Powered by Deep Web Technologies
Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Guadeloupe: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Guadeloupe: Energy Resources Guadeloupe: Energy Resources Jump to: navigation, search Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"390px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":16.25,"lon":-61.58333,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Hydrogeological model of a high energy geothermal field (Bouillante area, Guadeloupe, French West Indies)  

E-Print Network (OSTI)

1 Hydrogeological model of a high energy geothermal field (Bouillante area, Guadeloupe, French West, France 3. BRGM, Department of Geothermal Energy 3, Av. Claude Guillemin - 45060 Orléans Cedex 2, France Abstract The Bouillante geothermal field presently provides about 8% of the annual electricity needs

Paris-Sud XI, Université de


KG Group | Open Energy Information  

Open Energy Info (EERE)

KG Group KG Group Jump to: navigation, search Name KG Group Place Coimbatore, Tamil Nadu, India Sector Solar Product Holding company for three yarn firms; setting up a solar thermal plant in Tamil Nadu. Coordinates 11.01167°, 76.98406° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":11.01167,"lon":76.98406,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


EA-319 Fortis Energy Marketing & Trading GP | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fortis Energy Marketing & Trading GP EA-319 Fortis Energy Marketing & Trading GP Order authorizing Fortis Energy Marketing & Trading GP to export electric energy to Canada EA-319...


Origin and diagenesis of lignin and carbohydrates in mangrove sediments of Guadeloupe (French West Indies): Evidence for a  

E-Print Network (OSTI)

Origin and diagenesis of lignin and carbohydrates in mangrove sediments of Guadeloupe (French West the molecular composition (carbohydrates and lignin-derived phenols) of these organic deposits in relationship synthesized by bacteria. On the other hand, lignin phenols were lost rather slowly, i.e. at a similar or lower

Paris-Sud XI, Université de


Reply to comment on "Electrical Tomography of La Soufrire of Guadeloupe Volcano: Field experiments, 1D inversion and  

E-Print Network (OSTI)

Discussion Reply to comment on "Electrical Tomography of La Soufrière of Guadeloupe Volcano: Field.25.Qi; 91.35.Pn; 91.40.-k; 93.30.Vs 1. Introduction We thank Linde and Revil for their comment [1 and discuss our approach for interpreting electrical resistivity data acquired over complex geological

Beauducel, François


EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) EA-319-A Fortis Energy Marketing & Trading GP (BNP Paribas Energy Trading GP) Order authorizing Fortis...


New results on GP Com  

E-Print Network (OSTI)

We present high resolution optical and UV spectra of the 46 min orbital period, helium binary, GP Com. Our data contains simultaneous photometric correction which confirms the flaring behaviour observed in previous optical and UV data. In this system all lines show a triple peaked structure where the outer two peaks are associated with the accretion disc around the compact object. The main aim of this paper is to constrain the origin of the central peak, also called ``central spike''. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is ~10 km/s indicating that its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. Our resolution is higher than that of previous data which allows us to resolve structure in the central peak of the line. The central spike in three of the HeI lines shows another peak blueshifted with respect to the main peak. We propose that one of the peaks is a neutral helium forbidden transition excited in a high electron density region. This forbidden transition is associated with the permitted one (the stronger peak in two of the lines). The presence of a high electron density region again favours the white dwarf as their origin.

L. Morales-Rueda; T. R. Marsh; D. Steeghs; E. Unda-Sanzana; Janet H. Wood; R. C. North



Kinematics of the helium accretor GP Com  

E-Print Network (OSTI)

We present time-resolved spectra of the double-degenerate binary star, GP Com. The spectra confirm the presence and period (46.5 min) of the `S'-wave feature found by Nather, Robinson and Stover. GP Com is erratically variable at X-ray and UV wavelengths. We have found the equivalent variability in our data, which, as also seen in UV data, is mostly confined to the emission lines. The HeII 4686 changes by the largest amount, consistent with X-ray driven photo-ionisation. The flaring part of the line profiles is broader than the average, as expected if they are dominated by the inner disc. The HeII 4686 profile is especially remarkable in that its blue-shifted peak is 1400 km/s from line centre compared to 700 km/s for the HeI lines (the red-shifted peak is blended with HeI 4713). We deduce that HeII 4686 emission is confined to the inner 1/4 of the disc. We suggest that the activity of the inner disc indicates that accretion is significant (and unstable) there, in contrast to quiescent dwarf novae, in support of models in which GP Com is in a (quasi-)steady-state of low mass transfer rate. GP Com shows triple-peaked lines profiles which consist of the usual double-peaked profiles from a disc plus a narrow component at line centre. We find evidence for both radial velocity and flux variability in this component, inconsistent with a nebula origin. The radial velocity amplitude and its phase relative to the `S'-wave are consistent with an origin on the accreting white dwarf, if the mass ratio, q = M2/M1, is of order 0.02, as expected on evolutionary grounds. However this explanation is still not satisfactory as the systemic velocity of the narrow component shows significant variation from line to line, and we have no explanation for this.

T. R. Marsh



AVANCIS GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

GmbH Co KG Jump to: navigation, search Name: AVANCIS GmbH & Co KG Place: Torgau, Germany Product: Germany-based CIS PV cell manufacturer and subsidiary of Saint Gobain....


Mann Naturenergie GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Mann Naturenergie GmbH Co KG Mann Naturenergie GmbH Co KG Jump to: navigation, search Name Mann Naturenergie GmbH & Co.KG Place Langenbach/Ww, Rhineland-Palatinate, Germany Zip 57520 Sector Biofuels, Renewable Energy Product Mann Naturenergie is engaged in renewable energy production and distribution. It offers biofuels like wood chips, wood briquettes or vegetable oil but also technical expertise. References Mann Naturenergie GmbH & Co.KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Mann Naturenergie GmbH & Co.KG is a company located in Langenbach/Ww, Rhineland-Palatinate, Germany . References ↑ "Mann Naturenergie GmbH & Co.KG" Retrieved from "http://en.openei.org/w/index.php?title=Mann_Naturenergie_GmbH_Co_KG&oldid=3486


Wallenborn Projektentwicklung GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Wallenborn Projektentwicklung GmbH Co KG Wallenborn Projektentwicklung GmbH Co KG Jump to: navigation, search Name Wallenborn Projektentwicklung GmbH & Co. KG Place Klipphausen OT Lampersdorf, Germany Zip 1665 Sector Solar, Wind energy Product Wallenborn Projektentwicklung is a wind and solar project developer. References Wallenborn Projektentwicklung GmbH & Co. KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Wallenborn Projektentwicklung GmbH & Co. KG is a company located in Klipphausen OT Lampersdorf, Germany . References ↑ "Wallenborn Projektentwicklung GmbH & Co. KG" Retrieved from "http://en.openei.org/w/index.php?title=Wallenborn_Projektentwicklung_GmbH_Co_KG&oldid=352915


Energy age wind ltd Co KG | Open Energy Information  

Open Energy Info (EERE)

age wind ltd Co KG age wind ltd Co KG Jump to: navigation, search Name energy-age-wind ltd & Co. KG Place Telgte, Germany Zip 48291 Sector Wind energy Product Energy-age-wind aims to develop small scale vertical-axis wind turbines. References energy-age-wind ltd & Co. KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. energy-age-wind ltd & Co. KG is a company located in Telgte, Germany . References ↑ "energy-age-wind ltd & Co. KG" Retrieved from "http://en.openei.org/w/index.php?title=Energy_age_wind_ltd_Co_KG&oldid=344826" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes Special pages Printable version


Bernt Lorentz GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Bernt Lorentz GmbH Co KG Bernt Lorentz GmbH Co KG Jump to: navigation, search Name Bernt Lorentz GmbH & Co KG Place Henstedt-Ulzburg, Germany Zip D-24558 Sector Solar Product German manufacturer of solar tracking devices, water pumps, and related electronic and hydraulic components. References Bernt Lorentz GmbH & Co KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Bernt Lorentz GmbH & Co KG is a company located in Henstedt-Ulzburg, Germany . References ↑ "Bernt Lorentz GmbH & Co KG" Retrieved from "http://en.openei.org/w/index.php?title=Bernt_Lorentz_GmbH_Co_KG&oldid=342681" Categories: Clean Energy Organizations Companies Organizations Stubs What links here


Berger Lichttechnik GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Berger Lichttechnik GmbH Co KG Berger Lichttechnik GmbH Co KG Jump to: navigation, search Name Berger Lichttechnik GmbH & Co KG Place Baierbrunn, Germany Zip D-82065 Sector Solar Product German manufacturer of solar simulators and measuring systems. References Berger Lichttechnik GmbH & Co KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Berger Lichttechnik GmbH & Co KG is a company located in Baierbrunn, Germany . References ↑ "Berger Lichttechnik GmbH & Co KG" Retrieved from "http://en.openei.org/w/index.php?title=Berger_Lichttechnik_GmbH_Co_KG&oldid=342677" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes


Fuhrlander Pfleiderer GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Pfleiderer GmbH Co KG Pfleiderer GmbH Co KG Jump to: navigation, search Name Fuhrlander-Pfleiderer GmbH & Co KG Place Germany Sector Wind energy Product Joint venture combining the wind power activities of Furhlander AG and Pfleiderer AG. References Fuhrlander-Pfleiderer GmbH & Co KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Fuhrlander-Pfleiderer GmbH & Co KG is a company located in Germany . References ↑ "[ Fuhrlander-Pfleiderer GmbH & Co KG]" Retrieved from "http://en.openei.org/w/index.php?title=Fuhrlander_Pfleiderer_GmbH_Co_KG&oldid=345554" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes



E-Print Network (OSTI)

. Universitaria O4510 Mexico City, MEXICO Abstract. The paper describes a hybrid approach for dynamic system), relative humidity (H), solar radiation (R) and wind speed (V) and direction (D) were recorded. The time system modelling and prediction was presented. This MB-GP approach has used small values of GP parameters

Fernandez, Thomas


Markov Models for GP and Variablelength GAs with Homologous Crossover  

E-Print Network (OSTI)

Markov Models for GP and Variable­length GAs with Homologous Crossover Riccardo Poli School Abstract In this paper we present a Markov model for GP and variable­length GAs with homolo­ gous crossover from the parents. We obtain this result by using the core of Vose's model for GAs in conjunction

Fernandez, Thomas


Mapping the peculiar binary GP Com  

E-Print Network (OSTI)

We present high resolution spectra of the AM CVn helium binary GP Com at two different wavelength ranges. The spectra show the same flaring behaviour observed in previous UV and optical data. We find that the central spike contributes to the flare spectra indicating that its origin is probably the compact object. We also detect that the central spike moves with orbital phase following an S-wave pattern. The radial velocity semiamplitude of the S-wave is \\~10 km/s which indicates its origin is near the centre of mass of the system, which in this case lies very close to the white dwarf. The Stark effect seems to affect significantly the central spike of some of the lines suggesting that it forms in a high electron density region. This again favours the idea that the central spike originates in the white dwarf. We present Doppler maps obtained for the emission lines which show three clear emission regions.

L. Morales-Rueda; T. R. Marsh; R. C. North



Meihui Windpark GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

GmbH & Co KG Place: Niedersachsen, Lower Saxony, Germany Sector: Wind energy Product: German-based wind farm operator, previously in ownership of Taiwan's InfraVest Wind Power...

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Flabeg GmbH co KG | Open Energy Information  

Open Energy Info (EERE)

Name: Flabeg GmbH & co KG Place: Nrnberg, Germany Zip: 90441 Sector: Solar Product: Glass finishing for automotive and solar industry, especially STEG. References: Flabeg GmbH...


Europartner Solar GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Europartner Solar GmbH Co KG Europartner Solar GmbH Co KG Jump to: navigation, search Name Europartner-Solar GmbH & Co KG Place Wurzburg, Bavaria, Germany Zip 97074 Sector Solar Product Wurzburg-based solar equipment provider for PV systems. Coordinates 49.792775°, 9.936395° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":49.792775,"lon":9.936395,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


GEE Energy GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

GEE Energy GmbH Co KG GEE Energy GmbH Co KG Jump to: navigation, search Name GEE Energy GmbH & Co. KG Place Hamburg, Germany Zip 20459 Sector Biomass Product Biomass trader delivering wood pellets, wood and bark briquettes to Germany, Scandinavia, Austria, Italy and Switzerland. Coordinates 53.553345°, 9.992455° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":53.553345,"lon":9.992455,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Performance test report for the 1000 kg melter  

SciTech Connect

A multiphase program was initiated in 1994 to test commercially available melter technologies for the vitrification of the low-level waste (LLW) stream from defense wastes stored in underground tanks at the Hanford Site in southeastern Washington State. Phase 1 of the melter demonstration tests using simulated LLW was completed during fiscal year 1995. This document is the 100 kg melter offgas report on testing performed by GTS Duratek Inc., in Columbia, Maryland. GTS Duratek (one of the seven vendors selected) was chosen to demonstrate Joule heated melter technology under WHC subcontract number MMI-SVV- 384215. The document contains the complete offgas report on the 100 kg melter as prepared by Parsons Engineering Science, Inc. A summary of this report is also contained in the ``GTS Duratek, Phase 1 Hanford Low-Level Waste Melter Tests: Final Report`` (WHC-SD-VI-027).

Eaton, W.C.



SSB Antriebstechnik GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

SSB Antriebstechnik GmbH Co KG SSB Antriebstechnik GmbH Co KG Jump to: navigation, search Name SSB-Antriebstechnik GmbH & Co KG Place Salzbergen, Germany Zip 48499 Sector Wind energy Product Salzbergen-based provider of pitch and control systems for wind turbines including motors, gearboxes, control and switchgear and their maintenance. Coordinates 52.323136°, 7.347278° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.323136,"lon":7.347278,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


RIO Energie GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

RIO Energie GmbH Co KG RIO Energie GmbH Co KG Jump to: navigation, search Name RIO Energie GmbH & Co KG Place Mainz, Germany Zip 55118 Sector Wind energy Product Subsidiary of the juwi group, Rio Energie develops and installs small and medium sized PV systems and wind projects. Coordinates 50.000605°, 8.2723° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":50.000605,"lon":8.2723,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Fichtner GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Fichtner GmbH Co KG Fichtner GmbH Co KG Jump to: navigation, search Name Fichtner GmbH & Co KG Place Stuttgart, Baden-Württemberg, Germany Zip 70191 Sector Solar Product Consulting engineering company, focusses on large scale projects in the infrastructure sector. Leading consultant for Solar Thermal Electricity Generation (STEG) projects. Coordinates 48.767675°, 9.171925° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.767675,"lon":9.171925,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


The role of the charged residues of the GP2 helical regions in Ebola entry  

Science Journals Connector (OSTI)

The glycoprotein (GP) of Ebola is the sole structural protein that forms ... , the full length of GP gene of Ebola Zaire species, 2028 base pairs in length ... safe approach to dissecting the entry mechanism of Ebola

Haiqing Jiang; Jizhen Wang; Balaji Manicassamy



Event:LEDS GP Event at Bonn | Open Energy Information  

Open Energy Info (EERE)

Bonn Bonn Jump to: navigation, search Calendar.png LEDS GP Event at Bonn: 17:00 - 19:15pm on 2012/05/23 This event will be co-hosted by the International Partnership on Mitigation and MRV (http://www.mitigationpartnership.net/) and the LEDS Global Partnership (http://openei.org/wiki/LEDSGP). The event titled Catalyzing Cooperative Action for Low Emissions Development will take place on May 23, 2012 from 17:00-19:15 at the BMU Headquarters in Bonn and will be followed by a reception from 19:15-20:30. The purpose of the event is to share information and learning related to current activities, to discuss and receive feedback on these activities, and to explore opportunities for linking with related initiatives. Event Details Name LEDS GP Event at Bonn Date 2012/05/23


E-Print Network 3.0 - assign p-gp inhibitor Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Branch, National Institute of Mental Health Collection: Biology and Medicine 27 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...


Markov Chain Models for GP and Variable-length GAs with Homologous Crossover  

E-Print Network (OSTI)

Markov Chain Models for GP and Variable-length GAs with Homologous Crossover Riccardo Poli School mcphee@mrs.umn.edu Abstract In this paper we present a Markov chain model for GP and variable-length GAs of the genetic material taken from the parents. We obtain this result by using the core of Vose's model for GAs

Poli, Riccardo


Wurth Solar GmbH Co KG Wuerth Solar | Open Energy Information  

Open Energy Info (EERE)

Wurth Solar GmbH Co KG Wuerth Solar Jump to: navigation, search Name: Wurth Solar GmbH & Co KG (Wuerth Solar) Place: Schwabisch Hall, Baden-Wrttemberg, Germany Zip: D-74523...


Deutsche Rotor und Turm Service GmbH Co KG DRTS | Open Energy Information  

Open Energy Info (EERE)

Rotor und Turm Service GmbH Co KG DRTS Rotor und Turm Service GmbH Co KG DRTS Jump to: navigation, search Name Deutsche Rotor und Turm Service GmbH & Co KG (DRTS) Place Bremen, Germany Zip 28239 Sector Wind energy Product Service company for wind turbine blades and towers. References Deutsche Rotor und Turm Service GmbH & Co KG (DRTS)[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Deutsche Rotor und Turm Service GmbH & Co KG (DRTS) is a company located in Bremen, Germany . References ↑ "Deutsche Rotor und Turm Service GmbH & Co KG (DRTS)" Retrieved from "http://en.openei.org/w/index.php?title=Deutsche_Rotor_und_Turm_Service_GmbH_Co_KG_DRTS&oldid=344202" Categories:


Green Energy Geotherm Power Fonds GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Geotherm Power Fonds GmbH Co KG Geotherm Power Fonds GmbH Co KG Jump to: navigation, search Name Green Energy Geotherm Power Fonds GmbH & Co. KG Place Hannover, Lower Saxony, Germany Zip 30559 Sector Geothermal energy Product German-based fund that will invest in geothermal projects to be developed by Green Energy Group. References Green Energy Geotherm Power Fonds GmbH & Co. KG[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Green Energy Geotherm Power Fonds GmbH & Co. KG is a company located in Hannover, Lower Saxony, Germany . References ↑ "Green Energy Geotherm Power Fonds GmbH & Co. KG" Retrieved from "http://en.openei.org/w/index.php?title=Green_Energy_Geotherm_Power_Fonds_GmbH_Co_KG&oldid=346014"


Event:LEDS GP Event at Rio+20 | Open Energy Information  

Open Energy Info (EERE)

Rio+20 Rio+20 Jump to: navigation, search Calendar.png LEDS GP Event at Rio+20: 15:30 - 17:00 on 2012/06/19 The purpose of the event is to share information on current LEDS GP activities and explore opportunities for collaboration with other related activities. We are looking forward to an exciting discussion on how we can work together to foster low emissions development around the world. The "LEDS Global Partnership - Enhancing Global Collaboration on Low Emissions Development" will be held on June 19th, 2012 from 15:30-17:00 at the U.S. Center, located at the Athletes Park in Barra da Tijuca, across from Rio Centro. Event Details Name LEDS GP Event at Rio+20 Date 2012/06/19 Time 15:30 - 17:00 Location Brazil Organizer LEDS GP Tags LEDS, CLEAN, Training


Effect of Ebola virus proteins GP, NP and VP35 on VP40 VLP morphology  

Science Journals Connector (OSTI)

Recently we described a role for Ebola virus proteins, NP, GP, and VP35 in enhancement of VP40 VLP budding. To explore the possibility that VLP structure was altered by co-expression of EBOV proteins leading t...

Reed F Johnson; Peter Bell; Ronald N Harty



Sonnen Solar Park GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

search Name: Sonnen Solar Park GmbH & Co KG Place: Germany Sector: Solar Product: 1.75MW solar PV park in Bavaria, developed by Voltwerk. References: Sonnen Solar Park GmbH & Co...


QUIZ 2 A ball with mass 2 kg is thrown upward with initial velocity ...  

E-Print Network (OSTI)

A ball with mass 2 kg is thrown upward with initial velocity 100 m/s from the ground. Assume the air resistance is 0.2|v|. For simplicity, just assume that g = 10.



LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop | Open  

Open Energy Info (EERE)

GP Second Annual Event: Learning and Leading on LEDS Workshop GP Second Annual Event: Learning and Leading on LEDS Workshop Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us Calendar.png LEDS GP Second Annual Event: Learning and Leading on LEDS Workshop: on 2013/02/27 (February 27 - March 1, 2013) The LEDS Global Partnership is convening its second annual global workshop to bring together leading practitioners from countries and international institutions to share lessons and strengthen cooperation on low emission development around the world. The workshop will convene peer learning and collaboration sessions on common topics of interest defined by the African Climate & Development Society, Asia LEDS


Paradigma Energie und Umwelttechnik GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Paradigma Energie und Umwelttechnik GmbH Co KG Paradigma Energie und Umwelttechnik GmbH Co KG Jump to: navigation, search Name Paradigma Energie- und Umwelttechnik GmbH & Co KG Place Karlsbad, Germany Zip 76307 Sector Solar Product A manufacturer of solar energy products and systems Coordinates 48.914742°, 8.506386° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.914742,"lon":8.506386,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Offshore Burger Windpark Butendiek GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Burger Windpark Butendiek GmbH Co KG Burger Windpark Butendiek GmbH Co KG Jump to: navigation, search Name Offshore-Burger-Windpark Butendiek GmbH & Co KG Place Husum, Germany Zip 25813 Sector Wind energy Product Developing the 240MW Butendiek offshore wind farm. Coordinates 45.799479°, -121.486901° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":45.799479,"lon":-121.486901,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}



E-Print Network (OSTI)

CLIMATE CHANGE IMPACTS ON HYDROELECTRIC POWER G.P. Harrison(1), H.W. Whittington(1) and S.W. Gundry implications for the design, operation and viability of hydroelectric power stations. This describes attempts to predict and quantify these impacts. It details a methodology for computer based modelling of hydroelectric

Harrison, Gareth


On the description of the bearing capacity of electro-discharge machined G.P Petropoulosa  

E-Print Network (OSTI)

electro-discharge machining (EDM) is the most widely and successfully applied for the machining of variousOn the description of the bearing capacity of electro-discharge machined surfaces G.P Petropoulosa with the investigation of a set of "non-common" surface topography parameters of EDMed surfaces that describe

Aristomenis, Antoniadis


Evolving Recurrent Linear-GP for Document Classification and Word Tracking  

E-Print Network (OSTI)

Evolving Recurrent Linear-GP for Document Classification and Word Tracking Xiao Luo, A. Nur Zincir word sequences. During this process, word sequences of documents are tracked, frequent patterns of temporal sequences within a document. This in return automates the process of word tracking, frequent word

Zincir-Heywood, Nur


Complete braided adsorbent for marine testing to demonstrate 3g-U/kg-adsorbent  

SciTech Connect

ORNL has manufactured four braided adsorbents that successfully demonstrated uranium adsorption capacities ranging from 3.0-3.6 g-U/kg-adsorbent in marine testing at PNNL. Four new braided and leno woven fabric adsorbents have also been prepared by ORNL and are currently undergoing marine testing at PNNL.

