composition. The principal fissile species was {sup 235}U or {sup 239}Pu. Fuel enrichments ranged from 9% to 95%. Often there were only one or two main core diluent materials, such as aluminum, graphite, iron, sodium or stainless steel. The cores were reflected (and insulated from room return effects) by one or two layers of materials such as depleted uranium, lead or stainless steel. Despite their more complex nature, a small number of assemblies from the other two classes would make useful criticality safety benchmarks because they have features related to criticality safety issues, such as reflection by soil-like material. ZPR-3 Assembly 11 (ZPR-3/11) was designed as a fast reactor physics benchmark experiment with an average core {sup 235}U enrichment of approximately 12 at.% and a depleted uranium reflector. Approximately 79.7% of the total fissions in this assembly occur above 100 keV, approximately 20.3% occur below 100 keV, and essentially none below 0.625 eV - thus the classification as a 'fast' assembly. This assembly is Fast Reactor Benchmark No. 8 in the Cross Section Evaluation Working Group (CSEWG) Benchmark Specificationsa and has historically been used as a data validation benchmark assembly. Loading of ZPR-3 Assembly 11 began in early January 1958, and the Assembly 11 program ended in late January 1958. The core consisted of highly enriched uranium (HEU) plates and depleted uranium plates loaded into stainless steel drawers, which were inserted into the central square stainless steel tubes of a 31 x 31 matrix on a split table machine. The core unit cell consisted of two columns of 0.125 in.-wide (3.175 mm) HEU plates, six columns of 0.125 in.-wide (3.175 mm) depleted uranium plates and one column of 1.0 in.-wide (25.4 mm) depleted uranium plates. The length of each column was 10 in. (254.0 mm) in each half of the core. The axial blanket consisted of 12 in. (304.8 mm) of depleted uranium behind the core. The thickness of the depleted uranium radial blanket was approximately 14 in. (355.6 mm), and the length of the radial blanket in each half of the matrix was 22 in. (558.8 mm). The assembly geometry approximated a right circular cylinder as closely as the square matrix tubes allowed. According to the logbook and loading records for ZPR-3/11, the reference critical configuration was loading 10 which was critical on January 21, 1958. Subsequent loadings were very similar but less clean for criticality because there were modifications made to accommodate reactor physics measurements other than criticality. Accordingly, ZPR-3/11 loading 10 was selected as the only configuration for this benchmark. As documented below, it was determined to be acceptable as a criticality safety benchmark experiment. A very accurate transformation to a simplified model is needed to make any ZPR assembly a practical criticality-safety benchmark. There is simply too much geometric detail in an exact (as-built) model of a ZPR assembly, even a clean core such as ZPR-3/11 loading 10. The transformation must reduce the detail to a practical level without masking any of the important features of the critical experiment. And it must do this without increasing the total uncertain

  13. HELSINKI UNIVERSITY OF TECHNOLOGY ENE-47.153 Halogens, dioxins/Halogens, dioxins/furansfurans

    E-Print Network [OSTI]

    Zevenhoven, Ron

    -500 / 50-2000/0.5 -90 Light fuel oil - Peat ~ 500 Heavy fuel oil - / oil shale ~2000 & electronic equip- ment (E&E) waste plastics * ~ 3.5 / ~ 0.9 Sewage sludge 0.03 - 1 Mixed medical waste 1 - 4

  14. Better Buildings: Workforce: Spotlight on Portland, Oregon: Making...

    Energy Savers [EERE]

    Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings Portland Summary of Reported Data Voluntary Initiative: Designing Incentives...

  15. Celebrity Power: Spotlighting and Persuasion in the Media

    E-Print Network [OSTI]

    Harvey, Mark A.

    2014-05-31

    John Lennon’s organizing with Jerry Rubin and Abby Hoffman amounted to any real changes? Does it make a difference when politicians vi play music at their rallies? How did Ronald Reagan co-opt Bruce Springsteen’s critical and subversive “Born...

  16. High Performance Builder Spotlight: GreenCraft, Lewisville, TX

    SciTech Connect (OSTI)

    2011-01-01

    In October and November 2009, the TimberCreek Zero Energy House in Lewisville, Texas, opened as a Building America Demonstration House. The 2,538-foot,three-bedroom, 2½-bath custom-built home showed a home energy rating score (HERS) of 56 without the solar photovoltaics and a HERS score of 1 with PV.

  17. EM Update Newsletter Spotlights River Corridor Cleanup at Hanford...

    Energy Savers [EERE]

    preventing contamination from reaching it, and cocooning or demolishing hundreds of structures no longer in use, including former reactors along the river that helped create...

  18. Learning in a Studio Mode, Spotlighting Teamwork and

    E-Print Network [OSTI]

    Lin, Xi

    students supported by one instructor, 2 TF's, and 2 LA's" Focus on teamwork & active engagement" Learning student-centered active learning. 3/7/14Learning in a Studio Mode Why do Studio? Better learning overall Students like it better #12;3 Class design: Lecture 3/7/14Learning in a Studio Mode Lecture

  19. Spotlight on Michigan: Sweeping the State for Ultimate Success

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Programmatic evolution is underway to understand the effectiveness of the various sweep design elements and to further increase the number of upgrades completed. One realiza-...

  20. Spotlight on Austin, Texas: Best Offer Ever Produces Upgrades...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    andor ventilation 8) Identify any potential hazards to life safety such as carbon monoxide or inadequate combustion, electrical, or fuel issues NO END Processing enters bid,...

  1. ARPA-E Technology Showcase: Project Spotlight | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    General Atomics Scientists at General Atomics are working to develop a "flow battery" that will be able to store large amounts of energy using chemicals that are stored...

  2. McGuffey Art Center Spotlight Series SCIENCE & ART PROJECT

    E-Print Network [OSTI]

    Acton, Scott

    the psychological effects of social and political trauma, natural disaster or illness on individuals, families, China, Israel, Malaysia, South #12;Korea, New Zealand, Japan, Canada and Taiwan. To learn more, visit as a like-minded community using psychodrama, shamanic energy medicine, and art therapy. #12;

  3. The blinking spotlight of attention Rufin VanRullen*

    E-Print Network [OSTI]

    VanRullen, Rufin

    on continuous allocation of attention to the different targets (a ``parallel'' strategy) or whether attention to distinguish between these two alternatives. The human psychometric function for detection of a single target as a function of its duration can be used to predict the correspond- ing function for two or more attended

  4. Isoprenoid biosynthesis in eukaryotic phototrophs: A spotlight on algae

    SciTech Connect (OSTI)

    Lohr M.; Schwender J.; Polle, J. E. W.

    2012-04-01

    Isoprenoids are one of the largest groups of natural compounds and have a variety of important functions in the primary metabolism of land plants and algae. In recent years, our understanding of the numerous facets of isoprenoid metabolism in land plants has been rapidly increasing, while knowledge on the metabolic network of isoprenoids in algae still lags behind. Here, current views on the biochemistry and genetics of the core isoprenoid metabolism in land plants and in the major algal phyla are compared and some of the most pressing open questions are highlighted. Based on the different evolutionary histories of the various groups of eukaryotic phototrophs, we discuss the distribution and regulation of the mevalonate (MVA) and the methylerythritol phosphate (MEP) pathways in land plants and algae and the potential consequences of the loss of the MVA pathway in groups such as the green algae. For the prenyltransferases, serving as gatekeepers to the various branches of terpenoid biosynthesis in land plants and algae, we explore the minimal inventory necessary for the formation of primary isoprenoids and present a preliminary analysis of their occurrence and phylogeny in algae with primary and secondary plastids. The review concludes with some perspectives on genetic engineering of the isoprenoid metabolism in algae.

  5. Building America Research Teams: Spotlight on Home Innovation...

    Energy Savers [EERE]

    codes across the United States. The team won another Top Innovation award for its cost-effective advanced framing techniques that improve the thermal performance of an...

  6. ORNL, Industry Collaboration Puts Spotlight on Solar T DOING...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    for thin-film copper indium gallium di- selenide, a direct-bandgap material for solar cells. Ferro Corpora- tion (Independence, Ohio) is creating inks and pastes to be used for...

  7. High Performance Builder Spotlight: Wathen Castanos Hybrid Homes

    SciTech Connect (OSTI)

    2011-01-01

    Wathen Castanos Hybrid Homes of Fresno, CA, has worked with Building America team member IBACOS to apply building science to production homes. Even without solar panels, the company’s Jordan model exceeds California’s building efficiency standard by 36%.

  8. Earth & Space Science News Eos.org // 27 RESEARCH SPOTLIGHT

    E-Print Network [OSTI]

    Houze Jr., Robert A.

    . In a new study, Barnes and Houze catalog different types of "hydrometeors"--parti- cles of water and ice inflows travel laterally and gradually descend. This study shows how the formation of the liquid and ice

  9. Better Buildings: Workforce: Spotlight on Fayette County, Pennsylvania...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    low-income weatherization program to households with incomes greater than 200% above poverty level. The expanded program requires a BPI certified technician to perform a home...

  10. High Performance Builder Spotlight: G.W. Robinson

    SciTech Connect (OSTI)

    2011-01-01

    G.W. Robinson of Gainesville, Florida, worked with Building America partners Florida Solar Energy Center and Florida HERO to achieve a true net zero energy home in 2010.

  11. High Performance Builder Spotlight: LifeStyle Homes

    SciTech Connect (OSTI)

    2011-01-01

    LifeStyle Homes of Melbourne, Florida, is aiming for affordable net zero energy homes with help from Building America research partner Florida Solar Energy Center.

  12. Builders Challenge High Performance Builder Spotlight – Tommy Williams Homes

    SciTech Connect (OSTI)

    2010-02-05

    Builders Challenge fact sheet highlighting performance and energy-efficiency features of Tommy Williams Homes, Longleaf case study, Gainesville, FL

  13. Home Energy Score Past Webinars and Video Spotlights | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Here are past webinars and materials from Home Energy Score. March 4, 2015: Home Energy Score Update: New Simulation Training & Requirements for Assessors In an effort to...

  14. Thermal reclamation of used blast grit. Technology spotlight report

    SciTech Connect (OSTI)

    1995-08-01

    Naval shipyards and other domestic port facilities generate thousands of tons of used blast grit annually. There are also thousands of steel bridges in the United States on a repaint schedule that requires grit blasting for surface preparation. All the used grit, along with the paint residue it contains, is currently disposed of in landfills. Cleaning and recycling used blast grit is an attractive alternative. Institute of Gas Technology (IGT) has developed a fluidized-bed sand calciner that is well suited for cleaning and recycling used blast grit. Essentially, IGT researchers applied a transfer/adaptation of fluidized-bed calcination originally developed for the reclamation of foundry sand. The calciner has a patented sloped-grid design that enhances the combustion of paint residues and promotes the isolation of reusable material.

  15. FE SPOTLIGHT Breathing, bugs, and brains: conceptual unification?

    E-Print Network [OSTI]

    ). At some point, the level of oxygen declines, or car- bon dioxide rises, enough to cause the spiracles a recent mechanistic model for the control of spiracles, from Fo¨ rster & Hetz (2010), and a new hypothesis energy. Although the actual metabolic costs of running an insect brain are poorly known, they could

  16. Employee Spotlight: John T. Murphy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformation Current HABFES ScienceInformation CompanyEmployee

  17. Spotlight on Maine: Transition to a Sustainable Level of Incentives |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime |

  18. Spotlight on Michigan: Sweeping the State for Ultimate Success | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime |of Energy

  19. Spotlight on Seattle, Washington: Community Partnerships Work to Extend

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime |ofProgram Reach |

  20. Better Buildings: Financing and Incentives: Spotlight on Maine: Transition

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Departmentof EnergyStateandto a

  1. Better Buildings: Financing and Incentives: Spotlight on Michigan:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Departmentof EnergyStateandto aExperiment

  2. Better Buildings: Workforce, Spotlight on Maine: Contractor Sales Training

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Departmentof EnergyStateandto

  3. Better Buildings: Workforce: Spotlight on Fayette County, Pennsylvania:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Departmentof EnergyStateandtoDeveloping

  4. Better Buildings: Workforce: Spotlight on Portland, Oregon: Making the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Departmentof

  5. Spotlight on Key Program Strategies from the Better Buildings Neighborhood

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing Tool FitsProjectDataSecretaryDepartment7 Annual2 Special Report:405-01ToolsProgram, Final

  6. Building America Research Teams: Spotlight on Alliance for Residential

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l De pEnergymeeting, The Best ApproachprojectsBuilding

  7. Building America Research Teams: Spotlight on Home Innovation and PARR |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l De pEnergymeeting, The Best ApproachprojectsBuildingDepartment

  8. Hydrogen Production by PEM Electrolysis: Spotlight on Giner and Proton

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum12,ExecutiveFinancingR Walls -Hydro-Pac Inc.,1 DOEPRODUCTION BY PEM ELECTROLYSIS:

  9. DOE Sustainability SPOtlight: Special Edition 2013 DOE Sustainability

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based| Department8, 2015 GATEWAY Takes onandField |

  10. High Performance Builder Spotlight: Green Coast Enterprises - New Orleans,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum12,ExecutiveFinancing ProgramsDepartment of¡

  11. SSL in America: Spotlight on SAES Pure Gas

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterestedReplacement-2-AA-1 SECTION J APPENDIXAllegations RelatedSTUDENTApril 15, 2015

  12. Workers' Spotlight Newsletter - Issue 1 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork Plan|Department

  13. Workers' Spotlight Newsletter - Issue 10 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork Plan|Department0

  14. Workers' Spotlight Newsletter - Issue 11 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork Plan|Department011

  15. Workers' Spotlight Newsletter - Issue 12 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork Plan|Department0112

  16. Workers' Spotlight Newsletter - Issue 13 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork

  17. Workers' Spotlight Newsletter - Issue 6 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers'

  18. Workers' Spotlight Newsletter - Issue 7 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers'7 Workers'

  19. Workers' Spotlight Newsletter - Issue 8 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers'7

  20. Workers' Spotlight Newsletter - Issue 9 | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OFAMERICA'S FUTURE.Energy Wind PowerRegina RameikaWork2 Workers'7Workers'

  1. White House Spotlights Solar Innovation as Summit Registration Continues |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann JacksonDepartment| Department of EnergyData compiledEnergy In honorDepartment of

  2. Washington Auto Show Spotlight: How Fuel Cell Electric Vehicles Work |

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuel EfficiencyWashington , DC 20585 April 15, 2013

  3. Workers' Spotlight Newsletter - Issue 14 | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuelWeatherize »EvePlant | Department ofJuly 27, 20114

  4. Workers' Spotlight Newsletter - Issue 15 | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuelWeatherize »EvePlant | Department ofJuly 27, 201145

  5. Employee Spotlight: John T. Murphy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would like submitKansas NuclearElectronic StructureEly M.EmilioDave Keller June 2,

  6. ARPA-E Technology Showcase: Project Spotlight | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels DataEnergy Webinar: DemonstrationProgram |

  7. Design & Manufacture of Stiffened Spring-Back Reflector Demonstrator

    E-Print Network [OSTI]

    Soykasap, Omer

    woven Carbon Fiber Reinforced Plastic (CFRP) demon- strator. Although the SSBR concept was originally 100 grams. Introduction The SSBR concept is based on a thin flexible carbon fiber reinforced plastic

  8. AIAA 2004-1574 New Deployable Reflector Concept

    E-Print Network [OSTI]

    Soykasap, Omer

    that comprises curved surfaces formed from thin sheets of carbon-fiber-reinforced-plastic (CFRP) connected solid" from thin, curved sheets of carbon-fiber-reinforced-plastic (CFRP), connected by flexible hinges

  9. Thin-Shell Deployable Reflectors with Collapsible Stiffeners: Experiments and

    E-Print Network [OSTI]

    Pellegrino, Sergio

    suitable for high gain antennas, mirrors, etc. It is made as a single piece, for example by curing carbon-fiber of two different plastics. Both folding experiments and vibration tests in the fully deployed

  10. Advanced Manufacture of Reflectors- FY12 Q4

    Broader source: Energy.gov [DOE]

    This document summarizes the progress of this University of Arizona project, funded by SunShot, for the fourth quarter of fiscal year 2012.

  11. Convection venting lensed reflector-type compact fluorescent lamp system

    DOE Patents [OSTI]

    Pelton, B.A.; Siminovitch, M.

    1997-07-29

    Disclosed herein is a fluorescent lamp housing assembly capable of providing convection cooling to the lamp and the ballast. The lens of the present invention includes two distinct portions, a central portion and an apertured portion. The housing assembly further includes apertures so that air mass is able to freely move up through the assembly and out ventilation apertures. 12 figs.

  12. Effects of reflector augmentation on fixed polycrystalline arrays

    SciTech Connect (OSTI)

    Harrison, T.D.

    1984-05-01

    The 130-kW photovoltaic system located on the roof of the Omniplex in Oklahoma City, OK was designed with mirrors to increase the amount of solar radiation that strikes the modules during the intervals between spring and autumn equinox and so increases the power generated by the array. The design intent was to produce 130 kW at noon on summer solstice; however at no time has the array produced more than 100 kW. Sandia National Laboratories, Albuquerque, designed a multiphase experiment to determine the reason that the array failed to meet the design intent. This report describes the experiment, the results obtained, and the lessons learned.

  13. Thin-Shell Deployable Reflectors with Collapsible Stiffeners

    E-Print Network [OSTI]

    Pellegrino, Sergio

    of high-modulus, ultra-thin composite materials. An inherent, and significant limitation of this approach is that these structures remain "floppy" in their deployed configuration. This paper presents a general concept breadth of rectangular cross-section c radius of coiling D plate bending stiffness pg. 9 and 10, aperture

  14. Effect of implementation of a Bragg reflector in the photonic

    E-Print Network [OSTI]

    consists of an InP photonic crystal slab including four InAsP quantum wells, a SiO2 bonding layer-temperature InAs/InP Quantum Dots laser operat

  15. Project Profile: High Performance Reflector Panels for CSP Assemblies

    Broader source: Energy.gov [DOE]

    PPG, under the CSP R&D FOA, is aiming to develop and commercialize large-area second-surface glass mirrors that are superior in value, cost, and performance, to existing mirrors on the market today.

  16. Advanced Manufacture of Reflectors- FY13 Q1

    Broader source: Energy.gov [DOE]

    This document summarizes the progress of this University of Arizona project, funded by SunShot, for the first quarter of fiscal year 2013.