Janke, Chris [ORNL; Yatsandra, Oyola [ORNL; Mayes, Richard [ORNL; none,; Gill, Gary [PNNL; Li-Jung, Kuo [PNNL; Wood, Jordana [PNNL; Sadananda, Das [ORNL



Evaluation of absorption/stripping for second phase expansion of KG gas cracker  

SciTech Connect

This report addresses technology evaluation for a second phase expansion of BP Chemical Ltd.`s (BPCL) KG cracker. Its primary objective was to determine if the absorption/stripping technology being developed by BPCL is competitive with cryogenic demethanization technology. The expansion basis for this evaluation is a 150,000 MTA ethylene increment. This increment represents an increase in KG`s capacity from 450,000 MTA after the current expansion to an ultimate capacity of 600,000 MTA. Two recovery systems for a 150,000 MTA expansion are compared: (1) Case A - Absorption/Stripping Expansion; and (2) Case B - ARS Expansion. Another objective of this report was to confirm the magnitude of the economic advantages of the absorption/stripping technology for grass roots applications. For that evaluation, absorption/stripping was compared with the original 350,000 MTA KG recovery system. The two additional 350,000 MTA grass roots cases evaluated are: (1) Case C - Absorption/Stripping - Grass Roots Design; (2) Case D - Conventional Cryogenic Recovery (Original KG 350,000 MTA design).




ABO Wind Biogas Sachsen Anhalt GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

ABO Wind Biogas Sachsen Anhalt GmbH Co KG ABO Wind Biogas Sachsen Anhalt GmbH Co KG Jump to: navigation, search Name ABO Wind Biogas Sachsen-Anhalt GmbH & Co. KG Place Wiesbaden, Saxony-Anhalt, Germany Zip 65193 Product Company set up to build and operate three biogas plants in Saxony-Anhalt Germany. Coordinates 50.084592°, 8.242302° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":50.084592,"lon":8.242302,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Umwelt Windrad GmbH Co KG UWR | Open Energy Information  

Open Energy Info (EERE)

Windrad GmbH Co KG UWR Windrad GmbH Co KG UWR Jump to: navigation, search Name Umwelt Windrad GmbH & Co KG (UWR) Place Rheine, Germany Zip 48431 Sector Wind energy Product Germany-based, subsidiary of Novera Energy owner of the Prutzke and Rohlsdorf windfarms in northern Germany. Coordinates 52.278749°, 7.434676° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.278749,"lon":7.434676,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


KvH Projekt GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

KvH Projekt GmbH Co KG KvH Projekt GmbH Co KG Jump to: navigation, search Name KvH Projekt GmbH & Co KG Place Hamburg, Germany Zip D-20259 Sector Biomass, Solar, Wind energy Product Project developer in wind, solar, biomass and smart architecture. Coordinates 53.553345°, 9.992455° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":53.553345,"lon":9.992455,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Geothermie Unterhaching GmbH und Co KG | Open Energy Information  

Open Energy Info (EERE)

Unterhaching GmbH und Co KG Unterhaching GmbH und Co KG Jump to: navigation, search Name Geothermie Unterhaching GmbH und Co KG Place Unterhaching, Bavaria, Germany Zip 82008 Sector Geothermal energy Product The SPV was established by the municipal authority Unterhaching in order to carry out a geothermal project. Coordinates 48.066195°, 11.609048° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.066195,"lon":11.609048,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


PET 424304 2013 Exercises 1+2 of 4 17 Jan + 31 Jan 2013 1. 1kg ice at 263 K 1 kg water at 293 K. Heat Q at T = T is supplied by the surroundings.  

E-Print Network (OSTI)

. Heat Q at T = T° is supplied by the surroundings. Specific heat ice : ci = 2,14 kJ/(kgK); water cw = 4,18 kJ/(kgK) melting heat mH = 333,4 kJ/kg 2nd Law: m.sin + Qin/Tin + Sgen = dS/dt + m.sout + Qout)·cw. = 438,4 kJ (per kg) S/m = s = ci·ln(273/263) + melth / 273 + cw·ln(293/273) = 1,6 kJ/(kgK) using

Zevenhoven, Ron


Publications from Research Conducted at GP-SANS | ORNL Neutron Sciences  

NLE Websites -- All DOE Office Websites (Extended Search)

Publications from Research Conducted at GP-SANS Publications from Research Conducted at GP-SANS 2013 Publications Anovitz L. M., Cole D. R., Rother G., Allard L. F., Jackson A. J., Littrell K. C., "Diagenetic changes in macro- to nano-scale porosity in the St. Peter sandstone: an (ultra) small angle neutron scattering and backscattered electron imaging analysis", Geochimica et Cosmochimica Acta 102, 280-305 (2013). Black S. B., Chang Y., Bae C., Hickner M. A., "FTIR characterization of water-polymer interactions in superacid polymers", Journal of Physical Chemistry B 117, 16266-16274 (2013). Boukhalfa S., He L., Melnichenko Y. B., Yushin G., "Small-angle neutron scattering for in situ probing of ion adsorption inside micropores", Angewandte Chemie International Edition 52, 4618-4622 (2013).


A GP-Based Hyper-Heuristic Framework for Evolving 3-SAT Heuristics  

E-Print Network (OSTI)

.502 - - 0.560 start FLIP v v RANDOM l | IFV pro, v, v MAX SCR l [, op] | MIN SCR l [, op] MAX AGE l [, op] l ALL | IFL pro, l, l ALL USC | RAND USC | SCR Z l [, op] op TIE RAND | TIE AGE | TIE SCR pro 0 for SAT using GP-HH. MAC SCR l selects a variable from list l that by flipping will maximize the number

Fernandez, Thomas


Envelope Deglycosylation Enhances Antigenicity of HIV-1 gp41 Epitopes for Both Broad Neutralizing Antibodies and Their Unmutated Ancestor Antibodies  

E-Print Network (OSTI)

The HIV-1 gp41 envelope (Env) membrane proximal external region (MPER) is an important vaccine target that in rare subjects can elicit neutralizing antibodies. One mechanism proposed for rarity of MPER neutralizing antibody generation is lack...

Ma, Ben-Jiang; Alam, S. Munir; Go, Eden P.; Lu, Xiaozhi; Desaire, Heather; Tomaras, Georgia D.; Bowman, Cindy; Sutherland, Laura L.; Scearce, Richard M.; Santra, Sampa; Letivn, Norman L.; Kepler, Thomas B.; Liao, Hua-Xin; Haynes, Barton F.



Empirical validation of the conceptual design of the LLNL 60-kg contained-firing facility  

SciTech Connect

In anticipation of increasingly stringent environmental regulations, Lawrence Livermore National Laboratory (LLNL) is proposing to modify an existing facility to add a 60-kg firing chamber and related support areas. This modification will provide blast-effects containment for most of its open-air, high-explosive, firing operations. Even though these operations are within current environmental limits, containment of the blast effects and hazardous debris will further drastically reduce emissions to the environment and minimize the hazardous waste generated. The major design consideration of such a chamber is its overall structural dynamic response in terms of its long-term ability to contain all blast effects from repeated internal detonations of high explosives. Another concern is how much other portions of the facility outside the firing chamber must be hardened to ensure personnel protection in the event of an accidental detonation while the chamber door is open. To assess these concerns, a 1/4-scale replica model of the planned contained firing chamber was engineered, constructed, and tested with scaled explosive charges ranging from 25 to 125% of the operational explosives limit of 60 kg. From 16 detonations of high explosives, 880 resulting strains, blast pressures, and temperatures within the model were measured to provide information for the final design.

Pastrnak, J.W.; Baker, C.F.; Simmons, L.F.



The CDEX-1 1 kg Point-Contact Germanium Detector for Low Mass Dark Matter Searches  

E-Print Network (OSTI)

The CDEX Collaboration has been established for direct detection of light dark matter particles, using ultra-low energy threshold p-type point-contact germanium detectors, in China JinPing underground Laboratory (CJPL). The first 1 kg point-contact germanium detector with a sub-keV energy threshold has been tested in a passive shielding system located in CJPL. The outputs from both the point-contact p+ electrode and the outside n+ electrode make it possible to scan the lower energy range of less than 1 keV and at the same time to detect the higher energy range up to 3 MeV. The outputs from both p+ and n+ electrode may also provide a more powerful method for signal discrimination for dark matter experiment. Some key parameters, including energy resolution, dead time, decay times of internal X-rays, and system stability, have been tested and measured. The results show that the 1 kg point-contact germanium detector, together with its shielding system and electronics, can run smoothly with good performances. This...

Kang, Ke-Jun; Wu, Yu-Cheng; Cheng, Jian-Ping; Li, Yuan-Jing; Bai, Yang; Bi, Yong; Chang, Jian-Ping; Chen, Nan; Chen, Ning; Chen, Qing-Hao; Chen, Yun-Hua; Chuang, You-Chun; Dend, Zhi; Du, Qiang; Gong, Hui; Hao, Xi-Qing; He, Qing-Ju; Hu, Xin-Hui; Huang, Han-Xiong; Huang, Teng-Rui; Jiang, Hao; Li, Hau-Bin; Li, Jian-Min; Li, Jin; Li, Jun; Li, Xia; Li, Xin-Ying; Li, Xue-Qian; Li, Yu-Lan; Liao, Heng-Ye; Lin, Fong-Kay; Lin, Shin-Ted; Liu, Shu-Kui; Lv, Lan-Chun; Ma, Hao; Mao, Shao-Ji; Qin, Jian-Qiang; Ren, Jie; Ren, Jing; Ruan, Xi-Chao; Shen, Man-Bin; Singh, Lakhwinder; Singh, Manoj Kumar; Soma, Arun Kumar; Su, Jian; Tang, Chang-Jian; Tseng, Chao-Hsiung; Wang, Ji-Min; Wang, Li; Wang, Qing; Wong, Tsz-King Henry; Wu, Shi-Yong; Wu, Wei; Wu, Yu-Cheng; Xing, Hao-Yang; Xu, Yin; Xue, Tao; Yang, Li-Tao; Yang, Song-Wei; Yi, Nan; Yu, Chun-Xu; Yu, Hao; Yu, Xun-Zhen; Zeng, Xiong-Hui; Zeng, Zhi; Zhang, Lan; Zhang, Yun-Hua; Zhao, Ming-Gang; Zhao, Wei; Zhong, Su-Ning; Zhou, Zu-Ying; Zhu, Jing-Jun; Zhu, Wei-Bin; Zhu, Xue-Zhou; Zhu, Zhong-Hua



CDEX-1 1 kg point-contact germanium detector for low mass dark matter searches  

Science Journals Connector (OSTI)

The CDEX collaboration has been established for direct detection of light dark matter particles, using ultra-low energy threshold point-contact p-type germanium detectors, in China JinPing underground Laboratory (CJPL). The first 1 kg point-contact germanium detector with a sub-keV energy threshold has been tested in a passive shielding system located in CJPL. The outputs from both the point-contact P+ electrode and the outside N+ electrode make it possible to scan the lower energy range of less than 1 keV and at the same time to detect the higher energy range up to 3 MeV. The outputs from both P+ and N+ electrode may also provide a more powerful method for signal discrimination for dark matter experiment. Some key parameters, including energy resolution, dead time, decay times of internal X-rays, and system stability, have been tested and measured. The results show that the 1 kg point-contact germanium detector, together with its shielding system and electronics, can run smoothly with good performances. This detector system will be deployed for dark matter search experiments.

Kang Ke-Jun (???); Yue Qian (??); Wu Yu-Cheng (???); Cheng Jian-Ping (???); Li Yuan-Jing (???); Bai Yang (??); Bi Yong (??); Chang Jian-Ping (???); Chen Nan (??); Chen Ning (??); Chen Qing-Hao (???); Chen Yun-Hua (???); Chuang Yo-Chun (???); Deng Zhi (??); Du Qiang (??); Gong Hui (??); Hao Xi-Qing (???); He Qing-Ju (???); Hu Xin-Hui (???); Huang Han-Xiong (???); Huang Teng-Rui (???); Jiang Hao (??); Li Hau-Bin (???); Li Jian-Min (???); Li Jin (??); Li Jun (??); Li Xia (??); Li Xin-Ying (???); Li Xue-Qian (???); Li Yu-Lan (???); Liao Heng-Yi (???); Lin Fong-Kay (???); Lin Shin-Ted (???); Liu Shu-Kui (???); L Lan-Chun (???); Ma Hao (??); Mao Shao-Ji (???); Qin Jian-Qiang (???); Ren Jie (??); Ren Jing (??); Ruan Xi-Chao (???); Shen Man-Bin (???); Lakhwinder Singh; Manoj Kumar Singh; Arun Kumar Soma; Su Jian (??); Tang Chang-Jian (???); Tseng Chao-Hsiung (???); Wang Ji-Min (???); Wang Li (??); Wang Qing (??); Wong Tsz-King Henry (???); Wu Shi-Yong (???); Wu Wei (??); Wu Yu-Cheng (???); Xing Hao-Yang (???); Xu Yin (??); Xue Tao (??); Yang Li-Tao (???); Yang Song-Wei (???); Yi Nan (??); Yu Chun-Xu (???); Yu Hao (??); Yu Xun-Zhen (???); Zeng Xiong-Hui (???); Zeng Zhi (??); Zhang Lan (??); Zhang Yun-Hua (???); Zhao Ming-Gang (???); Zhao Wei (??); Zhong Su-Ning (???); Zhou Zu-Ying (???); Zhu Jing-Jun (???); Zhu Wei-Bin (???); Zhu Xue-Zhou (???); Zhu Zhong-Hua (???)



Pacific Northwest Site Office P.O. BOX 350, Kg-42  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Pacific Northwest Site Office Pacific Northwest Site Office P.O. BOX 350, Kg-42 Richland, Washington 99352 JAN 1 8 2019 MEMORANDUM FOR SCOTT B. HARRIS, GENERAL COUNSEL OFFICE OF GENERAL COUNSEL FROM: SUBJECT: GC- I , HQ JULIE K. ERlCKSON PACIFIC NORTHWEST SITE OFFICE 20 1 1 ANNUAL NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) PLANNING SUMMARY DOE 0 45 1.1B requires Secretarial Officers and Heads of Field Organizations to submit a Annual NEPA Planning Summary to the Office of General Counsel. We have consulted your December 8,201 0, memorandum, and guidance posted on the Office of NEPA Policy and Compliailce (GC-54) web site, and have no NEPA activities to report. If you have any questions, please contact me, or your staff may contact Theresa Aldridge, Operations Division, at (509) 372-4508, or Peter Siebach, Integrated Support Center - Chicago


Involvement of viral envelope GP2 in Ebola virus entry into cells expressing the macrophage galactose-type C-type lectin  

SciTech Connect

Highlights: {yields} Ebola virus infection is mediated by binding to and fusion with the target cells. {yields} Structural feature of the viral glycoprotein determines the infectivity. {yields} Surface C-type lectin, MGL, of macrophages and dendritic cells mediate the infection. {yields} GP2, one of glycoprotein subunits, plays an essential role in MGL-mediated infection. {yields} There is a critical amino acid residue involved in high infectivity. -- Abstract: Ebola virus (EBOV) infection is initiated by the interaction of the viral surface envelope glycoprotein (GP) with the binding sites on target cells. Differences in the mortality among different species of the Ebola viruses, i.e., Zaire ebolavirus (ZEBOV) and Reston ebolavirus (REBOV), correspond to the in vitro infectivity of the pseudo-typed virus constructed with the GPs in cells expressing macrophage galactose-type calcium-type lectin (MGL/CD301). Through mutagenesis of GP2, the transmembrane-anchored subunit of GP, we found that residues 502-527 of the GP2 sequence determined the different infectivity between VSV-ZEBOV GP and -REBOV GP in MGL/CD301-expressing cells and a histidine residue at position 516 of ZEBOV GP2 appeared essential in the differential infectivity. These findings may provide a clue to clarify a molecular basis of different pathogenicity among EBOV species.

Usami, Katsuaki [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Matsuno, Keita; Igarashi, Manabu [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Denda-Nagai, Kaori [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan); Takada, Ayato [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan)] [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Irimura, Tatsuro, E-mail: irimura@mol.f.u-tokyo.ac.jp [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)] [Laboratory of Cancer Biology and Molecular Immunology, Graduate School of Pharmaceutical Sciences, University of Tokyo, Tokyo 113-0033 (Japan)



The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII-hMDR1 Cells  

E-Print Network (OSTI)

The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of MDCKII ABSTRACT The human multi-drug resistance membrane transporter, P-glycoprotein, or P-gp, has been of which can prove molecular mechanisms. Determination of the elementary kinetic rate constants

Mittal, Aditya

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Unliganded HIV-1 gp120 core structures assume the CD4-bound conformation with regulation by quaternary interactions and variable loops  

SciTech Connect

The HIV-1 envelope (Env) spike (gp120{sub 3}/gp41{sub 3}) undergoes considerable structural rearrangements to mediate virus entry into cells and to evade the host immune response. Engagement of CD4, the primary human receptor, fixes a particular conformation and primes Env for entry. The CD4-bound state, however, is prone to spontaneous inactivation and susceptible to antibody neutralization. How does unliganded HIV-1 maintain CD4-binding capacity and regulate transitions to the CD4-bound state? To define this mechanistically, we determined crystal structures of unliganded core gp120 from HIV-1 clades B, C, and E. Notably, all of these unliganded HIV-1 structures resembled the CD4-bound state. Conformational fixation with ligand selection and thermodynamic analysis of full-length and core gp120 interactions revealed that the tendency of HIV-1 gp120 to adopt the CD4-bound conformation was restrained by the V1/V2- and V3-variable loops. In parallel, we determined the structure of core gp120 in complex with the small molecule, NBD-556, which specifically recognizes the CD4-bound conformation of gp120. Neutralization by NBD-556 indicated that Env spikes on primary isolates rarely assume the CD4-bound conformation spontaneously, although they could do so when quaternary restraints were loosened. Together, the results suggest that the CD4-bound conformation represents a 'ground state' for the gp120 core, with variable loop and quaternary interactions restraining unliganded gp120 from 'snapping' into this conformation. A mechanism of control involving deformations in unliganded structure from a functionally critical state (e.g., the CD4-bound state) provides advantages in terms of HIV-1 Env structural diversity and resistance to antibodies and inhibitors, while maintaining elements essential for entry.

Kwon, Young Do; Finzi, Andrs; Wu, Xueling; Dogo-Isonagie, Cajetan; Lee, Lawrence K.; Moore, Lucas R.; Schmidt, Stephen D.; Stuckey, Jonathan; Yang, Yongping; Zhou, Tongqing; Zhu, Jiang; Vicic, David A.; Debnath, Asim K.; Shapiro, Lawrence; Bewley, Carole A.; Mascola, John R.; Sodroski, Joseph G.; Kwong, Peter D. (Harvard-Med); (NIH); (Hawaii); (L.F. Kimball); (Columbia); (VCCRI); (Arkansas); (DFCI)



Milestone Report - Complete New Adsorbent Materials for Marine Testing to Demonstrate 4.5 g-U/kg Adsorbent  

SciTech Connect

This report describes work on the successful completion of Milestone M2FT-14OR03100115 (8/20/2014) entitled, Complete new adsorbent materials for marine testing to demonstrate 4.5 g-U/kg adsorbent. This effort is part of the Seawater Uranium Recovery Program, sponsored by the U.S. Department of Energy, Office of Nuclear Energy, and involved the development of new adsorbent materials at the Oak Ridge National Laboratory (ORNL) and marine testing at the Pacific Northwest National Laboratory (PNNL). ORNL has recently developed two new families of fiber adsorbents that have demonstrated uranium adsorption capacities greater than 4.5 g-U/kg adsorbent after marine testing at PNNL. One adsorbent was synthesized by radiation-induced graft polymerization of itaconic acid and acrylonitrile onto high surface area polyethylene fibers followed by amidoximation and base conditioning. This fiber showed a capacity of 4.6 g-U/kg adsorbent in marine testing at PNNL. The second adsorbent was prepared by atom-transfer radical polymerization of t-butyl acrylate and acrylonitrile onto halide-functionalized round fibers followed by amidoximation and base hydrolysis. This fiber demonstrated uranium adsorption capacity of 5.4 g-U/kg adsorbent in marine testing at PNNL.

Janke, Christopher James [ORNL; Das, Sadananda [ORNL; Oyola, Yatsandra [ORNL; Mayes, Richard T. [ORNL; Saito, Tomonori [ORNL; Brown, Suree [ORNL; Gill, Gary [PNNL; Kuo, Li-Jung [PNNL; Wood, Jordana [PNNL



The GP Patient Survey for use in primary care in the National Health Service in the UK - development and psychometric characteristics  

E-Print Network (OSTI)

Abstract Background The UK National GP Patient Survey is one of the largest ever survey programmes of patients registered to receive primary health care, inviting five million respondents to report their experience of NHS primary healthcare...

Campbell, John; Smith, Patten; Nissen, Sonja; Bower, Peter; Elliott, Marc; Roland, Martin



First Dark Matter Search Results from a 4-kg CF$_3$I Bubble Chamber Operated in a Deep Underground Site  

SciTech Connect

New data are reported from the operation of a 4.0 kg CF{sub 3}I bubble chamber in the 6800 foot deep SNOLAB underground laboratory. The effectiveness of ultrasound analysis in discriminating alpha decay background events from single nuclear recoils has been confirmed, with a lower bound of >99.3% rejection of alpha decay events. Twenty single nuclear recoil event candidates and three multiple bubble events were observed during a total exposure of 553 kg-days distributed over three different bubble nucleation thresholds. The effective exposure for single bubble recoil-like events was 437.4 kg-days. A neutron background internal to the apparatus, of known origin, is estimated to account for five single nuclear recoil events and is consistent with the observed rate of multiple bubble events. This observation provides world best direct detection constraints on WIMP-proton spin-dependent scattering for WIMP masses >20 GeV/c{sup 2} and demonstrates significant sensitivity for spin-independent interactions.