  17. RUBIDIUM VAPOR CELL WITH INTEGRATED NONMETALLIC MULTILAYER REFLECTORS

    E-Print Network [OSTI]

    Chen, Zhongping

    and demonstrated by use of a variety of innovative techniques, including wafer level glass blowing [3]. In many

  18. MODELLING OF CAVITY RECEIVER HEAT TRANSFER COMPACT LINEAR FRESNEL REFLECTOR

    E-Print Network [OSTI]

    is a concept for a large-scale solar thermal power plant. Its goal is to provide high-pressure steam from financed by an Australian power station, who will use the generated steam to displace coal consumption. This approach allows an affordable entry into renewable energy for existing coal-power producers, and allows

  19. Development of Advanced Polymeric Reflector for CSP Applications - Final Report

    SciTech Connect (OSTI)

    Treglio, Richard, T; Boyle, Keith, A; Henderson, Hildie

    2013-03-28

    This project attempted to deposit extremely thick and dense protective barrier onto a mirror film stack with a PET substrate. The target thickness was very high for thin film products; particularly since large areas and long production lengths of film are needed to make the final product economic. The technical investigations in this project centered on maintaining a quality barrier (i.e. dense film) while evaporating alumina with a high deposition rate onto a low cost PET substrate. The project found that the proposed configuration, particularly direct ion bombardment, provides too narrow a solution space to effectively and economically produce the ASRM attempted. The initial project goals were met when depositing on a limited width and at a modest rate. However, expanding to wide deposition at aggressive deposition rates did not produce consistent film quality. Economic viability drives the process to maximize deposition rate. The current system configuration has a limiting upper rate threshold that does not appear economically viable. For future work, alternate approaches seem needed to address the challenges encountered in the scale-up phase of this project.

  20. Recovery Act: Low-Cost, Highly Lambertian Reflector Composite...

    Office of Scientific and Technical Information (OSTI)

    of coatings development using particle size reduction techniques and preparation of coating solutions with a broad range of particle types. The research explored scale-up of...

  1. Code division multiple access signaling for modulated reflector technology

    DOE Patents [OSTI]

    Briles, Scott D. (Los Alamos, NM)

    2012-05-01

    A method and apparatus for utilizing code division multiple access in modulated reflectance transmissions comprises the steps of generating a phase-modulated reflectance data bit stream; modifying the modulated reflectance data bit stream; providing the modified modulated reflectance data bit stream to a switch that connects an antenna to an infinite impedance in the event a "+1" is to be sent, or connects the antenna to ground in the event a "0" or a "-1" is to be sent.

  2. Imaging with Spherically Bent Crystals or Reflectors (Technical Report) |

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfate Reducing(Journal Article)lasers(Journal Article) |SciTechphysical experiments,UCoGa5SciTech

  3. Imaging with Spherically Bent Crystals or Reflectors (Technical Report) |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverse (JournalvivoHighHusseinSOLICWfATION/MODIFICATlONImagingLaboratory

  4. Accumulation and Metabolism of Halogenated Compounds in Sea Turtles

    E-Print Network [OSTI]

    Richardson, Kristine Lynn

    2010-01-01

    Toxicological and Environmental Chemistry 34(1): 19- Lakesparverius). Environmental Toxicology and Chemistry 20(11):hepatocytes. Environmental Toxicology and Chemistry 25(2):

  5. Inert gas rejection device for zinc-halogen battery systems

    DOE Patents [OSTI]

    Hammond, Michael J. (Sterling Heights, MI); Arendell, Mark W. (Warren, MI)

    1981-01-01

    An electrolytic cell for separating chlorine gas from other (foreign) gases, having an anode, a cathode assembly, an aqueous electrolyte, a housing, and a constant voltage power supply. The cathode assembly is generally comprised of a dense graphite electrode having a winding channel formed in the face opposing the anode, a gas impermeable (but liquid permeable) membrane sealed into the side of the cathode electrode over the channel, and a packing of graphite particles contained in the channel of the cathode electrode. The housing separates and parallelly aligns the anode and cathode assembly, and provides a hermetic seal for the cell. In operation, a stream of chlorine and foreign gases enters the cell at the beginning of the cathode electrode channel. The chlorine gas is dissolved into the electrolyte and electrochemically reduced into chloride ions. The chloride ions disfuse through the gas impermeable membrane, and are electrochemically oxidized at the anode into purified chlorine gas. The foreign gases do not participate in the above electrochemical reactions, and are vented from the cell at the end of the cathode electrode channel.

  6. Nature's Inventory of Halogenation Catalysts: Oxidative Strategies Predominate

    E-Print Network [OSTI]

    biosynthetic gene clusters, enabling coordinate regulation to activate these secondary metabolite pathways the abundance of chloride and bromide ions in microenvironments of terrestrial and marine producer organisms

  7. Synthesis and Characterization of Halogen-Free Antiflammable Polyphosphonates Containing

    E-Print Network [OSTI]

    flammability. Polyethylene and polypropylene, for example, possess heat of combustion properties on par a diffusion barrier of gaseous products to the flame, shields the polymer surface from heat and oxygen

  8. Accumulation and Metabolism of Halogenated Compounds in Sea Turtles

    E-Print Network [OSTI]

    Richardson, Kristine Lynn

    2010-01-01

    rat liver cytosol with styrene oxide and 35 S-GSH, and B)PB-treated rat cytosol with styrene oxide and 35 S-GSH (seeglutathione conjugate of styrene as a standard. However, GS-

  9. Manganese Porphyrins Catalyze Selective C-H Bond Halogenations

    SciTech Connect (OSTI)

    Liu, Wei; Groves, John T

    2010-01-01

    We report a manganese porphyrin mediated aliphatic C?H bond chlorination using sodium hypochlorite as the chlorine source. In the presence of catalytic amounts of phase transfer catalyst and manganese porphyrin Mn(TPP)Cl 1, reaction of sodium hypochlorite with different unactivated alkanes afforded alkyl chlorides as the major products with only trace amounts of oxygenation products. Substrates with strong C?H bonds, such as neopentane (BDE =?100 kcal/mol) can be also chlorinated with moderate yield. Chlorination of a diagnostic substrate, norcarane, afforded rearranged products indicating a long-lived carbon radical intermediate. Moreover, regioselective chlorination was achieved by using a hindered catalyst, Mn(TMP)Cl, 2. Chlorination of trans-decalin with 2 provided 95% selectivity for methylene-chlorinated products as well as a preference for the C2 position. This novel chlorination system was also applied to complex substrates. With 5?-cholestane as the substrate, we observed chlorination only at the C2 and C3 positions in a net 55% yield, corresponding to the least sterically hindered methylene positions in the A-ring. Similarly, chlorination of sclareolide afforded the equatorial C2 chloride in a 42% isolated yield. Regarding the mechanism, reaction of sodium hypochlorite with the Mn{sup III} porphyrin is expected to afford a reactive Mn{sup V}?O complex that abstracts a hydrogen atom from the substrate, resulting in a free alkyl radical and a Mn{sup IV}—OH complex. We suggest that this carbon radical then reacts with a Mn{sup IV}—OCl species, providing the alkyl chloride and regenerating the reactive Mn{sup V}?O complex. The regioselectivity and the preference for CH{sub 2} groups can be attributed to nonbonded interactions between the alkyl groups on the substrates and the aryl groups of the manganese porphyrin. The results are indicative of a bent [Mn{sup v}?O---H---C] geometry due to the C—H approach to the Mn{sup v}?O (d??p?)* frontier orbital.

  10. Accumulation and Metabolism of Halogenated Compounds in Sea Turtles

    E-Print Network [OSTI]

    Richardson, Kristine Lynn

    2010-01-01

    tetrachlorodibenzo-p-dioxin (TCDD) (Poland et al. 1976;from PCBs seem to stem from dioxin- like congeners, but thetetrachlorodibenzo-p-dioxin- induced toxicity. Toxicology

  11. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, Michiko (Hampton Bays, NY); Slatkin, Daniel N. (Southold, NY)

    1995-10-03

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na.sub.4 B.sub.12 I.sub.11 SSB.sub.12 I.sub.11, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy.

  12. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, M.; Slatkin, D.N.

    1995-10-03

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na{sub 4}B{sub 12}I{sub 11}SSB{sub 12}I{sub 11}, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy. 1 fig.

  13. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, M.; Slatkin, D.N.

    1997-08-05

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na{sub 4}B{sub 12}I{sub 11}SSB{sub 12}I{sub 11}, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy. 1 fig.

  14. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, Michiko (Hampton Bays, NY); Slatkin, Daniel N. (Southold, NY)

    1997-08-05

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized. by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na.sub.4 B.sub.12 I.sub.11 SSB.sub.12 I.sub.11, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy.

  15. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, M.; Slatkin, D.N.

    1997-03-18

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na{sub 4}B{sub 12}I{sub 11}SSB{sub 12}I{sub 11}, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy. 1 fig.

  16. Halogenated sulfidohydroboranes for nuclear medicine and boron neutron capture therapy

    DOE Patents [OSTI]

    Miura, Michiko (Hampton Bays, NY); Slatkin, Daniel N. (Southold, NY)

    1997-03-18

    A method for performing boron neutron capture therapy for the treatment of tumors is disclosed. The method includes administering to a patient an iodinated sulfidohydroborane, a boron-10-containing compound. The site of the tumor is localized by visualizing the increased concentration of the iodine labelled compound at the tumor. The targeted tumor is then irradiated with a beam of neutrons having an energy distribution effective for neutron capture. Destruction of the tumor occurs due to high LET particle irradiation of the tissue secondary to the incident neutrons being captured by the boron-10 nuclei. Iodinated sulfidohydroboranes are disclosed which are especially suitable for the method of the invention. In a preferred embodiment, a compound having the formula Na.sub.4 B.sub.12 I.sub.11 SSB.sub.12 I.sub.11, or another pharmaceutically acceptable salt of the compound, may be administered to a cancer patient for boron neutron capture therapy.

  17. Determining thermochemical properties of halogenated metals: On enabling

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfate Reducing BacteriaConnectlaser-solid interactionCrystalDesigning(JournalProblemsofofthe rapid

  18. Determining thermochemical properties of halogenated metals: On enabling

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfate Reducing BacteriaConnectlaser-solid interactionCrystalDesigning(JournalProblemsofofthe

  19. Placing a tool in the spotlight: spatial attention modulates visuomotor responses in cortex

    E-Print Network [OSTI]

    Gazzaniga, Michael

    perception. Here, we report that spatial attention can also modulate implicit visuomotor processing in dorsal­the supplementary motor area (SMA) and the left inferior parietal lobule (IPL)­showed an interaction betweenPMd), the supplementary motor area (SMA), the region just anterior to SMA (preSMA), and the inferior parietal lobule (IPL

  20. Spotlights on Recent JACS Publications HYBRID METAL-ORGANIC CRYSTALS PROVIDE

    E-Print Network [OSTI]

    , and their applications include gas storage and separation, drug delivery, and catalysis. M. Angeles Monge and colleagues electrons on the nanosheets, activate and reduce adsorbed nitrogen into reactive ammonia. Though the authors

  1. Shifting the spotlight of attention: evidence for discrete computations in cognition

    E-Print Network [OSTI]

    Buschman, Tim

    Our thoughts have a limited bandwidth; we can only fully process a few items in mind simultaneously. To compensate, the brain developed attention, the ability to select information relevant to the current task, while ...

  2. Builders Challenge High Performance Builder Spotlight: Yavapai College, Chino Valley, Arizona

    SciTech Connect (OSTI)

    2009-12-22

    Building America Builders Challenge fact sheet on Yavapai College of Chino Valley, Arizona. These college students built a Building America Builders Challenge house that achieved the remarkably low HERS score of -3 and achieved a tight building envelope.

  3. Builders Challenge High Performance Builder Spotlight - Martha Rose Construction, Inc., Seattle, Washington

    SciTech Connect (OSTI)

    2008-01-01

    Building America/Builders Challenge fact sheet on Martha Rose Construction, an energy-efficient home builder in marine climate using the German Passiv Haus design, improved insulation, and solar photovoltaics.

  4. Builders Challenge High Performance Builder Spotlight - NextGen Home, Las Vegas, Nevada

    SciTech Connect (OSTI)

    None

    2009-01-01

    Building America Builders Challenge fact sheet on the NextGen demo home built in Las Vegas. The home has a Home Energy Rating System (HERS) index score of 44 with R-40 spray foam attic insulation, R-40 insulated concrete walls, and a 4kW DC solar laminate

  5. 220 March 2013 / Vol. 63 No. 3 www.biosciencemag.org Spring Spotlight on Books

    E-Print Network [OSTI]

    Shadmehr, Reza

    a Styrofoam coffee cup to a Big Gulp. Our expectation of the weight of an object influences the forces that we

  6. In the glare of the media spotlight, the European refugee crisis has sparked a

    E-Print Network [OSTI]

    Sussex, University of

    of poverty, receiving humanitarian assistance to `integrate' as refugees, and dealing with the consequences and poverty (MOOP) in East, West and Southern Africa as well as South and Southeast Asia show that all

  7. SpecieS in the Spotlight: Survive to thrive Recovering threatened and

    E-Print Network [OSTI]

    for taking the time to review this annual report to Congress. The report is important because it documents with renewed commitment and intensified efforts. Starting on May 15, 2015--Endangered Species Day) ·Central California Coast Coho Evolutionarily Significant Unit (ESU) ·Cook Inlet Beluga Whale DPS ·Hawaiian

  8. Lab Spotlight: Sandia National Lab Team Wins Best in Class Sustainabil...

    National Nuclear Security Administration (NNSA)

    McCord, Ralph Wrons, Sean Naegle, Debra Clifford, Ben St. Clair, Lynda Innis, Charles Snider, Chadwick Johnson, Matthew Smith, Jason Loyd, and Gabe Arrillaga. Jun 15, 2015 at 10...

  9. Building America Research Teams: Spotlight on ARIES and NorthernSTAR...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the central hydronic heating system in a three-building, 42-unit housing development. The heating control systems were upgraded, which reduced energy use by nearly 20% with a...

  10. oday the spotlight in the United States is on the increasing world demand for

    E-Print Network [OSTI]

    Mukhtar, Saqib

    , The Texas A&M University System. Manure to Energy: Understanding Processes, Principles and Jargon -- Saqib sources, such as bio fuels, forests, wind, solar and animal manure. While demand for hydrocarbon energy. Energy losses during the digestion process include the energy lost in manure (feces and urine), in gases

  11. Award Spotlight Could Return to EM-Developed Technology for Tracking...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with the local receiver, secured computer network servers, and satellite- or cellular-based communication channels. The EM RFID technology was developed to cut costs of...

  12. Award Spotlight Could Return to EM-Developed Technology for Tracking...

    Broader source: Energy.gov (indexed) [DOE]

    Office of Packaging and Transportation, discusses the radiofrequency identification technology he developed. At left is RFID Team Leader Yung Liu, with Argonne National...

  13. Builders Challenge High Performance Builder Spotlight - Rural Development Inc., Turner Falls, Massachusetts

    SciTech Connect (OSTI)

    2008-01-01

    Building America/Builders Challenge fact sheet on Rural Development Inc, an energy-efficient home builder in cold climate using radiant floor heat, solar hot water, and PV. Examines cost impacts.

  14. Moab Uranium Mill Tailings Cleanup Project Steps into Spotlight at International Meeting in Vienna

    Broader source: Energy.gov [DOE]

    VIENNA – The Moab Uranium Mill Tailings Remedial Action (UMTRA) Project has kept the United States at the forefront of characterization, remediation, and end-state reuse of uranium millsites around the world.

  15. Report to the New Jersey State Board of Agriculture Spotlight on Rutgers NJAES EcoComplex

    E-Print Network [OSTI]

    Goodman, Robert M.

    researchers are working on microturbine co-generation of heat and electricity and on biogas production from

  16. Spotlight on Austin, Texas: Best Offer Ever Produces Upgrades in Record

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime | Department of

  17. Spotlight on Austin, Texas: Let Your Contractor Be Your Guide for Big

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime | Department

  18. Spotlight on Rutland County, Vermont: How Local Ties Lead to Local Wins |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof2 SpecialSpent FuelTime |of

  19. The City of Los Angeles Has Its Spotlight on Energy Efficiency | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing ToolInternational Affairs, BeforeActivitiesEnergy Tell(EAP)BNLBusinessesof Energy

  20. EECBG Success Story: The City of Los Angeles Has Its Spotlight on Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i FramingBecker andfindingEnergy roof of the justice center

  1. Building America Research Teams: Spotlight on ARIES and NorthernSTAR |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l De pEnergymeeting, The Best Approachprojects

  2. Spotlight on Key Program Strategies from the Better Buildings Neighborhood Program

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION J APPENDIX E LIST OF APPLICABLE DIRECTIVESDepartmentSpecial Report:Department of EnergyFinal

  3. Oct. 29 Webinar to Spotlight DOE Energy Programs for Tribes and First

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterested Parties -DepartmentAvailable forSiteWeatherization FundingFundingOct

  4. Office of Worker Screening and Compensation Support Workers' Spotlight Issue 14 October, November, December 2014

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterested Parties -DepartmentAvailableHighOffice of IndianEnergy Office ofIssue 15

  5. Office of Worker Screening and Compensation Support Workers' Spotlight, July, August, September 2014

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterested Parties -DepartmentAvailableHighOffice of IndianEnergy Office ofIssue

  6. Award Spotlight Could Return to EM-Developed Technology for Tracking

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann JacksonDepartment|Marketing, LLC | Department4 The26Shipments | Department of Energy

  7. Home Energy Score Past Webinars and Video Spotlights | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof Energy ServicesContracting OversightEMSHome Energy ChecklistResidential

  8. Lab Spotlight: Sandia National Lab Team Wins Best in Class Sustainability

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACTThousand CubicResource andfirstDevice UWRecord-Setting

  9. #LabSpotlight - People of the National Labs | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels DataEnergy Webinar: Demonstration of

  10. Assessment of optical performance of three non-tracking, non-imaging, external compound parabolic concentrators designed for high temperature solar thermal collector units

    E-Print Network [OSTI]

    Cisneros, Jesus

    2010-01-01

    4 Ideal Solar Reflector Design……………………………………………5 Designand ideal solar reflector design. Sections three and four1998a). Ideal Solar Reflector Design The ideal reflector

  11. Doubling the optical efficiency of a chiral liquid crystal laser using a reflector

    E-Print Network [OSTI]

    Wu, Shin-Tson

    and other materials as well sharing a similar chiral PBG structure as elastomers7 and polymers8 have been advantages and the laser beam from another side is wasted. We venture to recycle the laser by adding a mirror

  12. WhiteOptics' Low-Cost Reflector Composite Boosts LED Fixture Efficiency

    Office of Energy Efficiency and Renewable Energy (EERE)

    With the help of DOE funding, WhiteOptics has developed a composite coating that can be used to improve efficiency in backlit, indirect, and cavity-mixing LED luminaire designs by maximizing light reflection and output. The highly diffuse coating, which is based on a novel high-reflectance particle technology, allows for uniform distribution of light without exaggerating the point-source nature of the LEDs, and is intended to offer an overall system cost-improving solution for LED optics.