Behnke, E.; /Indiana U., South Bend; Behnke, J.; /Indiana U., South Bend; Brice, S.J.; /Fermilab; Broemmelsiek, D.; /Fermilab; Collar, J.I.; /Chicago U., EFI; Conner, A.; /Indiana U., South Bend; Cooper, P.S.; /Fermilab; Crisler, M.; /Fermilab; Dahl, C.E.; /Chicago U., EFI; Fustin, D.; /Chicago U., EFI; Grace, E.; /Indiana U., South Bend /Fermilab



Effects of sequence changes in the HIV-1 gp41 fusion peptide on CCR5 inhibitor resistance  

SciTech Connect

A rare pathway of HIV-1 resistance to small molecule CCR5 inhibitors such as Vicriviroc (VCV) involves changes solely in the gp41 fusion peptide (FP). Here, we show that the G516V change is critical to VCV resistance in PBMC and TZM-bl cells, although it must be accompanied by either M518V or F519I to have a substantial impact. Modeling VCV inhibition data from the two cell types indicated that G516V allows both double mutants to use VCV-CCR5 complexes for entry. The model further identified F519I as an independent determinant of preference for the unoccupied, high-VCV affinity form of CCR5. From inhibitor-free reversion cultures, we also identified a substitution in the inner domain of gp120, T244A, which appears to counter the resistance phenotype created by the FP substitutions. Examining the interplay of these changes will enhance our understanding of Env complex interactions that influence both HIV-1 entry and resistance to CCR5 inhibitors.

Anastassopoulou, Cleo G.; Ketas, Thomas J. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Sanders, Rogier W. [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States) [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Laboratory of Experimental Virology, Department of Medical Microbiology, Center for Infection and Immunity Amsterdam (CINIMA), Academic Medical Center of the University of Amsterdam, Amsterdam (Netherlands); Johan Klasse, Per [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)] [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States); Moore, John P., E-mail: jpm2003@med.cornell.edu [Department of Microbiology and Immunology, Weill Medical College of Cornell University, 1300 York Avenue, New York, NY 10065 (United States)



The effects of 450 kg surface explosions at the E layer of the ionosphere. Los Alamos Source Region Project  

SciTech Connect

A network of hf ionospheric sounders consisting of two transmitter and two receiver stations was deployed to detect the effects of acoustic waves generated by surface ground motion following an underground nuclear test (UGT) at the Nevada Test Site. The frequency of the transmissions were chosen so that the hf radio waves were totally reflected in the E layer of the ionosphere at an altitude of approximately 100 km. The transmissions were highly stable cw tones at two frequencies separated by 100 kHz so that two altitudes separated by approximately .5 km could be sensed. The network sampled four geographic locations in the ionosphere ranging from almost directly overhead of the UGT out to a horizontal range of 60 km. The ionospheric sounders detected disturbances on all the paths beginning at approximately 325 s after the UGT which persisted for up to 100 s. These disturbances will be described in detail in a later paper. Shortly after the UGT an extended series of ionospheric disturbances were detected which we ascribe to the arrival of acoustic shock waves at the E layer caused by the surface detonation of ordinance with effective yields of 450 kg of high explosive during an unrelated exercise conducted by the U. S. Air Force at a nearby bombing range. The conjunction of these disturbances produced a direct comparison of the effects of UGT`s and surface explosions in the ionosphere. In this paper we describe the effects produced by the surface explosions and interpret the disturbance in terms of diffraction induced by electron density changes accompanying the passage of the acoustic waves from the explosions through the reflection altitudes.

Fitzgerald, T.J.; Carlos, R.C.



Glycosyl-phosphatidylinositol (GPI)-anchored membrane association of the porcine reproductive and respiratory syndrome virus GP4 glycoprotein and its co-localization with CD163 in lipid rafts  

SciTech Connect

The porcine reproductive and respiratory syndrome virus (PRRSV) glycoprotein 4 (GP4) resembles a typical type I membrane protein in its structure but lacks a hydrophilic tail at the C-terminus, suggesting that GP4 may be a lipid-anchored membrane protein. Using the human decay-accelerating factor (DAF; CD55), a known glycosyl-phosphatidylinositol (GPI) lipid-anchored protein, chimeric constructs were made to substitute the GPI-anchor domain of DAF with the putative lipid-anchor domain of GP4, and their membrane association and lipase cleavage were determined in cells. The DAF-GP4 fusion protein was transported to the plasma membrane and was cleaved by phosphatidylinositol-specific phospholipase C (PI-PLC), indicating that the C-terminal domain of GP4 functions as a GPI anchor. Mutational studies for residues adjacent to the GPI modification site and characterization of respective mutant viruses generated from infectious cDNA clones show that the ability of GP4 for membrane association corresponded to virus viability and growth characteristics. The residues T158 ({omega} - 2, where {omega} is the GPI moiety at E160), P159 ({omega} - 1), and M162 ({omega} + 2) of GP4 were determined to be important for virus replication, with M162 being of particular importance for virus infectivity. The complete removal of the peptide-anchor domain in GP4 resulted in a complete loss of virus infectivity. The depletion of cholesterol from the plasma membrane of cells reduced the virus production, suggesting a role of lipid rafts in PRRSV infection. Remarkably, GP4 was found to co-localize with CD163 in the lipid rafts on the plasma membrane. Since CD163 has been reported as a cellular receptor for PRRSV and GP4 has been shown to interact with this receptor, our data implicates an important role of lipid rafts during entry of the virus.

Du, Yijun [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Shandong Key Laboratory of Animal Disease Control and Breeding, Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Jinan (China); Pattnaik, Asit K. [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States)] [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States); Song, Cheng [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Yoo, Dongwan, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States)] [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Li, Gang, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States) [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Institute of Animal Science and Veterinary Medicine, Chinese Academy of Agricultural Sciences, Beijing (China)



Detection of Nitrogen and Neon in the X-ray Spectrum of GP Com with XMM/Newton  

E-Print Network (OSTI)

We report on X-ray spectroscopic observations with XMM/Newton of the ultracompact, double white dwarf binary, GP Com. With the Reflection Grating Spectrometers (RGS) we detect the Lyman alpha and beta lines of hydrogen-like nitrogen (N VII) and neon (Ne X), as well as the helium-like triplets (N VI and Ne IX) of these same elements. All the emission lines are unresolved. These are the first detections of X-ray emission lines from a double-degenerate, AM CVn system. We detect the resonance (r) and intercombination (i) lines of the N VI triplet, but not the forbidden (f) line. The implied line ratios for N VI, R = f/i < 0.3, and G = (f + i)/r ~1, combined with the strong resonance line are consistent with formation in a dense, collision-dominated plasma. Both the RGS and EPIC/MOS spectra are well fit by emission from an optically thin thermal plasma (model cevmkl in XSPEC). Helium, nitrogen, oxygen and neon are required to adequately model the spectrum, however, the inclusion of sulphur and iron further improves the fit, suggesting these elements may also be present at low abundance. We confirm in the X-rays the underabundance of both carbon and oxygen relative to nitrogen, first deduced from optical spectroscopy by Marsh et al. The average X-ray luminosity of ~3e30 ergs/s implies a mass accretion rate of ~9e-13 solar masses per year. The implied temperature and density of the emitting plasma, combined with the presence of narrow emission lines are consistent with production of the X-ray emission in an optically thin boundary layer just above the surface of the white dwarf.

Tod E. Strohmayer




Gasoline and Diesel Fuel Update (EIA)

78. Domestic Refinery Distillation Base Capacity, Expansion, and Utilization (1 of 1) 78. Domestic Refinery Distillation Base Capacity, Expansion, and Utilization (1 of 1) (Million of Barrels per Day) 1998- 1998 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2020 PAD District I Base Capacity 1.6 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 0.3% Capacity Additions 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 -1.4% Total Capacity 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.7 1.8 0.2% Utilization 94.0 92.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 94.0 0.0% PAD Districts II to IV Base Capacity 11.3 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 11.6 0.1% Capacity Additions


Influence of net energy content of the diets on productive performance and carcass merit of gilts, boars and immunocastrated males slaughtered at 120kg BW  

Science Journals Connector (OSTI)

Abstract In total, 540 crossbred pigs with an initial body weight of 28.5kg were used to investigate the effects of the net energy (NE) content (2.29, 2.33, 2.37, 2.41 and 2.45 Mcal/kg) of the diet on growth performance and carcass and meat quality traits of gilts, boars and immunocastrated males (IMC). An increase in dietary NE increased NE intake and decreased feed conversion ratio linearly. The IMC pigs showed greater feed intake and average daily gain than gilts and boars. Backfat depth increased and chilled and trimmed ham yield decreased, as the dietary NE increased. Backfat depth was greater for gilts and IMC than for boars. Also, gilts had greater carcass and loin yields than boars and IMC. Diets with the greater NE content were more appropriate for the production of heavy pigs. However, the economic interest of this practice needs further assessment.

L. Cmara; J.D. Berrocoso; J.L. Snchez; C.J. Lpez-Bote; G.G. Mateos



354 J. Agric. Food Chem. 1087, 35,354-358 mg/kg. These levels as well as those of precursors of the  

E-Print Network (OSTI)

354 J. Agric. Food Chem. 1087, 35,354-358 mg/kg. These levels as well as those of precursors. Food Agric. 1972,23, 79. Figdor, S. K.; Schach von Wittenau, M.; Faulkner, J. K.; Monro, A. M. J Service, U.S.Department of Agriculture, College Station, Texas 77841 (C.E.M., G.W.I., R.J.C.), Department

Hammock, Bruce D.



E-Print Network (OSTI)

57 MANOM?TRE A PISTON LIBRE POUR LA MESURE ABSOLUE DES HAUTES PRESSIONS JUSQU'A 10000 kg cm2 ET manomètre absolu de laboratoire, à piston libre, a été réalisé avec deux équipages interchangeables d'entraînement du piston permettant soit un mouvement d'oscillation, soit un mou- vement de rotation continue du

Paris-Sud XI, Université de


Aufgabe 3-17: Ein 2 m-Tank enthlt zu Beginn Luft (RL = 0,287 kJ/kgK) im Zustand 1 (22C, 100 kPa, u1 = 210,49 kJ/kg). Der Tank ist ber ein Ventil mit einer Leitung verbunden.  

E-Print Network (OSTI)

?bung 6: Aufgabe 3-17: Ein 2 m³-Tank enthält zu Beginn Luft (RL = 0,287 kJ/kgK) im Zustand 1 (22°C, 100 kPa, u1 = 210,49 kJ/kg). Der Tank ist über ein Ventil mit einer Leitung verbunden. In dieser. Die Luft strömt solange in den Tank, bis im Tank derselbe Druck herrscht wie in der Leitung. Dann wird

Peters, Norbert


Possible physical self-asserting of the homogeneous vector potential. A testing puzzle based on a G.P. Thomson-like arrangement  

E-Print Network (OSTI)

It is suggested a testing puzzle able to reveal the self-asserting property of the homogeneous vector potential field. As pieces of the puzzle are taken three reliable entities : (i) influence of a potential vector on the de Broglie wavelength (ii) a G.P. Thomson-like experimental arrangement and (iii) a special coil designed to create a homogeneous vector potential. The alluded property is not connected with magnetic fluxes surrounded by the vector potential field lines, but it depends on the fluxes which are outside of the respective lines. Also the same property shows that in the tested case the vector potential field is uniquely defined physical quantity, free of any adjusting gauge. So the phenomenology of the suggested quantum test differs on that of macroscopic theory where the vector potential is not uniquely defined and allows a gauge adjustment. Of course that the proposed test has to be subjected to adequate experimental validation.

Spiridon Dumitru



Antibody elicited against the gp41 N-heptad repeat (NHR) coiled-coil can neutralize HIV-1 with modest potency but non-neutralizing antibodies also bind to NHR mimetics  

Science Journals Connector (OSTI)

Following CD4 receptor binding to the HIV-1 envelope spike (Env), the conserved N-heptad repeat (NHR) region of gp41 forms a coiled-coil that is a precursor to the fusion reaction. Although it has been a target of drug and vaccine design, there are few monoclonal antibody (mAb) tools with which to probe the antigenicity and immunogenicity specifically of the NHR coiled-coil. Here, we have rescued HIV-1-neutralizing anti-NHR mAbs from immune phage display libraries that were prepared (i) from b9 rabbits immunized with a previously described mimetic of the NHR coiled-coil, N35CCG-N13, and (ii) from an HIV-1 infected individual. We describe a rabbit single-chain Fv fragment (scFv), 8K8, and a human Fab, DN9, which specifically recognize NHR coiled-coils that are unoccupied by peptide corresponding to the C-heptad repeat or CHR region of gp41 (e.g. C34). The epitopes of 8K8 and DN9 were found to partially overlap with that of a previously described anti-NHR mAb, IgG D5; however, 8K8 and DN9 were much more specific than D5 for unoccupied NHR trimers. The mAbs, including a whole IgG 8K8 molecule, neutralized primary HIV-1 of clades B and C in a pseudotyped virus assay with comparable, albeit relatively modest potency. Finally, a human Fab T3 and a rabbit serum (both non-neutralizing) were able to block binding of D5 and 8K8 to a gp41 NHR mimetic, respectively, but not the neutralizing activity of these mAbs. We conclude from these results that NHR coiled-coil analogs of HIV-1 gp41 elicit many Abs during natural infection and through immunization, but that due to limited accessibility to the corresponding region on fusogenic gp41 few can neutralize. Caution is therefore required in targeting the NHR for vaccine design. Nevertheless, the mAb panel may be useful as tools for elucidating access restrictions to the NHR of gp41 and in designing potential improvements to mimetics of receptor-activated Env.

Josh D. Nelson; Heather Kinkead; Florence M. Brunel; Dan Leaman; Richard Jensen; John M. Louis; Toshiaki Maruyama; Carole A. Bewley; Katherine Bowdish; G. Marius Clore; Philip E. Dawson; Shana Frederickson; Rose G. Mage; Douglas D. Richman; Dennis R. Burton; Michael B. Zwick



4-50 A vertical piston-cylinder device is filled with water and covered with a 20-kg piston that serves as the lid. The boiling temperature of water is to be determined.  

E-Print Network (OSTI)

4-24 4-50 A vertical piston-cylinder device is filled with water and covered with a 20-kg piston in the cylinder is determined from a force balance on the piston, PA = PatmA + W W = mg Patm P or, kPa119.61 skg

Bahrami, Majid



NLE Websites -- All DOE Office Websites (Extended Search)

DOP (5-2011) DOP (5-2011) Supersedes (7-2010) issue DECLARATION of OCCUPATIONAL MEDICINE PROVIDER GENERAL INFORMATION PURPOSE All Contractors and their lower-tier subcontractors must comply with the Department of Energy's Worker Safety and Health Program regulation, 10 CFR 851, "Worker Safety and Health Program (WSHP). The WSHP enforces worker safety and health requirements including, but not limited to, standards of the Occupational Safety and Health Administration (OSHA), American National Standards Institute (ANSI) and Workers Compensation Laws as incorporated in the SNL WSHP. APPLICABILITY Contractors at all tiers which meet the applicability criteria must establish and provide comprehensive



E-Print Network (OSTI)

) work at the vehicle nameplate and configuration level · General form of model has been widely used supply side that has very realistic constraints on platform redesign cycle. · Manufacturer behavior meeting algorithms. · Current model has extensive data on conventional technology data and hybrid/ diesel


On Cipher-Dependent Related-Key Attacks in the Ideal-Cipher Model M.R. Albrecht1, P. Farshim2, K.G. Paterson2, and G.J. Watson3  

E-Print Network (OSTI)

On Cipher-Dependent Related-Key Attacks in the Ideal-Cipher Model M.R. Albrecht1, P. Farshim2, K.G. Paterson2, and G.J. Watson3 1 INRIA, Paris-Rocquencourt Center, SALSA Project UPMC Univ Paris 06, UMR 7606, Canada T2N 1N4 gjwatson@ucalgary.ca Abstract. Bellare and Kohno introduced a formal framework


MT Energie GmbH Co KG | Open Energy Information  

Open Energy Info (EERE)

Saxony, Germany Zip: 27404 Sector: Services Product: MT-Energie provides both turn-key biogas plants and related components and services. Coordinates: 53.295765, 9.27964...

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


A study of Kg/Ko values from reservoir performance  

E-Print Network (OSTI)

Dril and Production Practice (19/7) p p. 166. Rassler, G. Lep U. S. PatentM)b 2 234529352 Aprilp 19~. 1O. arch ttse Data. U. ~ Brown, G. Gep ?E(D911ibriun Ratio Data Book?, natural Ga oline Associa ion of Aue ca. 12. Calhoun, John C. , Jr. , e... Dril and Production Practice (19/7) p p. 166. Rassler, G. Lep U. S. PatentM)b 2 234529352 Aprilp 19~. 1O. arch ttse Data. U. ~ Brown, G. Gep ?E(D911ibriun Ratio Data Book?, natural Ga oline Associa ion of Aue ca. 12. Calhoun, John C. , Jr. , e...

Young, Gerald Sewall



Demonstrations: retort stand, elastic band, 0.5 kg mass  

E-Print Network (OSTI)

oscillating system. For a wave on a string, we can use E = 1/2 m 2A2 for each element of mass m and length x of a wave Standing and Travelling Waves If we pluck a long string and release it, we can see a travelling wave move off from the place where the wave was plucked. At any given point on the string, the movement

Boal, David


1Hinode Satellite Power The Hinode satellite weighs approximately 700 kg (dry) and carries 170 kg of gas for  

E-Print Network (OSTI)

for up to two years. The satellite has two solar panels (blue) that produce all of the spacecraft's power. The panels are 4 meters long and 1 meter wide, and are covered on both sides by solar cells. Problem 1 - What is the total area of the solar panels covered by solar cells in square centimeters? Problem 2 - If a solar cell


*PSD:Position Sensitive Detector GP2D12/GP2D15 Distance Measuring Sensors  

E-Print Network (OSTI)

control circuit is unnecessary. (4) Low cost Tec.U970501 (1) TVs (2) Personal computers (3) Cars (4) · In the absence of device specification sheets, SHARP takes no responsibility for any defects that may occur

Wedeward, Kevin


Dynamically polarized target for the gp2 and GpE experiments at Jefferson Lab  

We describe a dynamically polarized target that has been utilized for two electron scattering experiments in Hall A at Jefferson Lab. The primary components of the target are a new, high cooling power 4 He evaporation refrigerator, and a re-purposed, superconducting split-coil magnet. It has been used to polarize protons in irradiated NH3 at a temperature of 1 K and at fields of 2.5 and 5.0 Tesla. The performance of the target material in the electron beam under these conditions will be discussed. Maximum polarizations of 28% and 95% were obtained at those fields, respectively. To satisfy the requirements of both experiments, the magnet had to be routinely rotated between angles of 0, 6, and 90 degrees with respect to the incident electron beam. This was accomplished using a new rotating vacuum seal which permits rotations to be performed in only a few minutes.

Pierce, Joshua J. [JLAB, Newport News, VA (United States); Maxwell, James D. [MIT, Amherst, MA (United States); Badman, Toby E. [Univ. of New Hampshire, Durham, NH (United States); Brock, James D. [JLAB, Newport News, VA (United States); Carlin, Christopher R. [JLAB, Newport News, VA (United States); Crabb, Donald G. [Univ. of Virginia, Charlottesville, VA (United States); Day, Donal B. [Univ. of Virginia, Charlottesville, VA (United States); Keith, Christopher D. [JLAB, Newport News, VA (United States); Kvaltine, Nicholas D. [Univ. of Virginia, Charlottesville, VA (United States); Meekins, David G. [JLAB, Newport News, VA (United States); Mulholland, Jonathan R.L. [Univ. of Tennessee, Knoxville, TN (United States); Shields, Joshua A. [Univ. of Virginia, Charlottesville, VA (United States); Slifer, Karl J. [Univ. of New Hampshire, Durham, NH (United States)



Crustal structure of Guadeloupe Islands and the Lesser Antilles Arc from a new gravity and magnetic synthesis  

E-Print Network (OSTI)

the compilation and processing of available, on-land, airborne and marine, gravity and magnetic data acquired is associated with formations consistent with the low measured density and the underlying hydrothermal system

Paris-Sud XI, Université de


A Functional Interaction between gp41 and gp120 Is Observed for Monomeric but Not Oligomeric, Uncleaved HIV-1 Env gp140  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 40 :s453-s458. 42. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 43. Svergun, DI . 1991. Mathematical...

Miklos Guttman; Kelly K. Lee




E-Print Network (OSTI)

a gentle introduction to the process of oil exploration and production (Section 2). The data integration of future work (Section 8). 2. Oil Exploration and Production Oil exploration and production is the process to Oil Exploration and Production Tina Yu, Dave Wilkinson and Deyi Xie ChevronTexaco Information

Fernandez, Thomas


Better GP benchmarks: community survey results and proposals  

Science Journals Connector (OSTI)

We present the results of a community survey regarding genetic programming benchmark practices. Analysis shows broad consensus that improvement is needed in problem selection and experimental rigor. While views expressed in the survey dissuade us from ... Keywords: Benchmarks, Community survey, Genetic programming

David R. White; James Mcdermott; Mauro Castelli; Luca Manzoni; Brian W. Goldman; Gabriel Kronberger; Wojciech Ja?kowski; Una-May O'Reilly; Sean Luke




E-Print Network (OSTI)

..................................................................................... 11 Waste Tanks ..................................................................................................................... 11 Immobilization of Waste Contained in Underground Tanks


Monitoring gp43 Antigenemia in Paracoccidioidomycosis Patients during Therapy  

Science Journals Connector (OSTI)

...Intergroup comparisons were performed by using the Kruskal-Wallis test. RESULTS Table 1 shows the characteristics of...Microbiol. 29: 1610-1615. 29 Restrepo, A. 1966. La prueba de inmunodifusion en el diagnostico de la paracoccidioidomicosis...

Silvia Helena Marques da Silva; Flvio Queiroz-Telles; Arnaldo Lopes Colombo; Maria Heloisa Souza Lima Blotta; Jos Daniel Lopes; Zoilo Pires de Camargo



Name: Entry: Gp: 1 Indian Institute of Technology, Delhi  

E-Print Network (OSTI)

relation R #18; A#2;A is an equivalence. R = f (a; b) : f(a) = f(b) g Re exivity: for all a 2 S : (a; a) 2 Marks: 80 Q1 [8 Marks] Equivalences. Suppose f : A ! B is a total function. Prove that the following(c). By transitivity of equality, f(a) = f(c), whence (a; c) 2 R. Q2 [8+8 Marks] Partial Orders. In a partial order h

Prasad, Sanjiva


Molecular mechanisms of HIV gp120-induced neurotoxicity  

E-Print Network (OSTI)

the NMDA receptor antagonist memantine. Brain Research. 706:antagonists such as memantine (on the market) or MK801,

Medders, Kathryn Elizabeth



ORIGINAL PAPER GP challenge: evolving energy function for protein  

E-Print Network (OSTI)

different amino acids encoded in the genetic material (DNA or RNA sequence). Each amino acid includes an a-carbon carbon, oxygen and nitrogen atoms form a protein backbone. This backbone forms several repeating local structures such as alpha helices, beta sheets or loops, known as secondary structure elements (see Fig. 1

Aickelin, Uwe


Page 1 of 4 Policy GP 38 January 24, 2008  

E-Print Network (OSTI)

sustainability and environmental literacy in teaching, research, operations and outreach at colleges the ecological integrity of our grounds and employ sustainable building design and construction principles and Procedures Revision Date Revision No. Subject: Sustainability 1.0 Purpose: In adopting this policy, Simon


Merrimac Supercomputing with Stream Extended Abstract for GP2  

E-Print Network (OSTI)

units, and utilize a deep register hierarchy with high local band- width to match the bandwidth demands us to place hun- dreds of functional units on a single chip but provides limited global on for operating a small number of functional units. Graphics processors utilize the inherent parallelism

Dally, William J.


"Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data"  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" Y/N","Status","Efficiency Measure(s)/ECMs","System Type","End Use","Grid","Fed or Indian","RECs Retained","Scope","Term","Purchased","Biomass1","Biomass2","Funding Source","Fleet Strategy","Vehicle","Size","Fuel","Fleet Fund","Compliance Path","GP Status","Version","HPSB","2015 Status","Power data" "No","Identified","Advanced Metering Systems","Biomass","Excluded","Electric On-Grid","On Federal or Indian Land, On User Site",0,"Scope 1","Long-Term (> 10)","Electric Renewable Energy","Agricultural byproducts","NA","Line Item","Acquire More Fuel-Efficient Vehicles","Compressed Natural Gas (CNG)","Buses","B100","Direct","Guiding Principles","Met",2.2,"LEED® Certified","D&D in Progress","Actual"


The gray snapper, Lutjanus griseus, is a moderate-size (to 8 kg) snapper  

E-Print Network (OSTI)

- sachusetts (Sumner et al., 1911), and transforming gray snapper larvae have been caught in ichthyoplankton samples or gear types. Croker (1962), Starck and Schroeder (1970), and Rutherford et al. (1983) conducted between 1986 and 1997.Average annual landings from the south Florida area (Ft. Pierce through the Dry


Amrique latine et Carabes  

E-Print Network (OSTI)



POPULATION DENSITY, 2000 Population density measures the number  

E-Print Network (OSTI)


Columbia University

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Chapter 6 x Viscous Flow in Ducts 509 Solution: For water at 20qC, take U 998 kg/m3 and P 0.001 kg/ms. For galvanized  

E-Print Network (OSTI)

) If the flow rate is 0.4 ft3/s, what is the loss coefficient of the filter? (b) If the disk valve is wide open butterfly valve loss Kvalve | 80. The energy equation is Q 2(9.81) s (0.3% more) (a)Ans. 3 m 0.00214 s 2 V m.3], solve V 5.4 , | Obviously opening the valve has a dominant effect for this system. 6.108 The water

Bahrami, Majid


Characterization of mercury, arsenic, and selenium in the product streams of the Pacific Northwest Laboratory 6-kg retort  

SciTech Connect

The objective of this program is to determine how retorting process parameters affect the partitioning of Hg, As, Se, and Cd from raw oil shale to spent shale, shale oil, retort water, and offgas. For each of the elements, the objective of this study is to (1) determine the distribution coefficients for each product stream; (2) identify the chemical forms in water, gas, and oil streams, with particular emphasis on inorganic or organometallic species known to be or suspected of being carcinogenic, toxic, or otherwise harmful; (3) investigate the mechanism(s) responsible for mobilization into each product stream for toxic or labile chemical forms identified in item 2 are mobilized into each product stream; and (4) the effect of retorting rate, maximum retorting temperature, and retorting atmosphere on items 1 and 3. A Green River shale from Colorado and a New Albany shale from Kentucky were heated at 1 to 2/sup 0/C/min and at 10/sup 0/C/min to maximum temperatures of 500 and 750/sup 0/C under a nitrogen sweep gas. The product streams were analyzed using a variety of methods including Zeeman atomic absorption spectroscopy, microwave-induced helium plasma spectroscopy, x-ray fluorescence, instrumental neutron activation analysis, high-pressure liquid and silica gel column chromatography, and mercury cold vapor atomic absorption. The results obtained using these analytical methods indicate that the distribution of mercury, arsenic, and selenium in the product stream is a function of oil shale type, heating rates, and maximum retorting temperatures. 11 refs., 27 figs., 5 tabs.

Olsen, K.B.; Evans, J.C.; Sklarew, D.S.; Girvin, D.C.; Nelson, C.L.; Lepel, E.A.; Robertson, D.E.; Sanders, R.W.



Therapeutic Tumor Immunity Induced by Polyimmunization with Melanoma Antigens gp100 and TRP-2  

Science Journals Connector (OSTI)

...Lond.), 372: 100-103, 1994. 4 Overwijk W. W., Tsung A., Irvine K. R...Rodriguez F., Whitton J. L., Overwijk W. W., Restifo N. P., Reisfeld...Apolloni E., Ronca R., Zamboni P., Overwijk W. W., Surman D. R., Restifo N...

Sanjeev Kumar Mendiratta; Gerald Thai; Nima K. Eslahi; Nikolyn M. Thull; Majed Matar; Vincenzo Bronte; Federica Pericle



Structure and complete nucleotide sequence of the Marek's disease herpesvirus gp57-65 gene.  

Science Journals Connector (OSTI)

...His Arg Asn 1260 1270 1280 1290 1300 1310 * * * * * * CTC CTC AOC CGC ATT CCA OTA TOG OAC MT TOG ACG AA ACA AM TAT ACO TGC AOA...Ph. Ie His Sor Thr Arg Lys Ile Ph. 1500 1510 1520 1530 1540 1550 * * * * * * OAT TAT MT CTC ATT GTT ATO TAG TTG TGA TmT ATT MA...

P M Coussens; L F Velicer



GP commissioning: implications for the third Helen Dickinson1 and Robin Miller  

E-Print Network (OSTI)

(Secretary of State for Health, 2010) heralded reforms described as the `biggest upheaval of the NHS outcome focus, extended choice etc),recent reform processes have shown that during implementation be for the third sector. NHS reform and policy drivers To some extent, the recently proposed reforms

Birmingham, University of


Isolate-Specific Differences in the Conformational Dynamics and Antigenicity of HIV-1 gp120  

Science Journals Connector (OSTI)

...Appl. Crystallogr. 36 :1277-1282. 72. Petoukhov, MV , and DI Svergun. 2007. Analysis of X-ray and neutron scattering from biomacromolecular solutions. Curr. Opin. Struct. Biol. 17 :562-571. 73. Svergun, DI . 1991. Mathematical...

Thaddeus M. Davenport; Miklos Guttman; Wenjin Guo; Brad Cleveland; Maria Kahn; Shiu-Lok Hu; Kelly K. Lee



How to Draw a Straight Line Using a GP: Benchmarking Evolutionary Design Against 19th  

E-Print Network (OSTI)

Kinematic Synthesis Hod Lipson Computational Synthesis Laboratory, Mechanical & Aerospace Engineering, and Computing & Information Science, Cornell University, Ithaca NY 14850, USA hod.lipson@cornell.edu Abstract, and a number of human-competitive inventions are shown. 1 Introduction Kinematics � the science of pure motion

Fernandez, Thomas



Annual Energy Outlook 2012 (EIA)

. . . . . . . . . . . . . . . . . . . . 45 Appendix D. Derivation of Pattern Asymmetry Test Equation . . . . . . . . . . . . . . . . . 55 Tables 3.1 Gasoline Price Levels Move...


E-Print Network 3.0 - alveolar epithelial gp60 Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

of the underlying mammary mesenchyme by the presumptive mammary epithelium to establish a bulb of ... Source: Scott, Matthew - Departments of Developmental Biology, Genetics, &...


Bounding the Gaussian Process Information Gain: Applications to PAC-Bayes and GP Bandit  

E-Print Network (OSTI)

Process Information Gain 23/3/10 1 / 23 #12;PAC-Bayesian Theorems PAC-Bayesian Recipe (x, y) Datapoint does not depend on data S! Lift result to smart classifier Q(f) = Q(f; S). What's the cost? n-1 D[Q P] How does it work? Variational (Fenchel) inequality

Seeger, Matthias


E-Print Network 3.0 - african clade-a gp160 Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

in most of sub-Saharan Africa, clade E (A... conservation of the novel epitopes in HIV-1 sequences classified as having been African in origin is notable... to the gag, nef,...


Climate Change in Scotland: Impact on Mini-Hydro G.P. Harrison  

E-Print Network (OSTI)

be generated from wind, wave, biomass or small- or mini-hydro plant. Production from these resources some 300 MW is small hydro potential capable of producing energy at less than 7p/kWh (Garrad Hassan, 2001). Although many of the better sites for small and mini-hydro have already been developed

Harrison, Gareth


Author's personal copy Kaly UL and Jones GP (1998) Mangrove restoration: A potential tool for  

E-Print Network (OSTI)

, Texas, USA. Marine Ecology ­ Progress Series 151: 165­179. Mitsch WJ and Gosselink JG (2000) Wetlands-year monitoring study. Restoration Ecology 12: 29­35. Thayer GW (ed.) (1992) Restoring the Nation and Kreeger DA (eds.) (2000) Concepts and Controversies in Tidal Marsh Ecology. Dordrecht: Kluwer Academic

Langerhans, Brian


Special Publication No. 3, Ticks and Tickborne Diseases, II. Hosts, Part 2. G-P  

E-Print Network (OSTI)

.. (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella..... (1958F), 58-84) (Iraq) SPECIAL PUBLICATION NO. 3 HOSTS 499 Gazella subgutturosa. --Continued Rhipicephalus schulzei (Ushakova, G. V. , (1960A), 210-220) (Kazakhstan) Rhipicephalus turanicus (Serdyukova, G. V., (1956B), 1-122) (USSR) Gazella...

Doss, Mildred A.; Farr, Marion M.; Roach, Katharine F.; Anastos, George


World geothermal power generation in the period 2001-2005 | Open...  

Open Energy Info (EERE)

Costa Rica, France (Guadeloupe), Iceland,Indonesia, Italy1,Kenya, Mexico, Nicaragua, Russia, and the USA have increased the capacity of their powerplant installations by more...


World Geothermal Power Generation in the Period 2001-2005 | Open...  

Open Energy Info (EERE)

Costa Rica, France (Guadeloupe), Iceland, Indonesia, Italy1, Kenya, Mexico, Nicaragua, Russia, and the USA have increased the capacity of their power plant installations by more...


L'Amrique latine ou les Amriques latines Georges Couffignal  

E-Print Network (OSTI)

, le Suriname, la Guyane, la Jamaïque, la Guadeloupe, la Martinique et les mini ?tats de la Caraïbe. Au

Paris-Sud XI, Université de


14010651-6226-5013-257-124-6 OTHER ALLOCATIONS  

E-Print Network (OSTI)

FRENCH POLYNESIA BOLIVIABOLIVIA Gabon Zimbawe Sri LankaSri Lanka ArgentinaArgentina ColombieColombia Togo IndiaIndia Gabon Togo Guadeloupe Zimbawe EGYPTEGYPT TUNISIATUNISIAMOROCCOMOROCCO SENEGALSENEGAL


Proceedings World Geothermal Congress 2005 Antalya, Turkey, 24-29 April 2005  

E-Print Network (OSTI)

Proceedings World Geothermal Congress 2005 Antalya, Turkey, 24-29 April 2005 1 Geophysical Methods Applied to the Assessment of the Bouillante Geothermal Field (Guadeloupe, French West Indies) Hubert, 45064 Orléans Cedex 2, France h.fabriol@brgm.fr Keywords: geothermal exploration, Guadeloupe Island

Boyer, Edmond


Viruses: incredible nanomachines. New advances with filamentous phages  

E-Print Network (OSTI)

) resonance energy transfer gp8 Gene 8 product; the protein coded by viral gene number 8 (gp3, gp5, gp6, gp7. The technique of phage display has provided powerful methodology for identification and optimisation of ligands

Hemminga, Marcus A.

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Targeted Immunotherapy Using Reconstituted Chaperone Complexes of Heat Shock Protein 110 and Melanoma-associated Antigen gp100  

Science Journals Connector (OSTI)

...Spiess P., Nichimura M. I., Overwijk W. W., Roberts B., Restifo N. P...Immunother., 20: 15-25, 1997. 28 Overwijk W. W., Tsung A., Irvine K. R...Methods, 53: 31-40, 1992. 34 Overwijk W. W., Lee D. S., Surman D. R...

Xiang-Yang Wang; Xing Chen; Masoud H. Manjili; Elizabeth Repasky; Robert Henderson; John R. Subjeck



Binding Characteristics and Antitumor Properties of 1A10 Bispecific Antibody Recognizing gp40 and Human Transferrin Receptor  

Science Journals Connector (OSTI)

...Litwin Sylvia Hsieh-Ma Tim Shi R. Katherine Alpaugh Gregory P. Adams Ellen J. Wolf...Litwin, Sylvia Hsieh-Ma, Tim Shi, R. Katherine Alpaugh, Gregory P. Adams, Ellen J...603, 1989. 2. LoBuglio, A. F., Wheeler, R. H., Trang, J., Haynes, A...

Anne R. Amoroso; Joseph I. Clark; Samuel Litwin; Sylvia Hsieh-Ma; Tim Shi; R. Katherine Alpaugh; Gregory P. Adams; Ellen J. Wolf; David B. Ring; and Louis M. Weiner



Molecular dissection of Rauscher virus gp70 by using monoclonal antibodies: localization of acquired sequences of related envelope gene recombinants  

Science Journals Connector (OSTI)

...and reagents provided by Drs. Norman Klinman, Judy Teale, Jeffery Hubert, David Katz, Thomas Shinnick, and Gregor Sutcliffe...767-774. 22. Schaffhausen, B. S., Silver, J. E. & Benjamin, T. L. (1978) Proc. Natl. Acad. Sci. USA 75,79-83...

H L Niman; J H Elder



PAPER CATEGORY: Genetic Programming 1 Effects of Tree Size and State Number on GP-Automata Bidding Strategies  

E-Print Network (OSTI)

deregulation of the electrical transmission network, the Federal Energy Regulatory Commission (FERC) hopes a genetic algorithm (GA) to evolve bidding strategies for the electric energy market. These strategies strategies to develop. The results have been written up specifically for the electric energy market

Fernandez, Thomas


Ten years of health workforce planning in the Netherlands: a tentative evaluation of GP planning as an example  

Science Journals Connector (OSTI)

In many countries, health-care labour markets are constantly being challenged by an alternation of shortage and oversupply. Avoiding these cyclic variations is a major challenge. In the Netherlands, a workforc...

Malou Van Greuningen; Ronald S Batenburg



Do shocks always accelerate ions? W.K.M. Rice, G.P. Zank Bartol Research Institute  

E-Print Network (OSTI)

the solar wind density (top panel), flow speed (middle panel), and energetic particle pressure (lower panel by observations of energetic particle enhancements coincident with shock waves (e.g. at 5 AU ­ left panel particle peak arrival time ­ right panel of figure. 5 AU 47 AU 0.52 ­ 1.45 MeV energetic particle

Christian, Eric


K.G. Mehrotra et al. (Eds.): IEA/AIE 2011, Part II, LNAI 6704, pp. 319327, 2011. Springer-Verlag Berlin Heidelberg 2011  

E-Print Network (OSTI)

-based optimization, fuzzy logic control. 1 Introduction Optimization is one of the main objectives for almost any Theory to Fuzzy Logic Control Fuzzy sets were first introduced in 1965 by Lotfi A. Zadeh [6]. Fuzzy set-Verlag Berlin Heidelberg 2011 Fuzzy Robot Controller Tuning with Biogeography-Based Optimization George Thomas

Simon, Dan


Miller, K.G., and Snyder, S.W. (Eds.), 1997 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 150X  

E-Print Network (OSTI)

was punctuated by at least four early Mio- cene glaciations (Mi1, Mi1a, Mi1b, and Mi2 of Miller et al., 1991 (~17-15 Ma). A transient cool- ing/glaciation at ~16.5 Ma (= Mi2 of Miller et al., 1991) was fol- lowed


Miller, K.G., and Snyder, S.W. (Eds.), 1997 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 150X  

E-Print Network (OSTI)

or differential erosion. Tectonic mechanisms include faulting of crustal blocks, mobile basins with evolving arches and depo- centers, local flexural subsidence, or differential subsidence caused by sediment). However, the oxygen-isotope method can be af- fected by temperature and local salinity changes, and more


Miller, K.G., and Snyder, S.W. (Eds.), 1997 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 150X  

E-Print Network (OSTI)

ascending order. Sequence boundaries are recognized by gamma-ray log excur- sions, hiatuses on the timing and magnitudes of sea-level changes (see summary by Miller, Chapter 1, this volume). The Paleocene). They concluded that there was a good match between the cycle chart and the record of deposition in New Jersey


NAME_______________________ (1) In the figure, a uniform beam, mass M = 65 kg and length 10.0 m, is hinged at the bottom,  

E-Print Network (OSTI)

constant. (d) The moment of inertia decreases, due to the energy expended in extending the solar panels. (e its axis with angular velocity . At this point, solar panels, which spin with the satellite is unchanged when the panels are extended, the angular velocity will remain unchanged. (g) The angular momentum

Ross, Joseph


271 Ernst & Sohn Verlag fr Architektur und technische Wissenschaften GmbH & Co. KG, Berlin Bauphysik 31 (2009), Heft 5 Die Entwicklung energetisch optimierter Lftungsstrategien fr  

E-Print Network (OSTI)

of this work was to develop a flexible, object- oriented, hygrothermal model library based on the Modelica mo werden. New object-oriented hygrothermal model library for calculating hygrothermal and hygienic comfort Modellierungssprache Modelica, für die Simulation und die Analyse der Wechselwirkungen zwischen Raumklima, Bauteil


Molecular cloning of Schistosoma mansoni egg cDNA clones of importance to host immune response  

E-Print Network (OSTI)

tropical and subtropical Africa, South America, especially in Egypt, Nalagasy, Arabia, Brazil, Venezunelaf Surinam, and Guayanaf and in several Caribbean islands, including Puerto Rico, the Dominican Republic, St. Lucia, Martinique, and Guadeloupe...

Chao, Hsu



IRD/T. Jaffr IRD/M.Dukhan  

E-Print Network (OSTI)



National Aeronautics and Space Administration  

E-Print Network (OSTI)

as well as conducting mission operations and data analysis. The GP-B Telescope Photo Credit: GP-B Photo


Role of the Ectodomain of the gp41 Transmembrane Envelope Protein of Human Immunodeficiency Virus Type 1 in Late Steps of the Membrane Fusion Process  

Science Journals Connector (OSTI)

...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...human immunodeficiency virus type 1 to fusion inhibitors targeted to the...the formation or dilation of fusion pores. Two types of inhibitors of HIV-1 entry...

Sverine Br; Marc Alizon



A Plant Homolog of the Neutrophil NADPH Oxidase gp91phox Subunit Gene Encodes a Plasma Membrane Protein with Ca2+ Binding Motifs  

Science Journals Connector (OSTI)

...16-hr-light/8-hr-dark cycle or in continuous...reaction (PCR) cycles, respectively...mCi/L Amersham Life Science, Arlington...the protein blot analysis of this fraction...R.W. Rain-, wind-, and touch-induced...M. Segal A.W. Analysis of glycosylation...

Thomas Keller; Howard G. Damude; Dietrich Werner; Peter Doerner; Richard A. Dixon; Chris Lamb


Topological Analysis of HIV-1 Glycoproteins Expressed In Situ on Virus Surfaces Reveals Tighter Packing but Greater Conformational Flexibility than for Soluble gp120  

Science Journals Connector (OSTI)

...Li, Y , S O'Dell, R Wilson, X Wu, SD Schmidt...Roederer, M Connors, JR Mascola, and RT Wyatt...Zhang, SA Migueles, R Wyatt, BF Haynes, PD Kwong, JR Mascola, and M Connors...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...

Tommy Tong; Keiko Osawa; James E. Robinson; Ema T. Crooks; James M. Binley



HIV gp120 H375 Is Unique to HIV-1 Subtype CRF01_AE and Confers Strong Resistance to the Entry Inhibitor BMS-599793, a Candidate Microbicide Drug  

Science Journals Connector (OSTI)

...in silico docking simulations and assisted in...benchmarks for molecular simulation. Comp. Phys...et al. 1995. Rapid turnover of plasma...high accuracy in automated protein docking...silico drug docking simulations identified a drug...serve as a means for rapid identification of...

Susan M. Schader; Susan P. Colby-Germinario; Peter K. Quashie; Maureen Oliveira; Ruxandra-Ilinca Ibanescu; Daniela Moisi; Thibault Mesplde; Mark A. Wainberg



Detection of growth sites in and protomer pools for the sheath of Methanospirillum hungatei GP1 by use of constituent organosulfur and immunogold labeling.  

Science Journals Connector (OSTI)

...the Hg-hoops was evident (data not shown). In negative stains...alterations of the hoops (data not shown). The concentration...Research Council of Canada infrastructure grant. Advice from G. D...Immunoglobulin produc- ing hybrid cell lines, p. 351-371...

G Southam; T J Beveridge


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


miR200c Attenuates P-gpMediated MDR and Metastasis by Targeting JNK2/c-Jun Signaling Pathway in Colorectal Cancer  

Science Journals Connector (OSTI)

...encoded by the ABCB1 gene and the most characterized member of energy-dependent drug efflux pumps involved in MDR, recently has...Table S7. Quantitative RT-PCR was carried out using SYBR Green PCR Master Mix (Life Technologies). The PCR conditions were...

Hua Sui; Guo-Xiang Cai; Shu-Fang Pan; Wan-Li Deng; Yu-Wei Wang; Zhe-Sheng Chen; San-Jun Cai; Hui-Rong Zhu; and Qi Li



Clinical Evaluation of a GP5+/6+-Based Luminex Assay Having Full High-Risk Human Papillomavirus Genotyping Capability and an Internal Control  

Science Journals Connector (OSTI)

...LMNX using a sample panel and infrastructure provided by the international...HPV66 (class 2B) (1). The Hybrid Capture 2 (HC2; Qiagen...comparison of an automated hybrid capture 2 assay and the consensus...against the performance of hybrid capture 2 for the purpose of...

D. T. Geraets; K. Cuschieri; M. N. C. de Koning; L. J. van Doorn; P. J. F. Snijders; C. J. L. M. Meijer; W. G. V. Quint; M. Arbyn



Cross-Sectional Comparison of an Automated Hybrid Capture 2 Assay and the Consensus GP5+/6+ PCR Method in a Population-Based Cervical Screening Program  

Science Journals Connector (OSTI)

...requires special skills and a more stringent infrastructure to reduce PCR-related contamination...2002. Restricted cross-reactivity of hybrid capture 2 with nononcogenic human papillomavirus...Schiffman, and C. M. Wheeler. 2004. Hybrid capture 2 viral load and the 2-year...