  13. Fabrication of crystalline Bragg reflectors for high power and integrated optical applications by

    E-Print Network [OSTI]

    Sóbester, András

    conditions, as well as having the additional benefit of use in hybrid laser crystals (e.g. integrated mirrors of fabrication and to allow mixed layer growth for grating strength apodisation. Substrates were heated via CO2 including chamber pumping and venting; this technique is hence of particular interest for rapid prototyping

  14. ORALLOY (93.2 235U) METAL CYLINDER WITH BERYLLIUM TOP REFLECTOR

    SciTech Connect (OSTI)

    John D. Bess; Leland M. Montierth; Raymond Reed; John T. Mihalczo

    2010-09-01

    A variety of critical experiments were constructed of enriched uranium metal during the 1960s and 1970s at the Oak Ridge Critical Experiments Facility (ORCEF) in support of criticality safety operations at the Y-12 Plant. The purposes of these experiments included the evaluation of storage, casting, and handling limits for the Y-12 Plant and providing data for verification of calculation methods and cross-sections for nuclear criticality safety applications. These included solid cylinders of various diameters, annuli of various inner and outer diameters, two and three interacting cylinders of various diameters, and graphite and polyethylene reflected cylinders and annuli. Of the hundreds of delayed critical experiments, one experiment was comprised of a stack of approximately 7-inch-diameter metal discs. The bottom of the stack consisted of uranium with an approximate height of 4-1/8 inches. The top of the stack consisted of beryllium with an approximate height of 5-9/16 inches. This experiment was performed on August 20, 1963 by J. T. Mihalczo and R. G. Taylor (Ref. 1) with accompanying logbook. Both detailed and simplified model specifications are provided in this evaluation. This fast-spectra experiment was determined to represent an acceptable benchmark. The calculated eigenvalues for both the detailed and simple models are within approximately 0.5% of the benchmark values, but significantly greater than 3s from the benchmark value because the uncertainty in the benchmark is very small: ±0.0002 (1s). There is significant variability between results using different neutron cross section libraries, the greatest being a ?keff of ~0.65% . Unreflected and unmoderated experiments with the same highly enriched uranium metal parts were performed at the Oak Ridge Critical Experiments Facility in the 1960s and are evaluated in HEU MET FAST 051. Thin graphite reflected (2 inches or less) experiments also using the same highly enriched uranium metal parts are evaluated in HEU MET FAST 071. Polyethylene-reflected configurations are evaluated in HEU-MET-FAST-076. Highly enriched metal annuli with beryllium cores are evaluated in HEU-MET-FAST-059.

  15. Algorithms for Rapid Characterization and Optimization of Aperture and Reflector Antennas

    E-Print Network [OSTI]

    Densmore, Arthur Charles

    2014-01-01

    Wavelengths During the 1988 Solar Conjunction of Voyager 2,"143] J. A. Kennewell, “Solar radio interference to satelliteSeck, and Y. Rahmat-Samii, “Ka-Band Solar Flux Study for G/T

  16. Design and fabrication of highly efficient electrooptic modulators using bragg grating reflectors 

    E-Print Network [OSTI]

    Kim, Ryoung-Han

    2006-04-12

    crystal if the light is incident along the optic z-axis. D. Electrooptic Effect The propagation of an electro-magnetic wave inside a medium is determined by the refractive index of the medium. The electrooptic effect is the change of refractive...

  17. Project Profile: Predictive Physico-Chemical Modeling of Intrinsic Degradation Mechanisms for Advanced Reflector Materials

    Broader source: Energy.gov [DOE]

    NREL, under the Physics of Reliability: Evaluating Design Insights for Component Technologies in Solar (PREDICTS) Program will be developing a physics-based computational degradation model to assess the kinetic oxidation rates; realistic model light attenuation and transport; and multi-layer treatment with variable properties Simulation based experimental design.

  18. Benchmark Evaluation of Uranium Metal Annuli and Cylinders with Beryllium Reflectors

    SciTech Connect (OSTI)

    John D. Bess

    2010-06-01

    An extensive series of delayed critical experiments were performed at the Oak Ridge Critical Experiments Facility using enriched uranium metal during the 1960s and 1970s in support of criticality safety operations at the Y-12 Plant. These experiments were designed to evaluate the storage, casting, and handling limits of the Y-12 Plant and to provide data for the verification of cross sections and calculation methods utilized in nuclear criticality safety applications. Many of these experiments have already been evaluated and included in the International Criticality Safety Benchmark Evaluation Project (ICSBEP) Handbook: unreflected (HEU-MET-FAST-051), graphite-reflected (HEU-MET-FAST-071), and polyethylene-reflected (HEU-MET-FAST-076). Three of the experiments consisted of highly-enriched uranium (HEU, ~93.2% 235U) metal parts reflected by beryllium metal discs. The first evaluated experiment was constructed from a stack of 7-in.-diameter, 4-1/8-in.-high stack of HEU discs top-reflected by a 7-in.-diameter, 5-9/16-in.-high stack of beryllium discs. The other two experiments were formed from stacks of concentric HEU metal annular rings surrounding a 7-in.diameter beryllium core. The nominal outer diameters were 13 and 15 in. with a nominal stack height of 5 and 4 in., respectively. These experiments have been evaluated for inclusion in the ICSBEP Handbook.

  19. What is a seismic reflector like? Nathalie Favretto-Cristini1

    E-Print Network [OSTI]

    Boyer, Edmond

    -tracing procedure in complex 2D and 3D structures. The first method, called Fresnel vol- ume ray tracing Cervený into the wave reflection process, this study might have significant implications for seismic interpretation using amplitude-variation-with-angle methodologies. INTRODUCTION The basis of many seismic studies

  20. Seismic reflector imaging using internal multiples with Marchenko-type equations

    E-Print Network [OSTI]

    Snieder, Roel

    vertical seismic profile data, thereby redatuming the source to the focus depth. Decon- volving the upgoing. (2012) used the idea to retrieve a virtual vertical seismic profile (VSP) with the virtual source inside by the downgoing vertical seismic pro- file data redatums the receiver to the focus depth and gives the desired

  1. Low-Cost Self-Cleaning Reflector Coatings for CSP Collectors- FY13 Q2

    Office of Energy Efficiency and Renewable Energy (EERE)

    This document summarizes the progress of this ORNL project, funded by SunShot, for the second quarter of fiscal year 2013.

  2. Project Profile: Low-Cost Self-Cleaning Reflector Coatings for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and solvents that can be applied to large area surfaces using simple low-cost spray coating techniques developed by the commercial paint industry. Innovation This project...

  3. Advanced Reflector and Absorber Materials (Fact Sheet), Thermal Systems Group: CSP Capabilities (TSG)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 OutreachProductswsicloudwsicloudden DocumentationAccommodationsRegisterLithium-basedNuclear Reactor

  4. Project Profile: Low-Cost Self-Cleaning Reflector Coatings for CSP

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy Bills andOrderNATIONALofDefine ReviewImpactDepartmentGenerationCollectors |

  5. Project Profile: Next-Generation Low-Cost Reflector | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy Bills andOrderNATIONALofDefineEnergy National Solar Thermal

  6. Recovery Act: Low-Cost, Highly Lambertian Reflector Composite For Improved

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefield MunicipalTechnical Report:Speeding access toSmall ReactorRaymond Davis, Jr., SolarReport) | SciTechLED

  7. Recovery Act: Low-Cost, Highly Lambertian Reflector Composite For Improved

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTech ConnectSpeedingConnect(Conference) | SciTechelectrodes.Report) | SciTechLED

  8. Hydrogen Production by Polymer Electrolyte Membrane (PEM)Electrolysis...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Production by Polymer Electrolyte Membrane (PEM) Electrolysis-Spotlight on Giner and Proton Hydrogen Production by Polymer Electrolyte Membrane (PEM) Electrolysis-Spotlight on...

  9. Hydrogen Production by Polymer Electrolyte Membrane (PEM)Electrolysis...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Electrolyte Membrane (PEM) Electrolysis-Spotlight on Giner and Proton Hydrogen Production by Polymer Electrolyte Membrane (PEM) Electrolysis-Spotlight on Giner and Proton...

  10. Investigating the Biosynthesis of Halogenated Meroterpenoid Natural Products from Marine Actinomycetes

    E-Print Network [OSTI]

    Winter, Jaclyn Marie

    2010-01-01

    0.25 M lithium sulfate 0.2 M calcium acetate 0.2 M calciumlithium nitrate none none none none none none 0.3 M ammonium acetate

  11. Investigating the biosynthesis of halogenated meroterpenoid natural products from marine actinomycetes

    E-Print Network [OSTI]

    Winter, Jaclyn Marie

    2010-01-01

    0.25 M lithium sulfate 0.2 M calcium acetate 0.2 M calciumlithium nitrate none none none none none none 0.3 M ammonium acetate

  12. Analysis and Characterization of Halogenated Transformation Products of Pharmaceuticals and Personal Care Products in Wastewater Effluent

    E-Print Network [OSTI]

    Bulloch, Daryl Neil

    2013-01-01

    L) in advanced primary wastewater treatment effluent treatedat an advanced primary wastewater treatment plant as finalat an advanced primary wastewater treatment plant as final

  13. Halogen-Based Plasma Etching of Novel Field-Effect Transistor Gate Materials

    E-Print Network [OSTI]

    Kiehlbaugh, Kasi Michelle

    2009-01-01

    access to the pumps inside for maintenance and repair. Afterand easy maintenance. The inlet to each mechanical pump was

  14. Processes for preparing carbon fibers using sulfur trioxide in a halogenated solvent

    DOE Patents [OSTI]

    Patton, Jasson T.; Barton, Bryan E.; Bernius, Mark T.; Chen, Xiaoyun; Hukkanen, Eric J.; Rhoton, Christina A.; Lysenko, Zenon

    2015-12-29

    Disclosed here are processes for preparing carbonized polymers (preferably carbon fibers), comprising sulfonating a polymer with a sulfonating agent that comprises SO.sub.3 dissolved in a solvent to form a sulfonated polymer; treating the sulfonated polymer with a heated solvent, wherein the temperature of the solvent is at least 95.degree. C.; and carbonizing the resulting product by heating it to a temperature of 500-3000.degree. C. Carbon fibers made according to these methods are also disclosed herein.