A. T. Hesselink; N. W. J. Bulkmans; J. Berkhof; A. T. Lorincz; C. J. L. M. Meijer; P. J. F. Snijders



Mascle, J., Lohmann, G.P., and Moullade, M. (Eds.), 1998 Proceedings of the Ocean Drilling Program, Scientific Results, Vol. 159  

E-Print Network (OSTI)

basins. Warm surface water flows to the west in the South Equatorial Current system, which piles warm water against Brazil and removes it from the West Afri- can Bight, allowing cold subsurface waters over the western basins (Hay and Brock, 1992; Hisard and Merle, 1980; Peterson and Stramma, 1991


' '& ('0)1"2$3 46587@9BACACDFEHGPIRQS7UTWVYX`AaSbdcefEHGhgpiRGPD!qhrhrhq'st70GPTuA`58A`GP9BA  

E-Print Network (OSTI)

This volume contains the research papers presented at the XML Finland 2002 conference in Helsinki, Finland, October 21-22, 2002 ­ the seventh annual conference organized by the XML Finland Association. The themes before. After the previous XML Finland conference in 2001, the feedback from the XML Finland Association

Hyvönen, Eero


Cholesterol-Dependent Membrane Fusion Induced by the gp41 Membrane-Proximal External RegionTransmembrane Domain Connection Suggests a Mechanism for Broad HIV-1 Neutralization  

Science Journals Connector (OSTI)

...monitored using the resonance energy transfer assay described...pCMV8.91, encoding a green fluorescent protein and...2 (blue), 5 (green), or 10 (orange...the associated elastic energy would relax in the course...1981. Use of resonance energy transfer to monitor membrane...

Beatriz Apellniz; Edurne Rujas; Pablo Carravilla; Jos Requejo-Isidro; Nerea Huarte; Carmen Domene; Jos L. Nieva



Access of Antibody Molecules to the Conserved Coreceptor Binding Site on Glycoprotein gp120 Is Sterically Restricted on Primary Human Immunodeficiency Virus Type 1  

Science Journals Connector (OSTI)

...determined by enzyme-linked immunosorbent assay (ELISA) with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, N.Y.) and purified by affinity chromatography with protein A (Pharmacia, Uppsala...

Aran F. Labrijn; Pascal Poignard; Aarti Raja; Michael B. Zwick; Karla Delgado; Michael Franti; James Binley; Veronique Vivona; Christoph Grundner; Chih-Chin Huang; Miro Venturi; Christos J. Petropoulos; Terri Wrin; Dimiter S. Dimitrov; James Robinson; Peter D. Kwong; Richard T. Wyatt; Joseph Sodroski; Dennis R. Burton



Evaluation of the pharmacokinetics and cardiotoxicity of doxorubicin in rat receiving nilotinib  

SciTech Connect

Doxorubicin (DOX) is a potent chemotherapy drug with a narrow therapeutic window. Nilotinib, a small-molecule Bcr-Abl tyrosine kinase inhibitor, was reported to reverse multidrug resistance (MDR) mediated by P-glycoprotein (P-gp) transmembrane transporters. The present study aimed to investigate nilotinib's affection on the steady-state pharmacokinetics, disposition and cardiotoxicity of DOX. A total of 24 male SpragueDawley rats were randomized into four groups (6 in each) and received the following regimens: saline, intravenous DOX (5 mg/kg) alone, and DOX co-administrated with either 20 or 40 mg/kg nilotinib. Blood was withdrawn at 12 time points till 72 h after DOX injection and the concentrations of DOX and its metabolite doxorubicinol (DOXol) in serum and cardiac tissue were assayed by LCMSMS method. To determine the cardiotoxicity, the following parameters were investigated: creatine kinase, lactate dehydrogenase, malondialdehyde, and superoxide dismutase. Histopathological examination of heart section was carried out to evaluate the extent of cardiotoxicity after treatments. The results showed that pretreatment of 40 mg/kg nilotinib increased the AUC{sub 0t} and C{sub max} of DOX and DOXol. However, their accumulation in cardiac tissue was significantly decreased when compared with the group that received DOX alone. In addition, biochemical and histopathological results showed that 40 mg/kg nilotinib reduced the cardiotoxicity induced by DOX administration. In conclusion, co-administration of nilotinib increased serum exposure, but significantly decreased the accumulation of DOX in cardiac tissue. Consistent with in vitro profile, oral dose of 40 mg/kg nilotinib significantly decreased the cardiotoxicity of DOX in rat by enhancing P-gp activity in the heart.

Zhou, Zhi-yong [Department of Pharmacy, Affiliated Sixth People's Hospital, Shanghai Jiao Tong University, 200233 Shanghai (China); School of Pharmacy, Shanghai Jiao Tong University, 200240 Shanghai (China); Wan, Li-li; Yang, Quan-jun; Han, Yong-long; Li, Yan; Yu, Qi [Department of Pharmacy, Affiliated Sixth People's Hospital, Shanghai Jiao Tong University, 200233 Shanghai (China); Guo, Cheng, E-mail: guochengphd@yahoo.com.cn [Department of Pharmacy, Affiliated Sixth People's Hospital, Shanghai Jiao Tong University, 200233 Shanghai (China); School of Pharmacy, Shanghai Jiao Tong University, 200240 Shanghai (China); Li, Xiao, E-mail: lixiao3326@yahoo.com.cn [Department of Hematology, Affiliated Sixth people's Hospital, Shanghai Jiao Tong University, 200233 Shanghai (China)



Effects of pacing site on global and regional left ventricular function in the setting of dyssynchronous heart failure  

E-Print Network (OSTI)

Tachampa K, Ait Mou Y, Farman GP, and Irving TC. MyofilamentTachampa K, Ait Mou Y, Farman GP, and Irving TC. Myofilament

Howard, Elliot Jacob



Abstract : 148 words Text : 1654 words Tables : 3 References : 29 Pages: 12  

E-Print Network (OSTI)

of the +874 T/A IFN gamma polymorphism with infections in sickle cell disease Joannes MO1 , Loko G2 roger.chout@chu-guadeloupe.fr Keywords: sickle cell, infection, polymorphism, genetic association, cytokine Abbreviated title: IFN gamma polymorphism and sickle cell disease hal-00387081,version1-23May2009

Boyer, Edmond


Severe proliferative retinopathy is associated with blood hyperviscosity in sickle cell hemoglobin-C disease but not in sickle cell anemia  

E-Print Network (OSTI)

Severe proliferative retinopathy is associated with blood hyperviscosity in sickle cell hemoglobin-C disease but not in sickle cell anemia Clément Lemaire1 , Yann Lamarre2 , Nathalie Lemonne3 , Xavier Waltz2, Pointe à Pitre, Guadeloupe, France. Running title: Sickle cell disease and retinopathy Corresponding

Paris-Sud XI, Université de


Does increased red blood cell deformability raise the risk for osteonecrosis in sickle cell Nathalie Lemonne1  

E-Print Network (OSTI)

1 Does increased red blood cell deformability raise the risk for osteonecrosis in sickle cell Pointe-à-Pitre, 97157 Pointe-à-Pitre, Guadeloupe Running head: Avascular necrosis and sickle cell anemia in sickle cell anemia (SCA) remains unknown. Blood hyper-viscosity has been suggested as a factor involved

Paris-Sud XI, Université de


Decreased Hematocrit-To-Viscosity Ratio and Increased Lactate Dehydrogenase Level in Patients with Sickle Cell  

E-Print Network (OSTI)

with Sickle Cell Anemia and Recurrent Leg Ulcers Philippe Connes1,2,3* , Yann Lamarre1,2 , Marie-à-Pitre, Guadeloupe Abstract Leg ulcer is a disabling complication in patients with sickle cell anemia (SCA Dehydrogenase Level in Patients with Sickle Cell Anemia and Recurrent Leg Ulcers. PLoS ONE 8(11): e79680. doi:10

Paris-Sud XI, Université de


Hemorheological risk factors of acute chest syndrome and painful vaso-occlusive crisis in children with sickle cell disease  

E-Print Network (OSTI)

in children with sickle cell disease Yann Lamarre1 , Marc Romana1 , Xavier Waltz1 , Marie-Laure Lalanne Guadeloupe Running title: Blood rheology in sickle cell disease Corresponding author: Philippe Connes, Ph and painful vaso-occlusive crises in children with sickle cell anemia and hemoglobin SC disease. Design

Boyer, Edmond


IRD/T. Jaffr IRD/M.Dukhan  

E-Print Network (OSTI)

GUYANE ArgentineArgentine Gabon Zimbawe Sri LankaSri Lanka BR?SIL ColombieColombie Togo Inde SyrieSyrie Gabon Togo ?thiopie Guadeloupe Zimbawe L'IRD DANS LE MONDE #12;RAPPORT D'ACTIVIT? ?DITORIAL 2004, date


Robustness of the detection probability for the sign detector  

E-Print Network (OSTI)

). . . theta(151)]; a~1, 1); gp 1 o vera=gammaprime(1/a); gp3 overs=gammaprime(3/a); [dfda, dsdaterm, dadthta(1, 1)] ~t(a, k, fo, gp 1 overs, gp3overa); dfdahtt~umint(a, k, dfda); dpda(1, 1)=dsdaterm+dfdaint; dbdp(1, 1)~dp(a, k, fo); a~(1, 2); gp 1 overs...=gammaprime(1/a); gp3overa=gammaprinx;(3/a); [dfda, dsdaterm, dadthta(1, 2)]=faint(a, k, fo, gp 1 o vera, gp3o vera); dfdaint~umint(a, k, dfda); dpda(1, 2)=dsdaterrn+dfdaint; dbdp(1, 2)=findp(age, fo); a~(1, 31); gp 1 overs=gammaprime(1/a); gp3o vera...

Huse, Elizabeth Ann



N-Substituted Pyrrole Derivatives as Novel Human Immunodeficiency Virus Type 1 Entry Inhibitors That Interfere with the gp41 Six-Helix Bundle Formation and Block Virus Fusion  

Science Journals Connector (OSTI)

...approved peptidic human immunodeficiency virus type 1 (HIV-1) fusion inhibitor, T-20 (Fuzeon; Trimeris Inc...NB-2 and NB-64 on HIV-1-mediated cell-cell fusion Fusion type Mean inhibitory activity SD a of: NB-2 NB-64...

Shibo Jiang; Hong Lu; Shuwen Liu; Qian Zhao; Yuxian He; Asim K. Debnath



A Novel Human Cytomegalovirus Glycoprotein, gpUS9, Which Promotes Cell-to-Cell Spread in Polarized Epithelial Cells, Colocalizes with the Cytoskeletal Proteins E-Cadherin and F-Actin  

Science Journals Connector (OSTI)

...solubility. Immunofluorescence laser scanning confocal microscopy...of human fibroblasts (HF) in culture (reviewed...ARPE-19) cells by fusion of the virion envelope...Immunofluorescence laser scanning confocal microscopy...cultures of nonpolarized HF (, , ). Since a substantial...

Ekaterina Maidji; Sharof Tugizov; Gerardo Abenes; Thomas Jones; Lenore Pereira



Antibodies with High Avidity to the gp120 Envelope Protein in Protection from Simian Immunodeficiency Virus SIVmac251 Acquisition in an Immunization Regimen That Mimics the RV-144 Thai Trial  

Science Journals Connector (OSTI)

...Winkelstein, W, Jr , DM Lyman, N Padian, R Grant, M Samuel...McLaughlin, M Pascuccio, R Gopaul, J McNally, CC Cruz, N Censoplano...Li, M , F Gao, JR Mascola, L Stamatatos...E Martinelli, JP McNally, DJ Goode, R Gopaul, J Hiatt...

Poonam Pegu; Monica Vaccari; Shari Gordon; Brandon F. Keele; Melvin Doster; Yongjun Guan; Guido Ferrari; Ranajit Pal; Maria Grazia Ferrari; Stephen Whitney; Lauren Hudacik; Erik Billings; Mangala Rao; David Montefiori; Georgia Tomaras; S. Munir Alam; Claudio Fenizia; Jeffrey D. Lifson; Donald Stablein; Jim Tartaglia; Nelson Michael; Jerome Kim; David Venzon; Genoveffa Franchini


The Cytotoxic T-Lymphocyte Response against a Poorly Immunogenic Mammary Adenocarcinoma Is Focused on a Single Immunodominant Class I Epitope Derived from the gp70 Env Product of an Endogenous Retrovirus  

Science Journals Connector (OSTI)

...Kikutani H., Dranoff G., Noelle R. J., Barth R. J., Jr. Protective immunity induced by...H., Pasternack G., Cotter R., Hunt D., Pardoll D. M...Balmain A., Hickman J. A., McNally N. J., Rohas A. M., Mitchison...

Antonio Rosato; Silvia Dalla Santa; Alessia Zoso; Sofia Giacomelli; Gabriella Milan; Beatrice Macino; Valeria Tosello; Paolo Dellabona; Pier-Luigi Lollini; Carla De Giovanni; and Paola Zanovello


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...leads to a higher viral susceptibility to plasma antibodies (11). Griffithsin (Grft...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang



The Griffithsin Dimer Is Required for High-Potency Inhibition of HIV-1: Evidence for Manipulation of the Structure of gp120 as Part of the Griffithsin Dimer Mechanism  

Science Journals Connector (OSTI)

...collected at 25C on a four-channel 600-MHz Bruker Avance III spectrometer. The data...well and incubated at 37C in a 5% CO2 atmosphere for 4 h, followed by washing the wells...as a microbicide. Published ahead of print 10 June 2013 Supplemental material for...

Jie Xue; Bart Hoorelbeke; Ioannis Kagiampakis; Borries Demeler; Jan Balzarini; Patricia J. LiWang



An Affinity-Enhanced Neutralizing Antibody against the Membrane-Proximal External Region of Human Immunodeficiency Virus Type 1 gp41 Recognizes an Epitope between Those of 2F5 and 4E10  

Science Journals Connector (OSTI)

...highest production of IgG1 Z13e1, as determined using ELISA with cell culture supernatant, was chosen for scale-up in the CellCube System (Corning, Inc., Corning, NY) and purified by affinity chromatography with protein A (Pharmacia, Uppsala, Sweden...

Josh D. Nelson; Florence M. Brunel; Richard Jensen; Emma T. Crooks; Rosa M. F. Cardoso; Meng Wang; Ann Hessell; Ian A. Wilson; James M. Binley; Philip E. Dawson; Dennis R. Burton; Michael B. Zwick



A comparative salary study of professional engineers employed by Texas State and municipal governments and private industry  

E-Print Network (OSTI)

in pxivate induetrf as oosyared with the public sector ~ TASLE I NLQIkmg CjQkRTXL% k5$ mIL3 IRCOlSS CF PBGFNBSIGNkL SNSX~ XW RDgXC kg() PRXVkTE ImjM~+ ~ ST OKU6o 1$$$ LOSER &QkRTILR 7e0& $, 060 Qw e 6s9H 8g420 /APSO lip'750 7gP70 8~t+3 10' $00...glgRARY a & M COLLEGE OF lExas k 005fkmkTXVI SPLIT STOFf Of NRfNSSIQ?kl 1SaQXRQNI SKPXOISQ 1T HXLS SSkSL kSS l@SISXPAL ' SOVIS?SI?TS k15 fIXVkTS Xlg@SgRI Villkea k& 5eeer . k Cheese kgrkemleerel eeS Neeiaeekeel College ef %agee kS yerelel...

Mauer, William A



Computationally efficient Gaussian Process changepoint detection and regression  

E-Print Network (OSTI)

Most existing GP regression algorithms assume a single generative model, leading to poor performance when data are nonstationary, i.e. generated from multiple switching processes. Existing methods for GP regression over ...

Grande, Robert Conlin



I-66 I-67 I-66. Identifying the neural initiation of a movement  

E-Print Network (OSTI)

of the BG. Recordings from acute brain slices demonstrate that GP neurons expressing the calcium binding loops between the GP and striatum "closed" or "open"? COSYNE 2012 83 #12;

Shenoy, Krishna V.


Lean transformation and relocation of jet engine assembly operations  

E-Print Network (OSTI)

As part of continuing lean transformation efforts at Pratt & Whitney, the Middletown Engine Center has turned its focus on the GP7000 turbofan engine as a target for lean implementation. Projected increases in GP7000 ...

Hale, Stephen Andrew



Caribbean-NREL Cooperation | Open Energy Information  

Open Energy Info (EERE)

Anguilla, Antigua and Barbuda, Aruba, Bahamas, Barbados, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Saint Kitts and Nevis, Saint Lucia, Saint Vincent and the Grenadines, Trinidad and Tobago, Turks and Caicos Islands Anguilla, Antigua and Barbuda, Aruba, Bahamas, Barbados, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Saint Kitts and Nevis, Saint Lucia, Saint Vincent and the Grenadines, Trinidad and Tobago, Turks and Caicos Islands UN Region Latin America and the Caribbean References NREL International Program [1] Abstract The National Renewable Energy Laboratory is partnering with Caribbean nations to build Low Carbon Communities in the Caribbean as part of the broader Low Carbon Communities of the Americas program.... The National Renewable Energy Laboratory is partnering with Caribbean nations to build Low Carbon Communities in the Caribbean as part of the broader Low Carbon Communities of the Americas program. References


$1,000-$9,999 --Individuals David A. Agger '87  

E-Print Network (OSTI)

'11GP Eleanor Grosz and Lawrence J. Zweifach '69 '11P M. Loraine and Ronald P. Guritzky '85 Michael M

Napier, Terrence


Animal Studies 4.1 Introduction  

E-Print Network (OSTI)

evoked potential optimization using a GP-BUCB- like algorithm is thus a necessary condition for success

Winfree, Erik


Genomic Analysis of Burkholderia And Rhodococcus equi Bacteriophages  

E-Print Network (OSTI)

Bcep1 and the other Bcep781 phages, we can conclude that BcepNY3 is part of the Bcep781 family. 27 TABLE 8. Coding regions of BcepNY3 Gene F/R Function Homology Amino Acid BcepNY3 gp01 R Hyp. conserved Similar... to Bcep1 gp2 MPLIEGKSDKSRSENIRTEVEAGKSPKQAEAI GYAVQRRAQHGADFARDCDMNLRHVMDV AKDYKR BcepNY3 gp02 R Hyp. conserved Similar to Bcep1 gp3 MAGTLTTANSTMYCTTEALFPTAQRIQGYA ADDAFDPDAVENGEYSMGIDGTLSAGFVFN EVPLTITLQADSPSLAQFEQIWMYEFQNRTKL...

Orchard II, Robert C.



Flipping of cloned d(pCpG)n.d(pCpG)n DNA sequences from right- to left-handed helical structure by salt, Co(III), or negative supercoiling  

Science Journals Connector (OSTI)

...MATERIALS AND METHODS Plasmid Construction. The octamer d(CpGpCpGpCpGpCpG...after inactivation of ligase by heating at 650C, digested with BamHI...Spinco AnG rotor) in double-sector cells. Absorption scans at...the National Aeronautics and Space Administration. A.N. was...

L J Peck; A Nordheim; A Rich; J C Wang



Improving the Anti-HIV Potency of Different Compounds through Synergy and Covalent Linkage: Dimerization Studies of CXCL8  

E-Print Network (OSTI)

In the first part of my dissertation we focused on the development of covalently linking compounds that bind gp120 with those that bind gp41 in order to block HIV fusion. We used griffithsin or CD4M33, that both bind to gp120, covalently linked...

Kagiampakis, Ioannis



Vaccine 29 (2011) 56115622 Contents lists available at ScienceDirect  

E-Print Network (OSTI)

antiviral immunity, the RM were immunized with multimeric HIV clade C (HIV-C) gp160 and HIV Tat. SIV Gag.elsevier.com/locate/vaccine Prime­boost vaccination with heterologous live vectors encoding SIV gag and multimeric HIV-1 gp160 Replication-competent adenovirus Live oral vaccine HIV/AIDS vaccine Multimeric HIV clade C gp160 Prime

Lieberman, Judy



U.S. Energy Information Administration (EIA) Indexed Site

GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." GP117","=Part3!$D$25","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP118","=Part3!$D$23","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP125","=Part3!$D$16","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP127","=Part3!$D$17","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP130","=Part3!$D$21","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP138","=Part3!$D$26","Whole number: 0 - 100,000","Value must be between 0 and 100,000."


Topics In Primitive Roots  

E-Print Network (OSTI)

This monograph considers a few topics in the theory of primitive roots g(p) modulo a prime p>=2. A few estimates of the least primitive roots g(p) and the least prime primitive roots g^*(p) modulo p, a large prime, are determined. One of the estimate here seems to sharpen the Burgess estimate g(p) 0, to the smaller estimate g(p) 2. The expected order of magnitude is g(p) 1 constant. The corresponding estimates for least prime primitive roots g^*(p) are slightly higher. Anotrher topic deals with an effective lower bound #{p > x/log x for the number of primes p 1. The current results in the literature claim the lower bound #{p > x/(log x)^2, and have restrictions on the minimal number of fixed integers to three or more.

N. A. Carella



Structure of the Ebola Virus Glycoprotein Bound to An Antibody From a Human Survivor  

SciTech Connect

Ebola virus (EBOV) entry requires the surface glycoprotein (GP) to initiate attachment and fusion of viral and host membranes. Here we report the crystal structure of EBOV GP in its trimeric, pre-fusion conformation (GP1+GP2) bound to a neutralizing antibody, KZ52, derived from a human survivor of the 1995 Kikwit outbreak. Three GP1 viral attachment subunits assemble to form a chalice, cradled by the GP2 fusion subunits, while a novel glycan cap and projected mucin-like domain restrict access to the conserved receptor-binding site sequestered in the chalice bowl. The glycocalyx surrounding GP is likely central to immune evasion and may explain why survivors have insignificant neutralizing antibody titres. KZ52 recognizes a protein epitope at the chalice base where it clamps several regions of the pre-fusion GP2 to the amino terminus of GP1. This structure provides a template for unraveling the mechanism of EBOV GP-mediated fusion and for future immunotherapeutic development.

Lee, J.E.; Fusco, M.L.; Hessell, A.J.; Oswald, W.B.; Burton, D.R.; Saphire, E.O.



Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution in Mega Cities Sundar A. Christopher 1; J.Wang1; P. Gupta 1; M.A. Box2; and G.P. Box2  

E-Print Network (OSTI)

Satellite Remote Sensing of Air Pollution in Mega CitiesSatellite Remote Sensing of Air Pollution, consistent, and cost-effective way for monitoring air pollution. Using Terra/Aqua data, we demonstrate matter, or aerosols, reduce visibility, affect human health, and also cause several ecological effects

Wang, Jun


4/25/11 12:32 PMThe Canadian Press: Scientists searching for 'soot-print' in the Arctic; black carbon coating seen as causing melt Page 1 of 2http://www.google.com/hostednews/canadianpress/article/ALeqM5gpZC2HL9mLKe_nwaOPhaSQPdnuUg?docId=6621785  

E-Print Network (OSTI)

the atmosphere by absorbing heat from the sun, explained Quinn, who works in NOAA's Pacific Marine Environmental with Quinn, likened the process to wearing a black shirt on a sunny day. "If you want to be cooler, you would wear a light-colored shirt that would reflect t

Rigor, Ignatius G.