  15. Supramolecular self-assembled network formation containing NBr halogen bonds in physisorbed overlayers

    E-Print Network [OSTI]

    Brewer, Adam Y.; Sacchi, Marco; Parker, Julia E.; Truscott, Chris L.; Jenkins, Steve; Clarke, Stuart M.

    2014-08-05

    the physicochemical properties of molecular solids4 via complementary interactions between the constituent mole- cules. Similar principles have been utilised in the design of two-dimensional (2D) physisorbed co-layers. Typically, hydro- gen bonding is the interaction... of the surface unit cell, relative to the much stronger adsorbate–adsorbate interactions.32,41 Therefore in the first set of calculations we have optimized the structure of the commensurate and non-commensurate co- layer without including the substrate...

  16. Halogen-Based Plasma Etching of Novel Field-Effect Transistor Gate Materials

    E-Print Network [OSTI]

    Kiehlbaugh, Kasi Michelle

    2009-01-01

    for the main etch step: Adding fluorine-bearing species tothe main etch. It was included as an alternative F-bearing

  17. Separating the Influence of Halogen and Climate Changes on Ozone Recovery in the Upper Stratosphere

    E-Print Network [OSTI]

    causes ozone destruction by enhancing production of water vapor via methane oxidation. Additionally. Including potential climate-induced stratospheric water vapor increases, the ozone change relative to 1980 depletion chemistry, and therefore indirectly leading to more ozone. Increases in methane directly affect

  18. Treatment and prevention systems for acid mine drainage and halogenated contaminants

    DOE Patents [OSTI]

    Jin, Song (Fort Collins, CO); Fallgren, Paul H. (Laramie, WY); Morris, Jeffrey M. (Laramie, WY)

    2012-01-31

    Embodiments include treatments for acid mine drainage generation sources (10 perhaps by injection of at least one substrate (11) and biologically constructing a protective biofilm (13) on acid mine drainage generation source materials (14). Further embodiments include treatments for degradation of contaminated water environments (17) with substrates such as returned milk and the like.

  19. Reactive Halogens in the Marine Boundary Layer (RHaMBLe): the tropical North Atlantic experiments

    E-Print Network [OSTI]

    2010-01-01

    close to or East of the Canary Islands, before arriving atpassing near to the Canary Islands on its way to Cape Verde.passing close to the Canary islands before approaching Cape

  20. THERMAL RATE CONSTANTS, ENERGY DEPENDENCE AND ISOTOPE EFFECT FOR LASER INITIATED HALOGEN-HYGRO-GENHALIDE REACTIONS

    E-Print Network [OSTI]

    Mei, C.-C.

    2011-01-01

    vs 10 IT ..•..••. Velocity dependence of the reaction crossIII-II. Velocity dependence of the reaction cross section crthermal reaction, the ratio of the rotational velocity of

  1. Halogen-elimination photochemistry and oxygen-activation chemistry of late transition-metal complexes

    E-Print Network [OSTI]

    Teets, Thomas S. (Thomas Sebastian)

    2012-01-01

    Multi-electron reaction chemistry, from both ground- and excited-state species, is at the heart of many topics in renewable energy and catalysis. In this thesis, two classes of reactions central to the themes of energy ...

  2. The Halogenation of Oils with Special Attention to the Method of Wijs

    E-Print Network [OSTI]

    Rhodes, Edmund Oliver

    1913-05-15

    of experiments in which varying time was used, 44 Eh c CO o a •H Eh «.H O +> O O , 3 C IH EH o o o a a $ S to o CO as will be noted from time to time in this paper while explaining the various tables. Following the completion of Table Ho. I, a series of experiments represented by Tables II, III, IV and V...

  3. Remedial extraction and catalytic hydrodehalogenation for treatment of soils contaminated by halogenated hydrophobic organic compounds 

    E-Print Network [OSTI]

    Wee, Hun Young

    2009-05-15

    for the extraction of 1,2,4,5-tetrachlorobenzne (TeCB) or pentachlorophenol (PCP) from contaminated soil. Palladium-catalyzed hydrodehalogenation (HDH) was applied for destroying TeCB or PCP in mixtures of water and ethanol in a batch mode. The experimental results...

  4. Analysis and Characterization of Halogenated Transformation Products of Pharmaceuticals and Personal Care Products in Wastewater Effluent

    E-Print Network [OSTI]

    Bulloch, Daryl Neil

    2013-01-01

    emerging contaminants in sewage sludge. Trac-Trends Anal.mass spectrometry in sewage sludge from the Spanish area of

  5. INTHIS ISSUE Staff Council Member List Corporate Challenge Results In The Staff Spotlight page 2 page 3 page 4

    E-Print Network [OSTI]

    O'Toole, Alice J.

    Maute, Lin 1 6851 lmaute McLain, Remona 7 2935 rpm014100 Minnish, Roxanne 6 2106 roxanne.minnish Murry

  6. CAFASP3 in the Spotlight of EVA Volker A. Eyrich,1* Dariusz Przybylski,1,2,4

    E-Print Network [OSTI]

    Pazos, Florencio

    Biotecnologia (CNB-CSIC), Cantoblanco, Madrid, Spain 6 ALMA Bioinformatica, Contoblanco, Madrid, Spain ABSTRACT

  7. Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:FinancingPetroleum Based Fuels Researchof Energy| Department of Energy

  8. Infrared floodlight assembly

    DOE Patents [OSTI]

    Wierzbicki, Julian J. (Peabody, MA); Chakrabarti, Kirti B. (Danvers, MA)

    1987-09-22

    An infrared floodlight assembly (10) including a cast aluminum outer housing (11) defining a central chamber (15) therein. A floodlight (14), having a tungsten halogen lamp as the light source, is spacedly positioned within a heat conducting member (43) within chamber (15) such that the floodlight is securedly positioned in an aligned manner relative to the assembly's filter (35) and lens (12) components. The invention also includes venting means (51) to allow air passage between the interior of the member (43) and the adjacent chamber (15), as well as engagement means (85) for engaging a rear surface of the floodlight (14) to retain it firmly against an internal flange of the member (43). A reflector (61), capable of being compressed to allow insertion or removal, is located within the heat conducting member's interior between the floodlight (14) and filter (35) to reflect infrared radiation toward the filter (35) and spaced lens (12).

  9. Application of conical 90-degree reflectors for solving the problem of mirror alignment in terahertz-range lasers

    SciTech Connect (OSTI)

    Radionov, V P; Kiselev, V K

    2014-10-29

    We report a study of the conical mirrors with an apex angle of 90° in the resonator of the gas-discharge HCN laser with the radiation wavelength of 337 ?m (0.89 THz). Experimental results have shown that such mirrors do not require precise alignment. This makes it possible to improve the radiation stability, significantly simplify the construction of laser and reduce the complexity of its maintenance. (laser applications and other topics in quantum electronics)

  10. Integration of Self-Assembled Porous Alumina and Distributed Bragg Reflector for Light Trapping in Si Photovoltaic Devices

    E-Print Network [OSTI]

    Sheng, Xing

    Light trapping is an important issue for thin film silicon photovoltaic cells due to the limited absorption coefficient for near infrared light. In this letter, we present a photonic structure that combines porous anodic ...

  11. Chemical Effect of Dry and Wet Cleaning of the Ru Protective Layer of the Extreme ultraviolet (EUV) Lithography Reflector

    E-Print Network [OSTI]

    Belau, Leonid

    2010-01-01

    Park, Physical Chemistry Chemical Y.B. He, et al. , JournalChemical Effect of Dry and Wet Cleaning of the Ru ProtectiveBerkeley, California 94720 Chemical Sciences Division,

  12. A Dual-Band Retrodirective Reflector Array on Paper Utilizing Substrate Integrated Waveguide (SIW) and Inkjet Printing

    E-Print Network [OSTI]

    Tentzeris, Manos

    .aubert@enseeiht.fr** Apostolos Georgiadis Centre Tecnologic de Telecomunicacions de Catalunya, Catalunya, Spain ageorgiadis

  13. A Novel Dual-Band Retro-directive Reflector Array on Paper Utilizing Substrate Integrated Waveguide (SIW) and Inkjet Printing

    E-Print Network [OSTI]

    Tentzeris, Manos

    Tecnologic de Telecomunicacions de Catalunya (CTTC), Catalunya, Spain Abstract -- In this paper, we propose

  14. GEOPHYSICS. VOL. 56, NO 4 (APRIL 1991); P. 565~571. 8 FIGS. Array analysis of reflector heterogeneity

    E-Print Network [OSTI]

    reflection surveys. For example, COCORP surveyshave found bright spotsinterpreted to indicate midcrustal

  15. Kinetic model for predicting the concentrations of active halogens species in chlorinated saline cooling waters. Final report

    SciTech Connect (OSTI)

    Haag, W.R.; Lietzke, M.H.