Induction of Antimicrobial Pathways during Early-Phase Immune Response to Salmonella spp. in Murine Macrophages: Gamma Interferon (IFN-?) and Upregulation of IFN-? Receptor Alpha Expression Are Required for NADPH Phagocytic Oxidase gp91-Stimulated Oxidative Burst and Control of Virulent Salmonella spp.  

Science Journals Connector (OSTI)

...in our J774.2 model system agrees with previous...with IFN- (E) high-power image of 14028 phoP mutant-infected...with IFN- (H) high-power image of wild-type...the reticuloendothelial system. Infect. Immun. 62...Newburger. 1990. Restoration of phagocyte function...

N. Foster; S. D. Hulme; P. A. Barrow


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Rate-decline Relations for Unconventional Reservoirs and Development of Parametric Correlations for Estimation of Reservoir Properties  

E-Print Network (OSTI)

? flow rate (qg) and cumulative production (Gp) versus production time (East Tx tight gas well numerical simulation model). ...................................................................................................... 4 1.2 (Log-log Plot): q/Gp... versus production time. Duong model and Modified Duong Model (MDNG ? 2) matches for numerical simulation case (East Tx tight gas well). ........................... 6 1.3 (Log-log Plot): K/Gp ? 1 versus production time. Modified Logistic Growth Model...

Askabe, Yohanes 1985-



On the well-posedness and scattering for the Gross-Pitaevskii hierarchy via quantum de Finetti  

E-Print Network (OSTI)

We prove the existence of scattering states for the defocusing cubic Gross-Pitaevskii (GP) hierarchy in ${\\mathbb R}^3$. Moreover, we show that an energy growth condition commonly used in the well-posedness theory of the GP hierarchy is, in a specific sense, necessary. In fact, we prove that without the latter, there exist initial data for the focusing cubic GP hierarchy for which instantaneous blowup occurs.

Thomas Chen; Christian Hainzl; Natasa Pavlovic; Robert Seiringer



QER Public Meeting in Denver, CO: Gas-Electricity Interdependencies...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force - Written Statement Joe M. Holmes,...


Quadrennial Energy Review  

Energy Savers (EERE)

Director, Marketing Services, Williams - Northwest Pipeline GP and on behalf of the Western Gas-Electric Regional Assessment Task Force * Joe M. Holmes, Lead Energy Trader,...


Interaction of lopinavir with MDR1, MRP1 and MRP2 efflux proteins  

E-Print Network (OSTI)

either by decreasing the total intracellular retention of drugs or redistributing intracellular accumulation of drugs away from target organelles. INHIBITORS USED ? MRP family transporters were selectively inhibited with MK-571, a specific... leukotriene D4 (LTD4) receptor antagonist. MK-571 specifically inhibits at least MRP1 and MRP2, but not P-gp. ? P-gp transporter was selectively inhibited with P-gp 4008, a specific inhibitor of MDR1/P-gp mediated efflux. ? Fumitremorgin-C (FC) is a...

Agarwal, Shankar; Pal, D.; Mitra, A. K.



unknown title  

E-Print Network (OSTI)

Transcription of the gene encoding melanomaassociated antigen gp100 in tissues and cell lines other than those of the melanocytic lineage

unknown authors


HIV Infection and the Central Nervous System: A Primer  

E-Print Network (OSTI)

NMDA receptor inhibition by memantine. Cell Death andopen-channel blocker memantine are ef- fective withoutand gp120: protection by memantine. Annals of Neurology, 47(

Ellis, Ronald J.; Calero, Patricia; Stockin, Michael D.



Protein, grain and sources of methionine in the nutrition of the laying hen and broiler chick  

E-Print Network (OSTI)

) supplementation (Gp. 7) produced the largest body weight gain while the diet containing only milo (Gp. 1) showed the smallest body weight gain. Hen-da Production: Birds receiving the diet with milo only (Gp, 1) laid significantly less eggs than any other.... When both FM and MHA were added to the milo and corn diets (Gps. 4 & 8) there was a significant improvement only in the group fed the milo diet (Gp. 4) when com- pared to the diets containing only corn and milo (Gps. 1 6 5). ~EW ' ht: MHA and FM...

Ernst, Herbert Lloyd



Autonomous robotic wheelchair with collision-avoidance navigation  

E-Print Network (OSTI)

range of the two GP2D12 infrared sensors as 70 cm. In Figure 5.1, we can see that the circle is the turning trajectory of the wheelchair turning at an original point. The detecting range of two GP2D12 and three GP2D15 infrared 28 sensors... signal. From some experiments and testing, we set the reaction of the robotic wheelchair in Table 5.1. There are five infrared sensors assembled on the sensor bracket. Two Sharp GP2D12 infrared sensors assembled on the right and left sides as Figure...

Hsieh, Pin-Chun



Quantitative evaluation of the effect of p-glycoprotein on oral drug absorption  

E-Print Network (OSTI)

Concentration P-gp Expression Level Affinity to P-gp Passive Membrane Permeability Cellular Accumulation Transport Experiments by using P-gp Expressing Cell Monolayers Apical Basal Caco-2 cell? MDR1-MDCK cell ? Permeability ratio Transport Rate = f ( Km, Vmax..., Ppassive ) ?Impact of P-gp on in vivo Oral Drug Absorption? Development of kinetic model that can predict the in vivo absorption of P-glycoprotein substrate drugs from in vitro data. PURPOSE 0 1.0 2.0 3.0 P e r m e a b i l i t y r a t i o ( B L t o A P...

Shirasaka, Yoshiyuki



E-Print Network 3.0 - african aids vaccine Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

with recombinant gp120 from the MN strain of HIV-1. NIAID AIDS ... Source: Gilbert, Peter - Fred Hutchinson Cancer Research Center & Department of Biostatistics,...


E-Print Network 3.0 - anti-myelin-associated glycoprotein peripheral...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 7 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...


E-Print Network 3.0 - arenavirus envelope glycoprotein Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 22 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...


E-Print Network 3.0 - axonal membrane glycoprotein Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

and Medicine 15 Supplementary Data (Supporting Online Materials) for: Cataloguing the HIV-1 Human Protein Interaction Network Summary: Envelope transmembrane glycoprotein gp41;...


A label-free differential quantitative mass spectrometry method for the characterization and identification of protein changes during citrus fruit development.  

E-Print Network (OSTI)

Like RANBP1 RANBP1b RAN3 Rho GDI GP3/ROP4 GDI1 GDI2-likeshowed that two RAB GDI (GDP-RAB dissociation inhibitors),



E-Print Network 3.0 - abc multidrug efflux Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Oak Ridge National Laboratory Fossil Energy Program Collection: Fossil Fuels 76 The Elementary Mass Action Rate Constants of P-gp Transport for a Confluent Monolayer of...


Children and adolescents deaths from trauma-related causes in a Brazilian City  

E-Print Network (OSTI)

S, Fraga GP: Fatal motorcycle crashes: a serious publicassociated with severity of motorcycle injuries among youngor train, bicycles, or motorcycles), asphyxia/ suffocation,



Caribbean-GTZ Renewable Energy Program | Open Energy Information  

Open Energy Info (EERE)

Caribbean-GTZ Renewable Energy Program Caribbean-GTZ Renewable Energy Program Jump to: navigation, search Logo: Caribbean-GTZ Renewable Energy Program Name Caribbean-GTZ Renewable Energy Program Agency/Company /Organization Deutsche Gesellschaft für Internationale Zusammenarbeit (GIZ) GmbH Partner German Federal Ministry for Economic Cooperation and Development (BMZ) Sector Energy Topics Background analysis, Policies/deployment programs Website http://www.gtz.de/en/praxis/95 Country Antigua & Barbuda, Aruba, Bahamas, Barbados, Cayman Islands, Cuba, Dominica, Dominican Republic, Grenada, Guadeloupe, Haiti, Jamaica, Martinique, Puerto Rico, Saint Barthelemy, St. Kitts & Nevis, St. Lucia, St. Vincent and the Grenadines, Trinidad & Tobago, Turks & Caicos Islands, United States


Monitoring-based HVAC Commissioning of an Existing Office Building for Energy Efficiciency  

E-Print Network (OSTI)

GP-21, and GP-23) and three boilers (BR3, BR4 and BR5); thefan BL1 during unoccupied hours 4.2 Boiler performance Thereare three main boilers, labeled as BR3, BR4, and BR5, in the

Wang, Liping



Antibody-mediated neutralization of Ebola virus can occur by two distinct mechanisms  

SciTech Connect

Human Ebola virus causes severe hemorrhagic fever disease with high mortality and there is no vaccine or treatment. Antibodies in survivors occur early, are sustained, and can delay infection when transferred into nonhuman primates. Monoclonal antibodies (mAbs) from survivors exhibit potent neutralizing activity in vitro and are protective in rodents. To better understand targets and mechanisms of neutralization, we investigated a panel of mAbs shown previously to react with the envelope glycoprotein (GP). While one non-neutralizing mAb recognized a GP epitope in the nonessential mucin-like domain, the rest were specific for GP1, were neutralizing, and could be further distinguished by reactivity with secreted GP. We show that survivor antibodies, human KZ52 and monkey JP3K11, were specific for conformation-dependent epitopes comprising residues in GP1 and GP2 and that neutralization occurred by two distinct mechanisms; KZ52 inhibited cathepsin cleavage of GP whereas JP3K11 recognized the cleaved, fusion-active form of GP.

Shedlock, Devon J., E-mail: shedlock@mail.med.upenn.ed [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Bailey, Michael A., E-mail: mike.bailey@taurigroup.co [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Popernack, Paul M. [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States); Cunningham, James M. [Department of Medicine, Brigham and Women's Hospital and Harvard Medical School, Boston, MA 02115 (United States); Burton, Dennis R. [Department of Immunology, Scripps Research Institute, La Jolla, CA 92037 (United States); Department of Molecular Biology, Scripps Research Institute, La Jolla, CA 92037 (United States); Sullivan, Nancy J., E-mail: nsullivan@nih.go [Biodefense Research Section, Vaccine Research Center, National Institute for Allergy and Infectious Disease, National Institutes of Health, 40 Convent Drive, MSC 3005, Bethesda, MD 20814 (United States)


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Ebola virus-like particles produced in insect cells exhibit dendritic cell stimulating activity and induce neutralizing antibodies  

SciTech Connect

Recombinant baculoviruses (rBV) expressing Ebola virus VP40 (rBV-VP40) or GP (rBV-GP) proteins were generated. Infection of Sf9 insect cells by rBV-VP40 led to assembly and budding of filamentous particles from the cell surface as shown by electron microscopy. Ebola virus-like particles (VLPs) were produced by coinfection of Sf9 cells with rBV-VP40 and rBV-GP, and incorporation of Ebola GP into VLPs was demonstrated by SDS-PAGE and Western blot analysis. Recombinant baculovirus infection of insect cells yielded high levels of VLPs, which were shown to stimulate cytokine secretion from human dendritic cells similar to VLPs produced in mammalian cells. The immunogenicity of Ebola VLPs produced in insect cells was evaluated by immunization of mice. Analysis of antibody responses showed that most of the GP-specific antibodies were of the IgG2a subtype, while no significant level of IgG1 subtype antibodies specific for GP was induced, indicating the induction of a Th1-biased immune response. Furthermore, sera from Ebola VLP immunized mice were able to block infection by Ebola GP pseudotyped HIV virus in a single round infection assay, indicating that a neutralizing antibody against the Ebola GP protein was induced. These results show that production of Ebola VLPs in insect cells using recombinant baculoviruses represents a promising approach for vaccine development against Ebola virus infection.

Ye Ling [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lin Jianguo [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Sun Yuliang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bennouna, Soumaya [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lo, Michael [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Wu Qingyang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bu Zhigao [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Pulendran, Bali [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Compans, Richard W. [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: compans@microbio.emory.edu; Yang Chinglai [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: chyang@emory.edu



A replication-deficient rabies virus vaccine expressing Ebola virus glycoprotein is highly attenuated for neurovirulence  

SciTech Connect

We are developing inactivated and live-attenuated rabies virus (RABV) vaccines expressing Ebola virus (EBOV) glycoprotein for use in humans and endangered wildlife, respectively. Here, we further characterize the pathogenesis of the live-attenuated RABV/EBOV vaccine candidates in mice in an effort to define their growth properties and potential for safety. RABV vaccines expressing GP (RV-GP) or a replication-deficient derivative with a deletion of the RABV G gene (RV{Delta}G-GP) are both avirulent after intracerebral inoculation of adult mice. Furthermore, RV{Delta}G-GP is completely avirulent upon intracerebral inoculation of suckling mice unlike parental RABV vaccine or RV-GP. Analysis of RV{Delta}G-GP in the brain by quantitative PCR, determination of virus titer, and immunohistochemistry indicated greatly restricted virus replication. In summary, our findings indicate that RV-GP retains the attenuation phenotype of the live-attenuated RABV vaccine, and RV{Delta}G-GP would appear to be an even safer alternative for use in wildlife or consideration for human use.

Papaneri, Amy B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)] [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Wirblich, Christoph [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States)] [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Cann, Jennifer A.; Cooper, Kurt [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States)] [Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Jahrling, Peter B. [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States) [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States); Integrated Research Facility, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick MD, 21702 (United States); Schnell, Matthias J., E-mail: matthias.schnell@jefferson.edu [Department of Microbiology and Immunology, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Jefferson Vaccine Center, Jefferson Medical College, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Blaney, Joseph E., E-mail: jblaney@niaid.nih.gov [Emerging Viral Pathogens Section, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Fort Detrick, MD 21702 (United States)



Ebola Virus Glycoproteins Induce Global Surface Protein Down-Modulation and Loss of Cell Adherence  

Science Journals Connector (OSTI)

ARTICLE PATHOGENESIS AND IMMUNITY Ebola Virus Glycoproteins Induce Global Surface...Philadelphia, Pennsylvania 19104-6076 The Ebola virus envelope glycoprotein (GP) derived...rounding and detachment in 293T cells, Ebola virus GP did not cause an increase in cell...

Graham Simmons; Rouven J. Wool-Lewis; Frdric Baribaud; Robert C. Netter; Paul Bates



A simple approach to lifetime learning in genetic programming-based symbolic regression  

Science Journals Connector (OSTI)

Genetic programming GP coarsely models natural evolution to evolve computer programs. Unlike in nature, where individuals can often improve their fitness through lifetime experience, the fitness of GP individuals generally does not change during their ... Keywords: Genetic programming, hybrid genetic algorithms, lifetime learning, local search, memetic algorithms, symbolic regression

Raja Muhammad Atif Azad; Conor Ryan



Characterization and Optimization of the Glucan Particle-Based Vaccine Platform  

Science Journals Connector (OSTI)

...GPs, suggesting that the GP platform acts as both an adjuvant and...make an effective vaccine platform that combines adjuvanticity...particle (GP)-based vaccine platform (2). GPs are derived from...Administration. MATERIALS AND METHODS Chemicals and cell culture media. Chemical...

Haibin Huang; Gary R. Ostroff; Chrono K. Lee; Charles A. Specht; Stuart M. Levitz




E-Print Network (OSTI)

small-scale heterogeneity. This research develops an upscaling method based on genetic programming (GP), which facilitates both the GP search and the implementation of the resulting models, and demonstrates and control (QA/QC), focused data collection, and event detection. The second portion of this dissertation

Fernandez, Thomas


Phenethyl Isothiocyanate (PEITC) Decreases Specficity Protein (SP) Tanscription Factors through an ROS-dependent Mechanism  

E-Print Network (OSTI)

.................................................................. 8 Gp|{ocvke"ogejcpkuou0............................................................... 8 Pqp/gp|{ocvke"ogejcpkuou....................................................... 10 Positive roles of ROS... rise to ROS involves the addition of two more electrons following the decay of peroxycytochrome P450 resulting in the release of the second oxygen atom in the form of water [20]. A schematic representation of ROS production by CYPs is illustrated...

Guthrie, Aaron S 1987-



Responding to symptoms suggestive of lung cancer: a qualitative interview study  

E-Print Network (OSTI)

the GP two or more times before referral, during this period they reinterpreted initial symptoms and appraised new symptoms. The meaning given to symptoms changed over time and many became increasingly concerned they may have lung cancer. The GP played a...

Birt, Linda; Hall, Nicky; Emery, Jon; Banks, Jon; Mills, Katie; Johnson, Margaret; Hamilton, Willie; Walter, Fiona M.



Radiative corrections to lepton-lepton scattering Physik-Department T39, Technische Universitat Munchen, D-85747 Garching, Germany  

E-Print Network (OSTI)

the tree diagrams and the one-loop diagrams. Infrared finiteness of these virtual radiative corrections is achieved (in the standard way) by including soft photon radiation below an energy cut-off . We evaluate discrepancies for the ratio of the proton electric and magnetic form factors Gp E/Gp M as determined

Weise, Wolfram


Direct estimation of gas reserves using production data  

E-Print Network (OSTI)

Virginia Well A (Fetkovich, et al.8): qg versus t ............................................................ 36 4.2 West Virginia Well A (Fetkovich, et al.8): qg versus t and pwf versus t ? Production History Plot... ................................................................................... 36 4.3 West Virginia Well A (Fetkovich, et al.8): Gp versus t ........................................................... 37 4.4 West Virginia Well A (Fetkovich, et al.8): qg versus Gp ......................................................... 38...

Buba, Ibrahim Muhammad



Experimental infection with Treponema hyodysenteriae in guinea pigs.  

Science Journals Connector (OSTI)

...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...limited mainly to the large intestine. TP used as controls or inoculated with nonpathogenic...odysenteriae, except in GP inoculated with iso- late B282 and in 16-week-old GP inoculated...

L A Joens; J G Songer; D L Harris; R D Glock



Regional Drinking Water Security Action research, policy and analysis  

E-Print Network (OSTI)

/ 21 #12;Mograj/Tembhre GP level study and data analysis The Question : Why do stressed villages GP level study and data analysis () December 18, 2012 13 / 21 #12;North Karjat rural regional scheme for Technology Alternatives for Rural Areas, GISE (CSE) IIT-Bombay www.ctara.iitb.ac.in () December 18, 2012 1

Sohoni, Milind


Turing Completeness in the Language of Genetic Programming with Indexed Memory  

E-Print Network (OSTI)

Turing Completeness in the Language of Genetic Programming with Indexed Memory Astro Teller GP is combined with the technique of indexed memory, the resulting system is Turing complete little familiarity with either GP or indexed memory. A complete introduction to the topic of traditional

Fernandez, Thomas



U.S. Energy Information Administration (EIA) Indexed Site

BS220","='Parts1-3'!$P$40" BS220","='Parts1-3'!$P$40" "_BS243","='Parts1-3'!$P$36" "_BS247","='Parts1-3'!$P$39" "_BS248","='Parts1-3'!$P$37" "_BS249","='Parts1-3'!$P$38" "_ES220","='Parts1-3'!$X$40" "_ES243","='Parts1-3'!$X$36" "_ES247","='Parts1-3'!$X$39" "_ES248","='Parts1-3'!$X$37" "_ES249","='Parts1-3'!$X$38" "_GP220","='Parts1-3'!$U$40" "_GP243","='Parts1-3'!$U$36" "_GP247","='Parts1-3'!$U$39" "_GP248","='Parts1-3'!$U$37" "_GP249","='Parts1-3'!$U$38" "_GR220","='Parts1-3'!$S$40"


Phenylalanines at positions 88 and 159 of Ebolavirus envelope glycoprotein differentially impact envelope function  

SciTech Connect

The envelope glycoprotein (GP) of Ebolavirus (EBOV) mediates viral entry into host cells. Through mutagenesis, we and other groups reported that two phenylalanines at positions 88 and 159 of GP are critical for viral entry. However, it remains elusive which steps of viral entry are impaired by F88 or F159 mutations and how. In this study, we further characterized these two phenylalanines through mutagenesis and examined the impact on GP expression, function, and structure. Our data suggest that F159 plays an indirect role in viral entry by maintaining EBOV GP's overall structure. In contrast, we did not detect any evidence for conformational differences in GP with F88 mutations. The data suggest that F88 influences viral entry during a step after cathepsin processing, presumably impacting viral fusion.

Ou Wu; King, Harlan; Delisle, Josie [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States); Shi Dashuang [Research Center for Genetic Medicine, Children's National Medical Center, George Washington University, Washington, D. C. 20010 (United States); Wilson, Carolyn A., E-mail: carolyn.wilson@fda.hhs.go [Division of Cellular and Gene Therapies, Center for Biologics Evaluation and Research, FDA, Bldg. 29B, Room 5NN22, 8800 Rockville Pike, Bethesda, MD 20892 (United States)



Development of monitoring and control technology based on trace gas monitoring. Final report  

SciTech Connect

Trace gases are generated by many biological reactions. During anaerobic decomposition, trace levels of hydrogen (H{sub 2}) and carbon monoxide (CO) gases are produced. It was shown previously that these trace gases are intrinsically related to the biochemical reactions occurring and, therefore, offer promise for on-line process monitoring and control. This work was designed to test how effectively hydrogen and CO could be to monitor high-rate anaerobic systems that has significant mass transfer and complex hydraulics. An experimental program was designed to examine the behavior of an upflow anaerobic sludge blanket (UASB) reactor system under steady state and in response to organic loading perturbations. The responses of trace gases CO and H{sub 2} were tracked using an on-line, real-time gas-monitoring system linked to a computer-controlled data acquisition package. Data on conventional process parameters such as pH, chemical oxygen demand (COD), volatile fatty acids (VFAs) were concurrently collected. Monitoring of conventional process indicators (i.e., pH, VFA, gas production) and trace gas (H{sub 2} and CO) indicators was conducted using a matrix of nine different steady-state OLRs (4-23 kg COD/m{sup 3} -d) and system HRTs (0.5 to 2.5 days) was performed to determine any correlation among the indicators. Of OLR, HRT, and influent COD, only OLR had any significant influence on the process indicators examined. All parameters except methane increased with increases in OLR; methane decreased with increased OLR. The OLR and gas production rate (GP) were observed to be linearly correlated.

Liebowitz, B.



LEDSGP/join | Open Energy Information  

Open Energy Info (EERE)

LEDSGP/join LEDSGP/join < LEDSGP Jump to: navigation, search redirect [1] LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us Join Us: Participate in the Partnership There are many ways for you to participate in the LEDS Global Partnership. Become a Member - Instantly build your network In order to become a member and join more than 100 organizations already contributing to the Partnership, please review the LEDS GP operating principles and contact us to us to let us know if you accept these principles. After you contact us noting your acceptance of these principles, we will add you to the LEDS GP distribution list to receive information on LEDS GP activities. We encourage you to join the LEDS GP


PlaNet: Combined Sequence and Expression Comparisons across Plant Networks Derived from Seven Species  

Science Journals Connector (OSTI)

...M. , Usadel, B., Schutte, M., Loraine, A., Ebenhoh, O., and Persson...Mehta, T., Coulibaly, I., and Loraine, A.E. (2008). CressExpress: A...Page, G.P., Somerville, C., and Loraine, A. (2006). Transcriptional coordination...