    1981-08-01

    A kinetic model has been developed for describing the speciation of chlorine-produced oxidants in seawater as a function of time. The model is applicable under a broad variety of conditions, including all pH range, salinities, temperatures, ammonia concentrations, organic amine concentrations, and chlorine doses likely to be encountered during power plant cooling water chlorination. However, the effects of sunlight are not considered. The model can also be applied to freshwater and recirculating water systems with cooling towers. The results of the model agree with expectation, however, complete verification is not feasible at the present because analytical methods for some of the predicted species are lacking.

  16. Kinetic Modeling of Halogen-Based Plasma Etching of Complex Oxide Films and its Application to Predictive Feature Profile Simulation

    E-Print Network [OSTI]

    Marchack, Nathan

    2012-01-01

    Guidelines A.1.1. Emergency Shut Down Procedures I. In caseGuidelines A.2.1. Emergency Shut Down Procedures 1. Turn offProcedure A.3.1. Emergency Shut Down Procedures I. In case

  17. Experimental and Computational Study of Flame Inhibition Mechanisms of Halogenated Compounds in C1-C3 Alkanes Flames 

    E-Print Network [OSTI]

    Osorio Amado, Carmen H

    2013-07-30

    has been found to meet all of the exigent criteria. Further progress in this research requires fundamental combustion knowledge that can help us understand the unique performance of Halon 1301, to prevent this search from becoming a tedious trial...

  18. Fluids and halogens at the diagenetic-metamorphic boundary: evidence from veins in continental basins, western Norway

    E-Print Network [OSTI]

    Svensen, Henrik

    basins, western Norway H. SVENSEN1 , B. JAMTVEIT1 , D. A. BANKS2 AND D. KARLSEN1 1 Department of Geology, University of Oslo, Blindern, Oslo, Norway; 2 School of Earth Sciences, University of Leeds, Leeds, UK, Kvamshesten and Solund basins) in western Norway. These include calcite-, quartz- and epidote-dominated veins

  19. Recovery of Poly(3-hydroxybutyrate-co-3-hydroxyhexanoate) from Ralstonia eutropha cultures with non-halogenated solvents

    E-Print Network [OSTI]

    Riedel, Sebastian L.

    Reduced downstream costs, together with high purity recovery of polyhydroxyalkanoate (PHA), will accelerate the commercialization of high quality PHA-based products. In this work, a process was designed for effective ...

  20. Two versatile cofactors, flavin adenine dinucleotide and non-heme iron, involved in DNA repair and natural product halogenation

    E-Print Network [OSTI]

    Wong, Cintyu

    2009-01-01

    Cofactors assist enzymes with a variety of complex chemistries. Two versatile cofactors, flavin adenine dinucleotide (FAD) and non-heme iron, together with molecular oxygen as an oxidizing agent, perform a wide array of ...

  1. Kinetic Modeling of Halogen-Based Plasma Etching of Complex Oxide Films and its Application to Predictive Feature Profile Simulation

    E-Print Network [OSTI]

    Marchack, Nathan

    2012-01-01

    S.F. “Area Selective Atomic Layer Deposition by Microcontactarea-selective atomic layer deposition." Advanced Materialsof Al2O3 using atomic layer deposition." Applied Physics

  2. Kinetic Modeling of Halogen-Based Plasma Etching of Complex Oxide Films and its Application to Predictive Feature Profile Simulation

    E-Print Network [OSTI]

    Marchack, Nathan

    2012-01-01

    Applied Physics Letters 94(4). Pourbaix, M. (1976). "SOMEEllingham 1944) and the Pourbaix diagram (plot of voltageelectrochemical system). (Pourbaix 1976) However, for the

  3. Kinetic Modeling of Halogen-Based Plasma Etching of Complex Oxide Films and its Application to Predictive Feature Profile Simulation

    E-Print Network [OSTI]

    Marchack, Nathan

    2012-01-01

    958-963. Chae, H. , S. A. Vitale, et al. (2003). "Silicon381-387. Chae, H. , S. A. Vitale, et al. (2003). "SiliconPhysics 57(2): 952-959. Vitale, S. A. , H. Chae, et al. (

  4. Gas Phase Reactions between Fuel Molecules and Halogens: A Review of the Reaction between Atomic Chlorine and Ammonia

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverse (Journal Article)ForthcomingGENERALProblems I n QEstimates - EnergyGasGas

  5. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Environmental Management (EM)

    todesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Better Buildings: Financing and Incentives: Spotlight on Maine: Transition to a Sustainable Level of Incentives...

  6. UniversityofCambridgeresearchmagazine www.cam.ac.uk/research/

    E-Print Network [OSTI]

    ;2 | contents Researchnews 3­5 Spotlight: 6­17 Foodsecurity Turbocharging a new Green 6 Revolution Predictive

  7. Speaker biographies for the Fuel Cell Technologies Program Webinar titled Hydrogen Production by PEM Electrolysis Â… Spotlight on Giner and Proton

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergy BillsNo.Hydrogen4EnergySolidof Energy Space

  8. STUDIES ON ZINC NODULES ELECTRODEPOSITED FROM ACID ELECTROLYTES

    E-Print Network [OSTI]

    Anderson, R.

    2011-01-01

    LBL Workshop on the Electrochemistry of Zinc/Halogen Bat-and E. Cairns, "The Electrochemistry Zinc Electrode," inon the Proceed- of Electrochemistry Zinc/Halogen Batteries,

  9. Design of anti-ring back reflectors for thin-film solar cells based on three-dimensional optical and electrical modeling

    SciTech Connect (OSTI)

    Hsiao, Hui-Hsin; Wu, Yuh-Renn, E-mail: yrwu@ntu.edu.tw [Graduate Institute of Photonics and Optoelectronics, National Taiwan University, Taipei, Taiwan (China); Chang, Hung-Chun [Graduate Institute of Photonics and Optoelectronics, Graduate Institute of Communication Engineering, and Department of Electrical Engineering, National Taiwan University, Taipei, Taiwan (China)

    2014-08-11

    The optical and electrical properties of a photonic-plasmonic nanostructure on the back contact of thin-film solar cells were investigated numerically through the three-dimensional (3D) finite-difference time-domain method and the 3D Poisson and drift-diffusion solver. The focusing effect and the Fabry-Perot resonances are identified as the main mechanisms for the enhancement of the optical generation rate as well as the short circuit current density. However, the surface topography of certain nanopattern structures is found to reduce the internal electrostatic field of the device, thus limiting charge collection. The optimized conditions for both optics and electronics have been analyzed in this paper.

  10. GEOPHYSICS, VOL. 55, NO. 6 (JUNE 1990); P. 67Ck.681, 11 FIGS., 1 TABLE. Physical properties of deep crustal reflectors in southern California from

    E-Print Network [OSTI]

    in the deep crust. To simplify this analysis, recorded ampli- tudes are assumed to be reflections from weak in the Mojave Desert recorded deep reflections that show amplitude changes with offset. Both the 1985 Calcrust reflection which they believe can be traced to surface exposures, the geologic interpretation of middle

  11. Enhanced Thermal Stability of W-Ni-Al[subscript 2]O[subscript 3] Cermet-Based Spectrally Selective Solar Absorbers with W Infrared Reflectors

    E-Print Network [OSTI]

    Cao, Feng

    Solar thermal technologies such as solar hot water and concentrated solar power trough systems rely on spectrally selective solar absorbers. These solar absorbers are designed to efficiently absorb the sunlight while ...

  12. VUV-VIS optical characterization of Tetraphenyl-butadiene films on glass and specular reflector substrates from room to liquid Argon temperature

    E-Print Network [OSTI]

    Francini, R; Nichelatti, E; Vincenti, M A; Canci, N; Segreto, E; Cavanna, F; Di Pompeo, F; Carbonara, F; Fiorillo, G; Perfetto, F

    2013-01-01

    The use of efficient wavelength-shifters from the vacuum-ultraviolet to the photosensor's range of sensitivity is a key feature in detectors for Dark Matter search and neutrino physics based on liquid argon scintillation detection. Thin film of Tetraphenyl-butadiene (TPB) deposited onto the surface delimiting the active volume of the detector and/or onto the photosensor optical window is the most common solution in current and planned experiments. Detector design and response can be evaluated and correctly simulated only when the properties of the optical system in use (TPB film + substrate) are fully understood. Characterization of the optical system requires specific, sometimes sophisticated optical methodologies. In this paper the main features of TPB coatings on different, commonly used substrates is reported, as a result of two independent campaigns of measurements at the specialized optical metrology labs of ENEA and University of Tor Vergata. Measured features include TPB emission spectra with lineshap...

  13. EDDY RESOLVING NUTRIENT ECODYNAMICS IN THE GLOBAL PARALLEL OCEAN PROGRAM AND CONNECTIONS WITH TRACE GASES IN THE SULFUR, HALOGEN AND NMHC CYCLES

    SciTech Connect (OSTI)

    S. CHU; S. ELLIOTT

    2000-08-01

    Ecodynamics and the sea-air transfer of climate relevant trace gases are intimately coupled in the oceanic mixed layer. Ventilation of species such as dimethyl sulfide and methyl bromide constitutes a key linkage within the earth system. We are creating a research tool for the study of marine trace gas distributions by implementing coupled ecology-gas chemistry in the high resolution Parallel Ocean Program (POP). The fundamental circulation model is eddy resolving, with cell sizes averaging 0.15 degree (lat/long). Here we describe ecochemistry integration. Density dependent mortality and iron geochemistry have enhanced agreement with chlorophyll measurements. Indications are that dimethyl sulfide production rates must be adjusted for latitude dependence to match recent compilations. This may reflect the need for phytoplankton to conserve nitrogen by favoring sulfurous osmolytes. Global simulations are also available for carbonyl sulfide, the methyl halides and for nonmethane hydrocarbons. We discuss future applications including interaction with atmospheric chemistry models, high resolution biogeochemical snapshots and the study of open ocean fertilization.