Marek Mutwil; Sebastian Klie; Takayuki Tohge; Federico M. Giorgi; Olivia Wilkins; Malcolm M. Campbell; Alisdair R. Fernie; Björn Usadel; Zoran Nikoloski; Staffan Persson



Ebola virus RNA editing:Characterization of the mechanism and gene products.  

E-Print Network (OSTI)

??Ebola virus (EBOV) is an enveloped, negative-sense single-stranded RNA virus that causes severe hemorrhagic fever in humans and nonhuman primates. The EBOV glycoprotein (GP) gene (more)

Mehedi, Masfique



Full-length Ebola glycoprotein accumulates in the endoplasmic reticulum  

Science Journals Connector (OSTI)

The Filoviridae family comprises of Ebola and Marburg viruses, which are known to ... pathogens. The envelope glycoprotein (GP) of Ebola virus, which mediates entry into target cells ... with full-length and muci...

Suchita Bhattacharyya; Thomas J Hope


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Science Journals Connector (OSTI)

......GENERAL PURPOSE HYDROGEN GENERATOR Model 250 GP general purpose hydro- gen generator for laboratory use is...dew point of 0 C at atmospheric pressure for chromato...prevent damage to the generator from low water or excess hydrogen demand......

New Products



The role of ATP release and autocrine/paracrine P1/P2 receptor signaling in the modulation of neutrophil chemotaxis  

E-Print Network (OSTI)

DA, Beitz LO, Li Z, Lin S, Gout I, Cantley LC, Rawlings DJ,S, Dahl GP. PROBENECID, A GOUT REMEDY, INHIBITS PANNEXIN 1for the treatment of gout, can block pannexin channels (4).

Corriden, Ross



Sustainable Energy Research Team publications Whittaker, C., Adams, P., McManus, M.C Securing a Bioenergy Supply: UK and US in  

E-Print Network (OSTI)

.C Securing a Bioenergy Supply: UK and US in Perspectives on Biofuels: Potential Benefits and Possible, G.P. McManus, M.C. and Mezzullo, W. G, 2011. Barriers to and drivers for UK bioenergy development

Martin, Ralph R.


Structure and stability of Co(II)-complexes formed by wild-type and metal-ligand substitution mutants of T4 gene 32 protein  

E-Print Network (OSTI)

Phage T4 gene 32 protein (gp32) is a zinc metalloprotein that binds cooperatively and preferentially to single-stranded nucleic acids and functions as a replication and recombination accessory protein. We have previously shown that the ZN...

Guo, Juqian



Functional expression of P-glycoprotein in primary cultures of human cytotrophoblasts and BeWo cells  

E-Print Network (OSTI)

The objective of this study was to investigate the functional expression of the efflux transporter, P-glycoprotein (P-gp), in primary cultures of human cytotrophoblasts and BeWo cell monolayers. Uptake studies with primary ...

Utoguchi, Naoki; Chandorkar, Gurudatt A.; Avery, Michael; Audus, Kenneth L.



e-journal: Information Technology for Economics & Management  

E-Print Network (OSTI)

as inputs into the 2SLS system of equations. GP is a computerized search algorithm that identifies equations and fuel oil. Lien and Root (1999) estimate a persistence profile of impulse response in natural gas

Fernandez, Thomas


The waiting room: vector for health education? the general practitioners point of view  

Science Journals Connector (OSTI)

In the present study, we examined use of the GPs waiting room as a vector for the dissemination of health information. Most waiting rooms have a number of posters on display. Posters are widely used for health p...

Maxine Gignon; Hadjila Idris; Cecile Manaouil; Oliver Ganry



Environmental Performance Report 2011: Annual Site Environmental...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Announcement FTLB-Field Test Laboratory Building FY-Fiscal Year GHG-Greenhouse Gas GP-Guiding Principles GWP-Global Warming Potential HAP-Hazardous Air Pollutant...


Structural Basis for Broad and Potent Neutralization of HIV-1 by Antibody VRC01  

SciTech Connect

During HIV-1 infection, antibodies are generated against the region of the viral gp120 envelope glycoprotein that binds CD4, the primary receptor for HIV-1. Among these antibodies, VRC01 achieves broad neutralization of diverse viral strains. We determined the crystal structure of VRC01 in complex with a human immunodeficiency virus HIV-1 gp120 core. VRC01 partially mimics CD4 interaction with gp120. A shift from the CD4-defined orientation, however, focuses VRC01 onto the vulnerable site of initial CD4 attachment, allowing it to overcome the glycan and conformational masking that diminishes the neutralization potency of most CD4-binding-site antibodies. To achieve this recognition, VRC01 contacts gp120 mainly through immunoglobulin V-gene regions substantially altered from their genomic precursors. Partial receptor mimicry and extensive affinity maturation thus facilitate neutralization of HIV-1 by natural human antibodies.

Zhou, Tongqing; Georgiev, Ivelin; Wu, Xueling; Yang, Zhi-Yong; Dai, Kaifan; Finzi, Andrs; Kwon, Young Do; Scheid, Johannes F.; Shi, Wei; Xu, Ling; Yang, Yongping; Zhu, Jiang; Nussenzweig, Michel C.; Sodroski, Joseph; Shapiro, Lawrence; Nabel, Gary J.; Mascola, John R.; Kwong, Peter D. (NIH); (Rockefeller); (DFCI)



H-Bridge H-Bridge Relay Differentiator  

E-Print Network (OSTI)

H-Bridge H-Bridge Relay Altera PLD LP Filter LP Filter Differentiator w/LP Filter Differentiator w Supply Voltage Motor H-Bridge Connection Motor Relay Connection FREQ_OUT External Power Supply GP2D12

Wedeward, Kevin


Ympristystvllisen katteen suunnittelu shkautoon.  

E-Print Network (OSTI)

??Tss opinnytetyss suunnittelin ympristystvlliset shkauton katteet Saimaan ammattikorkeakoululle. Autoa suunnitteli yhteistyss kanssani kaksi muuta opiskelijaa. Shkauton oli tarkoitus kisata Lappeenranta GPtapahtumassa jrjestetyss Joulella pisimmllekisassa. Tyss (more)

Friman, Chris



September 2013 Most Viewed Documents for Renewable Energy Sources...  

Office of Scientific and Technical Information (OSTI)

Corey, G.P. (1996) 76 > PROPERTIES AND PERFORMANCE OF CEMENT-BASED GROUTS FOR GEOTHERMAL HEAT PUMP APPLICATIONS. ALLAN,M.L. (1999) 70 > Solar radiation data manual for flat-plate...


Hamilton Paths in Generalized Petersen Graphs.  

E-Print Network (OSTI)

??This thesis puts forward the conjecture that for n > 3k with k > 2, the generalized Petersen graph, GP(n,k) is Hamilton-laceable if n is (more)

Pensaert, William



E-Print Network 3.0 - androgen-repressed human prostate Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Rosenthal, H., Chu, T.M., Mirand, E.A., Murphy, G.P., 1983. LNCaP model of ... Source: Brand, Paul H. - Department of Physiology and Pharmacology, University of Toledo...


E-Print Network 3.0 - ani edenes indian Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

parameters to be statically tuned... be written both in the explicitly parallel Eden 2, and in the implicitly parallel GpH 3, developed new... could be parallelized using...



Science Journals Connector (OSTI)


Gilbert F. White



Consumption-based accounting of CO2 emissions  

E-Print Network (OSTI)

intensity of GDP (energy per unit GDP) and the carbonand per- capita GDP, but also by unanticipated global increases in the energyg = G/P is per-capita GDP, e = E/G is energy intensity of

Davis, S. J; Caldeira, K.



Improving WRF-ARW Wind Speed Predictions using Genetic Programming  

Science Journals Connector (OSTI)

Numerical weather prediction models can produce wind speed forecasts at a very high space resolution. ... that GP is able to successfully downscale the wind speed predictions, reducing significantly the inherent ...

Giovanna Martinez-Arellano; Lars Nolle



A comparison of selection and breeding strategies for incorporating wood properties into a loblolly pine (Pinus taeda L.) elite population breeding program  

E-Print Network (OSTI)

at 23 Table 2. Range of full-sib family means (with standard deviations) for wood quality and growth traits in loblolly pine. GP065 GP258 Earlywood 4 MFAa 38.8 3.2 to 43.7 3.3 37.0 3.9 to 41.8 4.7 Latewood 4 MFA 39... at 23 Table 2. Range of full-sib family means (with standard deviations) for wood quality and growth traits in loblolly pine. GP065 GP258 Earlywood 4 MFAa 38.8 3.2 to 43.7 3.3 37.0 3.9 to 41.8 4.7 Latewood 4 MFA 39...

Myszewski, Jennifer Helen



Valediction Immunocontraception From Romance to Reality  

Science Journals Connector (OSTI)

One of Dr. G.P. Talwars Dramatis Personnae is a male baboon by the name of Hanuman, who successfully inseminated a female baboon by the name of Radha soon after successful termination of a previous pregnancy ind...

V. Ramalingaswami


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


) &%102435768!9@ 0A BDCFE!GIHQPSRUTFVWHQE!X`Ybadcfehgdiqpa7CFE4r GIs7Vtc7i!ubaGwvSHQaEWHQadci@CFEWxy8GIsQTFabVWHQE!CFadc  

E-Print Network (OSTI)

!GIHQPSRUTFVWHQE!X`Ybadcfehgdiqp¤a7CFE4r GIs7Vtc7i!uba§GwvSHQa§EWHQadci@CFEWxy8GIsQTFabVWHQE!CFadc cGP7CFE4©1HQ p

Cohen-Or, Daniel


Monitoring and Verification Procedures Used in the Texas LoanSTAR and Rebuild America Programs  

E-Print Network (OSTI)

Department of Energy's (USDOE's) 1996 NEMVP, 1997 IPMVP, 2001 IPMVP, ASHRAE's GP 14P, and the 1999 Texas Performance Contracting Guidelines. This paper reviews the basic procedures that are used for monitoring and verifying energy savings in commercial...

Farouz, S.; Baltazar-Cervantes, J. C.; Haberl, J. S.; Claridge, D. E.



Green Solar | Open Energy Information  

Open Energy Info (EERE)

Solar Solar Place Paris, France Zip 45003 Product Develops and builds PV systems in Guadeloupe and Mauritius. Coordinates 48.85693°, 2.3412° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.85693,"lon":2.3412,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


The Risk Assessment Information System  

NLE Websites -- All DOE Office Websites (Extended Search)

RAIS User's Group RAIS User's Group The connection is no longer here Fill out the following section for addition to the RAIS User's List: CONTACT DETAILS First name: * Required Last name: * Required Company: Street: City: State: Country: Anguilla Antigua and Barbuda Aruba Bahamas Barbados Belize Bermuda Virgin Islands, British Canada Cayman Islands Costa Rica Cuba Dominica Dominican Republic El Salvador Falkland Islands (Malvinas) Greenland Grenada Guadeloupe Guatemala Haiti Honduras Jamaica Martinique Mexico Montserrat Netherlands Antilles Nicaragua Panama Puerto Rico Saint Kitts and Nevis Saint Lucia Saint Pierre and Miquelon Saint Vincent and The Grenadines Trinidad and Tobago Turks and Caicos Islands United States United States Minor Outlying Islands Virgin Islands, U.S. Argentina Bolivia


Bringing simulation to implementation: Presentation of a global approach in the design of passive solar buildings under humid tropical climates  

E-Print Network (OSTI)

In early 1995, a DSM pilot initiative has been launched in the French islands of Guadeloupe and Reunion through a partnership between several public and private partners (the French Public Utility EDF, the University of Reunion Island, low cost housing companies, architects, energy consultants, etc...) to set up standards to improve thermal design of new residential buildings in tropical climates. This partnership led to defining optimized bio-climatic urban planning and architectural designs featuring the use of passive cooling architectural principles (solar shading, natural ventilation) and components, as well as energy efficient systems and technologies. The design and sizing of each architectural component on internal thermal comfort in building has been assessed with a validated thermal and airflow building simulation software (CODYRUN). These technical specifications have been edited in a reference document which has been used to build over 300 new pilot dwellings through the years 1996-1998 in Reunion...

Garde, Franois; Celaire, Robert



An Integrated Hydrogen Vision for California  

E-Print Network (OSTI)

for California Gasifier 24,000 kg/day Medium $5.08/kg ($Pyrolysis Gasifier Not specified 22,737 kg/day Medium 75,790



Final Report: Assessment of Combined Heat and Power Premium Power Applications in California  

E-Print Network (OSTI)

Gas (kg) Annual Off-site Carbon Emissions (Macrogrid) (kg)Annual Total Carbon Emissions (kg)To determine the relative carbon emissions of each proposed

Norwood, Zack



Atmos. Chem. Phys. www.atmos-chem-phys.net  

E-Print Network (OSTI)

of stratospheric air from MIPAS SF6 measurements Supplement G. P. Stiller1, T. von Clarmann1, M. H¨opfner1, N representative for one month and a 5 latitude bin) are presented. Correspondence to: G.P. Stiller (gabriele.stiller@imk.fzk.de) Published by Copernicus Publications on behalf of the European Geosciences Union. #12;2 G.P. Stiller at al

Meskhidze, Nicholas


Pathways to neuronal injury and apoptosis in HIV-associated dementia  

Science Journals Connector (OSTI)

... and apoptosis which is blocked by inhibition of the p38 MAP kinase. The NMDAR antagonist memantine prevents neuronal damage in response to HIV/gp120 in cultured neurons as well as in ... to either HIV-infected macrophages or HIV/gp120, both in vitro and in vivo. Memantine, an open-channel blocker, prevents excessive NMDAR activity while sparing physiological function. Also, ...

Marcus Kaul; Gwenn A. Garden; Stuart A. Lipton



Society Associate Percival L. Hallowell '18* ++  

E-Print Network (OSTI)

and F. George Shenton '40 Peggy F. and Edgar F. Whitmore, Jr. '40 1941 Society Associates Richard B. Seebald '42 '49G ++ Emmet T. White '42 '78P ++ Barbara and George G. Zipf '42 '78H ++ 1943 Founder. and John H. Gross '44 '48G '55G Elizabeth and William C. Hittinger '44 '73H '71P '75P '78P '97GP '02GP

Napier, Terrence


Photogrammetry as a tool for estimating size and condition in the Hawaiian monk seal (Monachus schauinslandi), the harbor seal (Phoca vitulina), and the northern elephant seal (Mirounga anguistirosis)  

E-Print Network (OSTI)

) for captive, subadult, Hawaiian monk seals M= 58. 18 + 9. 07 (GA) + 1. 20 (LA) - 0. 46 (L) -0. 64 (GP). . . . . . . . . . . . . . . . . . . 65 FIGURE Page The two best models reflecting the relationship of mass with photogrammetric and morphometric... The relationship of mass with photogrammetric measures for captive, adult harbor seals: M= -204. 597 - 6. 834 (GA) + 1. 538 (GP) + 0. 554(LP) + 0. 217 (L) . . . . 71 The relationship between body mass and photogrammetric measures of lateral perimeter (LP...

McFadden, Katherine Walton



Biochemical and Genetic Characterization of Bacteriophage Holins  

E-Print Network (OSTI)

TMDs of Mu gp19. ........................... 155 xii LIST OF TABLES Page Table 1. Strains, phages, plasmids and primers used in this work. .................................. 45 Table 2. Mutant alleles of Y... on the muralytic activity for holin function. The gp13 holin of P22 has 90% identity compared to lambda S, but has a glycosidase endolysin. The Rz/Rz1 spanin genes The Rz and Rz1 genes encode a third class of lysis proteins, the spanins, responsible...

To, Kam Ho



Genetic programming approach to predict torque and brake specific fuel consumption of a gasoline engine  

Science Journals Connector (OSTI)

This study presents genetic programming (GP) based model to predict the torque and brake specific fuel consumption a gasoline engine in terms of spark advance, throttle position and engine speed. The objective of this study is to develop an alternative robust formulations based on experimental data and to verify the use of GP for generating the formulations for gasoline engine torque and brake specific fuel consumption. Experimental studies were completed to obtain training and testing data. Of all 81 data sets, the training and testing sets consisted of randomly selected 63 and 18 sets, respectively. Considerable good performance was achieved in predicting gasoline engine torque and brake specific fuel consumption by using GP. The performance of accuracies of proposed GP models are quite satisfactory (R2=0.9878 for gasoline engine torque and R2=0.9744 for gasoline engine brake specific fuel consumption). The prediction of proposed GP models were compared to those of the neural network modeling, and strictly good agreement was observed between the two predictions. The proposed GP formulation is quite accurate, fast and practical.

Necla Togun; Sedat Baysec



Disruption of Orolingual Behavior in Rats Treated with Atypical Antipsychotic Drugs  

E-Print Network (OSTI)

row. The emission of 12, 4 g licks resulted in the delivery of 0.055 ml of tap water onto the disk. Recording sessions lasted 120.32 seconds or about 2 min. Observation of the effects of acute oral clozapine (10.0 mg/kg, 5.0 mg/kg, 20.0 mg/kg...), acute oral aripiprazole (6.0 mg/kg, 12.0 mg/kg, 18.0 mg/kg), acute oral risperidone (0.50 mg/kg 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg), acute oral ziprasidone (1.0 mg/kg, 0.50 mg/kg, 2.0 mg/kg, 4,0 mg/kg) acute oral quetiapine fumarate (10.0 mg/kg, 5.0 mg/kg...

Hughes, John Clayton



Improvements to Hydrogen Delivery Scenario Analysis Model (HDSAM...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Gaseous Forecourt kg Sum kg kg Energy Fue Other O&M Cap ta Indianapolis, Compressed Gas (5000 psi Delivery, 20% M arket Penetration, 850 kg day Station, 62 miles to City...


National Beef Quality Audit - 2011: Survey of Instrument Grading Assessments of Beef Carcass Characteristics  

E-Print Network (OSTI)

.0%), YG 3 (33.8%), YG 4 (8.5%), and YG 5 (0.9%). Distribution of HCW was <272.2 kg (1.6%), 272.2 kg to 453.6 kg (95.1%), ?453.6 kg (3.3%). Monthly HCW means were: November 2010 (381.3 kg), January 2011 (375.9 kg), March 2011 (366.2 kg), May 2011 (357.9 kg...

Gray, Gatlan 1989-



Service robotics Prof. Alessandro De Luca  

E-Print Network (OSTI)

-mining · PEMEX lightweight anti-personnel mine detector (EPFL, Lausanne) · weight: 16 kg, max 6 kg for wheel

De Luca, Alessandro


Safety and core design of large liquid-metal cooled fast breeder reactors  

E-Print Network (OSTI)

quantities of depleted uranium hexafluoride (DUF 6 ), known85 kg of enriched uranium hexafluoride (UF 6 ) and ?915 kg

Qvist, Staffan Alexander



Bulk Hauling Equipment for CHG  

NLE Websites -- All DOE Office Websites (Extended Search)

BULK HAULING EQUIPMENT FOR CHG BULK HAULING EQUIPMENT FOR CHG Don Baldwin Director of Product Development - Hexagon Lincoln HEXAGON LINCOLN TITAN(tm) Module System Compressed Hydrogen Gas * Capacity 250 bar - 616 kg 350 bar - 809 kg 540 bar - 1155 kg * Gross Vehicle Weight (with prime mover) 250 bar - 28 450 kg 350 bar - 30 820 kg 540 bar - 39 440 kg * Purchase Cost 250 bar - $510,000 350 bar - $633,750 540 bar - $1,100,000 Compressed Natural Gas * Capacity (250 bar at 15 C) - 7412 kg * GVW (With prime mover) - 35 250 kg * Purchase Cost (+/- 5%) - $510,000 HEXAGON LINCOLN TITAN(tm) V Magnum Trailer System Compressed Hydrogen Gas * Capacity 250 bar - 800 kg 350 bar - 1050 kg 540 bar - 1500 kg * Gross Vehicle Weight (with prime mover) 250 bar - 31 000 kg 350 bar - 34 200 kg 540 bar - 45 700 kg * Purchase Cost (+/-


LEDSGP/publications | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/publications < LEDSGP Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LEDS GP Publications and Communications Material Communications Material Document Title Date LEDSGPFactsheet.pdf LEDS GP Factsheet September 2013 LEDSGPSlideDeck.pdf LEDS GP Slide Deck September 2013 Publications Document Title Date MACCCurvesPaper.pdf Broadening the Appeal of Marginal Abatement Cost Curves: Capturing Both Carbon Mitigation and Development Benefits of Clean Energy Technologies May 2012

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


ES&H Index  

NLE Websites -- All DOE Office Websites (Extended Search)

Corporate Policy System Documents Corporate Policy System Documents Plan Work Procedures ESH100.1.EP.1, Implement the Environmental Management System (EMS) ESH100.1.EP.2, Implement NEPA, Cultural Resources, and Historic Properties Requirements ESH100.1.EP.3, Complete an Environmental Life-cycle Management Evaluation ESH100.1.GP.1, Manage Safety for Contracted Activities ESH100.1.GP.2, Implement ES&H General Requirements ESH100.1.GP.3, Implement the Integrated Safety Management System ESH100.1.WPC.1, Plan and Control Work Analyze and Control Hazards Procedures ESH100.2.ELC.1, Manage Electrical Hazards ESH100.2.ENV.10, Manage Surface and Storm Water Discharges ESH100.2.ENV.11, Control Scrap Metal From a Radiological Area ESH100.2.ENV.12, Obtain and Comply with Air Permits ESH100.2.ENV.13, Control Ozone Depleting Substances


LEDSGP/about/regional-platforms | Open Energy Information  

Open Energy Info (EERE)

regional-platforms regional-platforms < LEDSGP‎ | about Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Regional Platforms LEDS GP regional platforms lead regional peer learning, training, and collaboration; engage technical working groups, the LEDS GP Secretariat, and others to meet country and regional needs; and cultivate champions and broad support for LEDS. African Climate and Development Society The African Climate and Development Society works towards climate resilient and low carbon development in Africa by bringing together policy, practice


Resolving Conflicting Crystallographic and NMR Models for Solution-State DNA with Solution X-ray Diffraction  

Science Journals Connector (OSTI)

We report on synchrotron-based high-angle X-ray solution scattering measured to 2 resolution for two synthetic DNA sequences for which there are conflicting X-ray crystal and solution NMR models. ... Herein, we report on synchrotron-based high-angle X-ray solution scattering measured to 2 resolution for two synthetic DNA sequences for which there are numerous conflicting X-ray crystal and solution NMR models. ... The crystal structure of the synthetic DNA dodecamer d(CpGpCpGpApApTpTpCpGpCpG) was refined to a residual error of R = 17.8% at 1.9- resoln. ...