  14. Grant Holder Research Organisation Project Title Grant Reference Peter Bernath University of York Satellite Observations of Halogen-Containing Molecules NE/I022663/1

    E-Print Network [OSTI]

    Grant Holder Research Organisation Project Title Grant Reference Peter Bernath University of York, Ice and Super-cooled Water Particles. NE/I023058/1 Gareth Chisham NERC British Antarctic Survey The University of Manchester Effects of a warming climate on the key organic carbon cycle processes

  15. Field test of a generic method for halogenated hydrocarbons: Semivost test at a chemical manufacturing facility. Final project report, August 1992-August 1993

    SciTech Connect (OSTI)

    McGaughey, J.F.; Bursey, J.T.; Merrill, R.G.

    1996-11-01

    The candidate methods for semivolatile organic compounds are SW-846 Sampling Method 0010 and Analytical Method 8270, which are applicable to stationary sources. Two field tests were conducted using quadruple sampling trains with dynamic spiking were performed according to the guidelines of EPA Method 301. The first field test was performed at a site with low levels of moisture. The second test reported here was conducted at a chemical manufacturing facility where chemical wastes were burned in a coal-fired boiler. Poor recoveries obtained for the spiked analytes at the second test were attributed to wet sorbent from the sampling train, use of methanol to effect complete transfer of wet sorbent from the sampling module, and use of extraction techniques which did not effect a complete separation of methylene chloride from methanol. A procedure to address problems with preparation of samples from Method 0010 is included in the report.

  16. Deoxybenzoin-Based Polyarylates as Halogen-Free Fire-Resistant Kenneth A. Ellzey, T. Ranganathan, Joseph Zilberman, E. Bryan Coughlin,*

    E-Print Network [OSTI]

    with high carbon monoxide emis- sion.7,8 Ideal flame-retardant polymers would possess high thermal stability, low combustion heat release rate, low total heat of combustion, and minimal release of toxic fumes. The use of nonhalogenated polymers that undergo significant carbonization upon heating is highly desirable

  17. Reactive halogens (BrO and OClO) detected in the plume of Soufrière Hills Volcano during an eruption hiatus

    E-Print Network [OSTI]

    Donovan, Amy; Tsanev, Vitchko; Oppenheimer, Clive; Edmonds, Marie

    2014-08-20

    column densities. The final week of measurements was characterized by lower wind speeds and clearer skies. Attempts to measure the ageing plume offshore on 17 April 2011 had limited success due to attenuation and the angle at which the measurements had...

  18. Fluid origins, paths, and fluid-rock reactions at convergent margins, using halogens, Cl stable isotopes, and alkali metals as geochemical tracers

    E-Print Network [OSTI]

    Wei, Wei

    2007-01-01

    20-40 mm/yr and the geothermal gradient is high, ~110°C/km,is 85 mm/yr and the geothermal gradient is ~10°C/km (TableRica subduction zone, the geothermal gradient is low and

  19. Fluid origins, paths, and fluid-rock reactions at convergent margins, using halogens, Cl stable isotopes, and alkali metals as geochemical tracers

    E-Print Network [OSTI]

    Wei, Wei

    2007-01-01

    0.89 ‰ at Nankai and Barbados, (e.g. Ransom et al. , 1995;to -7.8 ‰ at Nankai and Barbados (e.g. (Ransom et al. ,3.3.2; (2) smectite from Barbados (ODP Leg 110, 110-671B-51

  20. Safe Use of Isoflurane in Animal Care Research Isoflurane is a halogenated hydrocarbon that is commonly used as an animal anesthetic. Exposure to

    E-Print Network [OSTI]

    Jia, Songtao

    ; cough, sore throat, headache, drowsiness, and dizziness. The health effects from long term exposure

  1. ,,,"Incandescent","Standard Fluorescent","Compact Fluorescent","High-Intensity Discharge","Halogen"

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: AlternativeMonthly","10/2015"Monthly","10/2015" ,"Release7 Relative Standard Errors for Table 5.7;" " Unit:8977.8.38.

  2. ,,,"Incandescent","Standard Fluorescent","Compact Fluorescent","High-Intensity Discharge","Halogen"

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: AlternativeMonthly","10/2015"Monthly","10/2015" ,"Release7 Relative Standard Errors for Table 5.7;" "

  3. Development of a Low Cost Ultra Specular Advanced Polymer Film...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Development of a Low Cost Ultra Specular Advanced Polymer Film Solar Reflector Development of a Low Cost Ultra Specular Advanced Polymer Film Solar Reflector This presentation was...

  4. UBC Social Ecological Economic Development Studies (SEEDS) Student Report Ben Duenas, Chen Ling, Neona Chan, Yi Ru Soh

    E-Print Network [OSTI]

    categories: solvent/oil waste (halogenated, non- halogenated and oils), non-regulated contaminated solid, Neona Chan, Yi Ru Soh Quantifying Water Content for Non-halogenated Waste Solvents CHBE 464 March 24 Problem-Based Laboratory: Final Report Quantifying Water Content for Non-halogenated Waste Solvents March

  5. NREL: NEWS - Features

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    alumni from NREL's Executive Energy Leadership program (Energy Execs) are finding their green energy projects in the national spotlight as they put what they learned into...

  6. Homeowner and Contractor Surveys | Department of Energy

    Energy Savers [EERE]

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings...

  7. Approaches to Approved Contractor Lists | Department of Energy

    Energy Savers [EERE]

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings...

  8. PEM Electrolyzer Incorporating an Advanced Low Cost Membrane...

    Broader source: Energy.gov (indexed) [DOE]

    pd030hamdan2011o.pdf More Documents & Publications Hydrogen Production by Polymer Electrolyte Membrane (PEM) Electrolysis-Spotlight on Giner and Proton Hydrogen...

  9. Fermilab | Visit Fermilab | Colloquium

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science History Organization Photo and Video Gallery Diversity Education Safety Sustainability and Environment Contact Newsroom Spotlight Press Releases Fact Sheets and...

  10. Opportunity for Collaborative Interdisciplinary Research is Expanded by

    E-Print Network [OSTI]

    Crawford, T. Daniel

    Control Room · Renewable Materials · Nanoscience and Technology of the Environment · School of Biomedical .................................................................... 6 Technology News ............................................................... 7 Student News ...................................................................... 8 Technology Focus ........................................................... 12 Faculty Spotlight

  11. PNNL: Breakthroughs Magazine - Winter 2000-2001

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0-2001 issue Spotlight on nanotechnology Breakthroughs Magazine Breakthroughs Archive In this issue... Cover Editor's Screen Contents At A Glance Special Report (cover story)...

  12. Hanford’s 200 West Pump and Treat System Garners Worldwide Attention

    Broader source: Energy.gov [DOE]

    RICHLAND, Wash. – A groundwater treatment system at the Hanford site is in the international spotlight and is being called a technological marvel.

  13. Detector Support Group

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    browser. Concerns? Hall B Navigation DSG Home Staff Presentations Notes print version Detector Support Group Spotlight Archive Index Rotation test for the SVT detector EPICS...

  14. Internet Usage Mining Using Random Forests

    E-Print Network [OSTI]

    Liu, Xuening

    2013-01-01

    Los Angeles Internet Usage Mining Using Random Forests Aof the Thesis Internet Usage Mining Using Random Forests bydata emerges, data mining is finally in the spotlight. This

  15. Technical Standards Newsletter - March 1999 | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    The Technical Standards Newsletter - March 1999 Inside this issue: A Note From the Manager ..... 2 TSM Spotlight ... 3 Upcoming Meetings ... 4...

  16. Building America Whole-House Solutions for New Homes: Green Coast...

    Energy Savers [EERE]

    Green Coast Enterprises - New Orleans, Louisiana High Performance Builder Spotlight: Green Coast Enterprises - New Orleans, Louisiana DOE Zero Energy Ready Home Case Study:...

  17. WIPP Attracts International Interest

    Broader source: Energy.gov [DOE]

    CARLSBAD, N.M. – EM’s Waste Isolation Pilot Plant (WIPP) was in the spotlight with two international organizations at meetings held in Europe late last year.

  18. STATE OF CALIFORNIA NATURAL RESOURCES AGENCY EDMUND G. BROWN JR., Governor CALIFORNIA ENERGY COMMISSION

    E-Print Network [OSTI]

    Ballasts, Light-emitting Diodes, and Multifaceted Reflector Lamps · Water Appliances (Docket #12-AAER-2C

  19. Fine-scale features on bioreplicated decoys of the emerald ash borer provide necessary visual verisimilitude

    E-Print Network [OSTI]

    for developing insect- trapping technologies. Keyword: 3D Printing, Bioreplication, Bragg-stack reflector

  20. Tres Problemas de Iluminacion y Visibilidad Jorge Urrutia *

    E-Print Network [OSTI]

    Urrutia, Jorge

    mucha atenci´on en la literatura. Las fuentes de luz utilizadas para iluminar nuestros objetos pueden ser de varios tipos, l´amparas que emiten luz alrede- dor de ellas, reflectores o fuentes de luz que Reflectores. Un - reflector es una fuente de luz colocada en un punto p, llamado el ´apice del reflector, que