Xiaobing Zuo; David M. Tiede



The Ebola virus glycoprotein mediates entry via a non-classical dynamin-dependent macropinocytic pathway  

SciTech Connect

Ebola virus (EBOV) has been reported to enter cultured cell lines via a dynamin-2-independent macropinocytic pathway or clathrin-mediated endocytosis. The route(s) of productive EBOV internalization into physiologically relevant cell types remain unexplored, and viral-host requirements for this process are incompletely understood. Here, we use electron microscopy and complementary chemical and genetic approaches to demonstrate that the viral glycoprotein, GP, induces macropinocytic uptake of viral particles into cells. GP's highly-glycosylated mucin domain is dispensable for virus-induced macropinocytosis, arguing that interactions between other sequences in GP and the host cell surface are responsible. Unexpectedly, we also found a requirement for the large GTPase dynamin-2, which is proposed to be dispensable for several types of macropinocytosis. Our results provide evidence that EBOV uses an atypical dynamin-dependent macropinocytosis-like entry pathway to enter Vero cells, adherent human peripheral blood-derived monocytes, and a mouse dendritic cell line.

Mulherkar, Nirupama [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Raaben, Matthijs [Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115 (United States); Torre, Juan Carlos de la [Department of Immunology and Microbial Science, The Scripps Research Institute, La Jolla, CA 92037 (United States); Whelan, Sean P. [Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115 (United States); Chandran, Kartik, E-mail: kartik.chandran@einstein.yu.edu [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States)



Gaussian process modeling for measurement and verification of building energy savings  

Science Journals Connector (OSTI)

We present a Gaussian process (GP) modeling framework to determine energy savings and uncertainty levels in measurement and verification (M&V) practices. Existing M&V guidelines provide savings calculation procedures based on linear regression techniques that are limited in their predictive and uncertainty estimation capabilities. We demonstrate that, unlike linear regression, GP models can capture complex nonlinear and multivariable interactions as well as multiresolution trends of energy behavior. In addition, because GP models are developed under a Bayesian setting, they can capture different sources of uncertainty in a more systematic way. We demonstrate that these capabilities can ultimately lead to significantly less expensive M&V practices. We illustrate the developments using simulated and real data settings.

Yeonsook Heo; Victor M. Zavala



Measurement and verification of building systems under uncertain data: A Gaussian process modeling approach  

Science Journals Connector (OSTI)

Abstract Uncertainty in sensor data (e.g., weather, occupancy) complicates the construction of baseline models for measurement and verification (M&V). We present a Monte Carlo expectation maximization (MCEM) framework for constructing baseline Gaussian process (GP) models under uncertain input data. We demonstrate that the GP-MCEM framework yields more robust predictions and confidence levels compared with standard GP training approaches that neglect uncertainty. We argue that the approach can also reduce data needs because it implicitly expands the data range used for training and can thus be used as a mechanism to reduce data collection and sensor installation costs in M&V processes. We analyze the numerical behavior of the framework and conclude that robust predictions can be obtained with relatively few samples.

Michael C. Burkhart; Yeonsook Heo; Victor M. Zavala



Radiative muon capture in nuclei  

Science Journals Connector (OSTI)

The energy spectra of photons following negative muon absorption in C12, O16, Al27, Ca40, Fenat, Ho165, and Bi209 have been measured with two NaI spectrometers. The branching ratios for the emission of high energy photons give information on the induced pseudoscalar coupling constant gP in nuclear matter. The data for light nuclei are in agreement with the theoretical calculations using the nucleonic value of gP?7gA predicted by the partially conserved axial vector current hypothesis, while significantly lower values of gP are required to fit the data of the heavier elements with presently existing theoretical predictions. Disregarding the remaining theoretical uncertainties, these results can be interpreted as a further indication of the renormalization of the nucleonic form factors inside the nucleus.

M. Dbeli; M. Doser; L. van Elmbt; M. W. Schaad; P. Trul; A. Bay; J. P. Perroud; J. Imazato; T. Ishikawa



LAC Regional Platform Workshop Presentations | Open Energy Information  

Open Energy Info (EERE)

LAC Regional Platform Workshop Presentations LAC Regional Platform Workshop Presentations Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LAC Workshop Announcement Agenda Participant Package Accommodations Location & Transportation Insurance & Visas Participants Presentations Outcomes Report Links Contact Us Introductory Remarks: LAC Regional Platform and Workshop and the LEDS GP Session Document Title LEDS GP slides for LAC Event.pdf LEDS GP Slides Interactive Session 1: Planning and Sustaining a LEDS Process Document Title Fernando Farias - 1aChilev1.pdf Making the Case for LEDS and Building Political Support: Chile on Engaging Ministries and Political Leaders Lupe Guinand - 2012 11 06 PlanCC Apoyo Político VA (2)rev.pdf Planning for Climate Change Project (PlanCC) - Promoviendo Estrategias de Desarrollo Bajas en Carbono (LEDS) en el Perú


Abstract--A novel methodology for economic evaluation of hydrogen storage for a mixed wind-nuclear power plant is  

E-Print Network (OSTI)

: hydrogen efficiency of electrolyzer (kg/MWh) d : hydrogen efficiency of fuel cell (kg/MWh) O : oxygen hydrogen production (kg) dischargeV : fuel cells hydrogen consumption (kg) hsellV : hydrogen exchange capacity (MW) STG Vmax : maximum storage level (kg) STGDISCH Pmax : maximum fuel cell power (MW) STGDISCH

Cañizares, Claudio A.


,"Natural Gas Plant Field Production: Natural Gas Liquids "  

U.S. Energy Information Administration (EIA) Indexed Site

Field Production: Natural Gas Liquids " Field Production: Natural Gas Liquids " ,"Click worksheet name or tab at bottom for data" ,"Worksheet Name","Description","# Of Series","Frequency","Latest Data for" ,"Data 1","Natural Gas Plant Field Production: Natural Gas Liquids ",16,"Monthly","9/2013","1/15/1981" ,"Release Date:","11/27/2013" ,"Next Release Date:","Last Week of December 2013" ,"Excel File Name:","pet_pnp_gp_a_epl0_fpf_mbbl_m.xls" ,"Available from Web Page:","http://www.eia.gov/dnav/pet/pet_pnp_gp_a_epl0_fpf_mbbl_m.htm" ,"Source:","Energy Information Administration"


Effect of ozone and granular activated coal (GAC) on the bioactivity of drinking water  

SciTech Connect

In this research, the appearance of easily biodegradable organic material in ozonation and granular activated coal (GAC) filtration was studied. The amount of bioactivity was measured by conventional AOC analyses used in two different modes and also using quite a new growth potential (GP) method. GAC filtration without ozone doubled the amount of AOC of the chemically treated surface water, whereas by ozonation with GAC filtration it was possible to halve the amount of the AOC. The measurement of GP was noticeably simpler than measuring AOC, but for wider use more parallel studies are needed for the comparability of the results of the analysis.

Sallanko, J.; Iivari, P.; Heiska, E. [University of Oulu, Oulu (Finland). Water Resources and Environmental Engineering Laboratory



Radiative muon absorption in calcium  

Science Journals Connector (OSTI)

The photon spectrum from radiative absorption of negative muons in Ca40 has been measured with a high-resolution pair spectrometer. The data are analyzed in order to determine the induced pseudoscalar coupling constant gp in nuclear matter. When compared to models which use a realistic nuclear response function and avoid the closure approximation, a value of gp/gA=4.01.5 is obtained, which indicates a quenching of this coupling compared to the nucleonic value by a factor 0.570.25.

A. Frischknecht; W. Stehling; G. Strassner; P. Trul; J. C. Alder; C. Joseph; J. F. Loude; J. P. Perroud; D. Ruegger; T. M. Tran; W. Dahme; H. Panke; R. Kopp



The changes of ?-glycerophosphate dehydrogenase isozymes in Solenopsis invicta queens during development and colony founding  

E-Print Network (OSTI)

Alleles RESULTS AND DISCUSSION 20 20 22 Location of ot-GPDH Activity Developmental Changes in Activity Characterizations of 4-GPDH Alleles 22 24 29 SUMMARY REFERENCES CITED VITA 36 38 42 LIST OF FIGURES Fig. 1. --The 4-GP Cycle of Insect... with their sustained metabolic activity. ? GPO -d t 1 f ~t' . --2h * tl mitochondrial reactions that may control respiration in flight muscle: the oxidations of pyruvate, proline, and o(-glycerophosphate (&-GP). For both pyruvate and proline oxidation the key...

Dowler, Megan Gail



Using short time pressure buildup tests to calculate gas reserves  

E-Print Network (OSTI)

-in Time ht l & dt 2 &ht 3 Transient Gp FiC, ure 1. Graphical Presentation of Sullivan. Poston en4 Piper's Method THEORY The basic equation for the radial flow of a single phase fluid in a porous medium& is i 8 kp Bp Bp ? ( " ) =citip- r Br p Br Br...) must be the same for any shut-in time. in the plot of p/z vs Ip p 1. Gp if the isochronal, transient line is parallel to the static line. Fig. 2 illustrates the graphical presentation of this idea. Mathematically, we must have (qyc)l ~ p (7ll )2...

Vu, Trang Dinh



Space-Time Curvature Signatures in Bose-Einstein Condensates  

E-Print Network (OSTI)

We derive a generalized Gross-Pitaevski (GP) equation immersed on a electromagnetic and a weak gravitational field starting from the covariant Complex Klein-Gordon field in a curved space-time. We compare it with the GP equation where the gravitational field is added by hand as an external potential. We show that there is a small difference of order $g z/c^2$ between them that could be measured in the future using Bose-Einstein Condensates (BEC). This represents the next order correction to the Newtonian gravity in a curved space-time.

Matos, Tonatiuh



An Assessment of the Near-Term Costs of Hydrogen Refueling Stations and Station Components  

E-Print Network (OSTI)

Cost ($/MMBTU, HHV) Electricity Cost (cents/kWh) ProductionNatural Gas Cost ($/kg) Electricity Cost ($/kg) O&M ($/kg)Gas Cost ($/MMBTU, HHV) Electricity Cost ($/kWh) Production

Weinert, Jonathan X.; Lipman, Timothy



An Assessment of the Near-Term Costs of Hydrogen Refueling Stations and Station Components  

E-Print Network (OSTI)

Operating Costs Purifier Electricity costs (energy + demand)Cost ($/MMBTU, HHV) Electricity Cost (cents/kWh) ProductionNatural Gas Cost ($/kg) Electricity Cost ($/kg) O&M ($/kg)

Lipman, T E; Weinert, Jonathan X.




E-Print Network (OSTI)

to grab the 10 Kg load, the force (F1) exerted on your lower back becomes 10 x 10 Kg plus 10 x 40 Kg = 100 Lbs) F1 F2 #12;


Modeling, Estimation, and Control of Waste Heat Recovery Systems  

E-Print Network (OSTI)

in where ? is the valve coefficient, is the throttle valve? T in where ? is the valve coefficient, is throttle valveC kg s kJ kg kg s 3. Valve Coefficient ?: 0.03 4. Throttle

Luong, David



Son Servera > UIB (en transport pblic)  

E-Print Network (OSTI)

'66 Emissions addicionals (CO2): 13,05 Kg Emissions addicionals (SO2): 0,008 Kg Durada: 123 min. Cost mitjà del viatge2 : 1,52 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic : 4105'73 Emissions addicionals (CO2): 4.592,77 Kg Emissions addicionals (SO2): 2,82 Kg Temps acumulat

Oro, Daniel

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Sant Lloren des Cardassar > UIB (en transport pblic)  

E-Print Network (OSTI)

: 10'61 Emissions addicionals (CO2): 11,87 Kg Emissions addicionals (SO2): 0,007 Kg Durada: 108 min. Cost mitjà del viatge2 : 1,52 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Despesa per any3 : 3.734'02 Emissions addicionals (CO2): 4.176,96 Kg Emissions addicionals (SO2): 2,57 Kg

Oro, Daniel


Sant Joan > UIB (en transport pblic)  

E-Print Network (OSTI)

,90 Emissions addicionals (CO2): 7,71 Kg Emissions addicionals (SO2): 0,005 Kg Durada: 81 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.427'39 Emissions addicionals (CO2): 1.915,23 Kg Emissions addicionals (SO2): 1,18 Kg Temps acumulat: 19,80 dies

Oro, Daniel


Consell > UIB (en transport pblic)  

E-Print Network (OSTI)

,30 Emissions addicionals (CO2): 4,81 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 47 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.515'01 Emissions addicionals (CO2): 1.694,73 Kg Emissions addicionals (SO2): 1,04 Kg Temps acumulat: 11,49 dies

Oro, Daniel


Lloret de Vistalegre > UIB (en transport pblic)  

E-Print Network (OSTI)

,50 Emissions addicionals (CO2): 7,27 Kg Emissions addicionals (SO2): 0,004 Kg Durada: 65min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.286'59 Emissions addicionals (CO2): 2.557,84 Kg Emissions addicionals (SO2): 1,57 Kg Temps acumulat: 15,89 dies

Oro, Daniel


Maria de la Salut > UIB (en transport pblic)  

E-Print Network (OSTI)

'38 Emissions addicionals (CO2): 9,38 Kg Emissions addicionals (SO2): 0,006 Kg Durada: 83 min. Cost mitjà del viatge2 : 1,21 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.951'17 Emissions addicionals (CO2): 3.301,25 Kg Emissions addicionals (SO2): 2,03 Kg Temps acumulat: 20,29 dies

Oro, Daniel


Estellencs > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 4,69 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 50 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.475'58 Emissions addicionals (CO2): 1.650,63 Kg Emissions addicionals (SO2): 1,01 Kg Temps acumulat: 12,22 dies

Oro, Daniel


Esporles > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 1,59 Kg Emissions addicionals (SO2): 0,001 Kg Durada: 15 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat'25 Emissions addicionals (CO2): 560,71 Kg Emissions addicionals (SO2): 0,34 Kg Temps acumulat: 3,67 dies

Oro, Daniel


Mancor de la Vall > UIB (en transport pblic)  

E-Print Network (OSTI)

'32 Emissions addicionals (CO2): 7,07 Kg Emissions addicionals (SO2): 0,004 Kg Durada: 82 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.224'64 Emissions addicionals (CO2): 2.488,54 Kg Emissions addicionals (SO2): 1,53 Kg Temps acumulat: 20,04 dies

Oro, Daniel


Bger > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 7,79 Kg Emissions addicionals (SO2): 0,005 Kg Durada: 80 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.449'92 Emissions addicionals (CO2): 2.740,54 Kg Emissions addicionals (SO2): 1,68 Kg Temps acumulat: 19,56 dies

Oro, Daniel


Puigpunyent > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 2,74 Kg Emissions addicionals (SO2): 0,002 Kg Durada: 50 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat'70 Emissions addicionals (CO2): 963,91 Kg Emissions addicionals (SO2): 0,59 Kg Temps acumulat: 12,22 dies

Oro, Daniel


Costitx > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 7,79 Kg Emissions addicionals (SO2): 0,005 Kg Durada: 84 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.449'92 Emissions addicionals (CO2): 2.740,54 Kg Emissions addicionals (SO2): 1,68 Kg Temps acumulat: 20,53 dies

Oro, Daniel


Algaida > UIB (en transport pblic)  

E-Print Network (OSTI)

: 4,455 Emissions addicionals (CO2): 5,32 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 55 min. Cost mitjà del viatge2 : 0,63 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Despesa per any3 : 1.568,16 Emissions addicionals (CO2): 1.871,13 Kg Emissions addicionals (SO2): 1,15 Kg

Oro, Daniel


Sller > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 3,33 Kg Emissions addicionals (SO2): 0,002 Kg Durada: 26 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.047,55 Emissions addicionals (CO2): 1.171,82 Kg Emissions addicionals (SO2): 0,72 Kg Temps acumulat: 6,36 dies

Oro, Daniel


Sencelles > UIB (en transport pblic)  

E-Print Network (OSTI)

,93 Emissions addicionals (CO2): 5,51 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 79 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públic.734'66 Emissions addicionals (CO2): 1.940,43 Kg Emissions addicionals (SO2): 1,19 Kg Temps acumulat: 19,31 dies

Oro, Daniel


Campanet > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 7,79 Kg Emissions addicionals (SO2): 0,005 Kg Durada: 80 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.449'92 Emissions addicionals (CO2): 2.740,54 Kg Emissions addicionals (SO2): 1,68 Kg Temps acumulat: 19,56 dies

Oro, Daniel


(en transport pblic) Temps total del trajecte: 40 minuts  

E-Print Network (OSTI)

addicionals (CO2): 3,78 Kg Emissions addicionals (SO2): 0,002 Kg Durada: 40 min. Cost mitjà del viatge2 : 1,90 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.188,35 Emissions addicionals (CO2): 1.329,32 Kg Emissions addicionals (SO2): 0,82 Kg Temps acumulat: 9,78 dies

Oro, Daniel


Selva > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 7,23 Kg Emissions addicionals (SO2): 0,004 Kg Durada: 74 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.275'33 Emissions addicionals (CO2): 2.545,24 Kg Emissions addicionals (SO2): 1,56 Kg Temps acumulat: 18,09 dies

Oro, Daniel


Ariany > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 9,92 Kg Emissions addicionals (SO2): 0,006 Kg Durada: 93 min. Cost mitjà del viatge2 : 1,21 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.120'13 Emissions addicionals (CO2): 1.915,23 Kg Emissions addicionals (SO2): 1,18 Kg Temps acumulat: 12,71 dies

Oro, Daniel


(en transport pblic) Temps total del trajecte: 123 minuts  

E-Print Network (OSTI)

addicionals (CO2): 13,96 Kg Emissions addicionals (SO2): 0,009 Kg Durada: 123 min. Cost mitjà del viatge2 : 1,52 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.392'96 Emissions addicionals (CO2): 4.914,07 Kg Emissions addicionals (SO2): 3,02 Kg Temps acumulat: 30,07 dies

Oro, Daniel


Santa Eugnia > UIB (en transport pblic)  

E-Print Network (OSTI)

: 4'14 Emissions addicionals (CO2): 4,64 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 56 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Despesa per any3 : 1.458'69 Emissions addicionals (CO2): 1.631,72 Kg Emissions addicionals (SO2): 1,00 Kg

Oro, Daniel

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Valldemossa > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 1,88 Kg Emissions addicionals (SO2): 0,001 Kg Durada: 12 min. Cost mitjà del viatge2 : 1,90 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat,,40 Emissions addicionals (CO2): 661,51 Kg Emissions addicionals (SO2): 0,41 Kg Temps acumulat: 2,93 dies

Oro, Daniel


Fornalutx > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 4,51 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 46 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.188,35 Emissions addicionals (CO2): 1.587,62 Kg Emissions addicionals (SO2): 0,98 Kg Temps acumulat: 11,24 dies

Oro, Daniel


Llub > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 7,86 Kg Emissions addicionals (SO2): 0,005 Kg Durada: 77 min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.472'45 Emissions addicionals (CO2): 2.765,74 Kg Emissions addicionals (SO2): 1,70 Kg Temps acumulat: 18,82dies

Oro, Daniel


Banyalbufar > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 3,40 Kg Emissions addicionals (SO2): 0,002 Kg Durada: 35 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.070'08 Emissions addicionals (CO2): 1.197,02 Kg Emissions addicionals (SO2): 0,74 Kg Temps acumulat: 8,56 dies

Oro, Daniel


Alar > UIB (en transport pblic)  

E-Print Network (OSTI)

addicionals (CO2): 5,44 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 52 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions addicionals (SO2): 0 kg Transport públicTransport privat.712,13 Emissions addicionals (CO2): 1.915,23 Kg Emissions addicionals (SO2): 1,18 Kg Temps acumulat: 12,71 dies

Oro, Daniel


An Analysis of Near-Term Hydrogen Vehicle Rollout Scenarios for Southern California  

E-Print Network (OSTI)

1000 kg/d) Onsite Steam Methane Reforming (SMR) stations (vehicle. Onsite Steam Methane Reforming (SMR) Several recent1000 kg/d) Onsite Steam Methane Reforming (SMR) stations (

Nicholas, Michael A; Ogden, J



Oscillatory Flame Response in Acoustically Coupled Fuel Droplet Combustion  

E-Print Network (OSTI)

and volumetric heats of combustion in biofuels render themVaporization [kJ/kg] Heat of Combustion [kJ/kg] Estimated

Sevilla Esparza, Cristhian Israel



Optimum Performance of Direct Hydrogen Hybrid Fuel Cell Vehicles  

E-Print Network (OSTI)

kW) Vehicle Mass (kg) Electric Motor (kW) Fuel Cell StackkW) Vehicle Mass (kg) Electric Motor (kW) Fuel Cell Stack

Zhao, Hengbing; Burke, Andy



Dieselzymes: development of a stable and methanol tolerant lipase for biodiesel production by directed evolution  

E-Print Network (OSTI)

in terms of kg of bio- diesel produced per kg of catalyst [efficient synthesis of bio- diesel even in the presence of a

Korman, Tyler P; Sahachartsiri, Bobby; Charbonneau, David M; Huang, Grace L; Beauregard, Marc; Bowie, James U



Land Use Planning to Promote Marine Conservation of Coral reef Ecosystems in Moorea, French Polynesia  

E-Print Network (OSTI)

the marine environment: phosphorous promote excessive al-year .. 0.7 kg Phosphorous/year Pigs 1,800year 8 kg Phosphorous/year Total

Timothy Duane



Life-Cycle Assessment of Energy and Environmental Impacts of...  

Office of Scientific and Technical Information (OSTI)

global warming potential (GWP100a) CML2001 kg CO 2 -eq AP Acidification Potential air pollution acidification potential CML2001 kg SO 2 -eq POCP Photochemical Ozone...


"1. Carbon Dioxide Emission Factors for Stationary Combustion1"  

U.S. Energy Information Administration (EIA) Indexed Site

Fuel Emission Factors" Fuel Emission Factors" "(From Appendix H of the instructions to Form EIA-1605)" "1. Carbon Dioxide Emission Factors for Stationary Combustion1" "Fuel ",,"Emission Factor ",,"Units" "Coal2" "Anthracite",,103.69,,"kg CO2 / MMBtu" "Bituminous",,93.28,,"kg CO2 / MMBtu" "Sub-bituminous",,97.17,,"kg CO2 / MMBtu" "Lignite",,97.72,,"kg CO2 / MMBtu" "Electric Power Sector",,95.52,,"kg CO2 / MMBtu" "Industrial Coking",,93.71,,"kg CO2 / MMBtu" "Other Industrial",,93.98,,"kg CO2 / MMBtu" "Residential/Commercial",,95.35,,"kg CO2 / MMBtu" "Natural Gas3"


Solving planning-graph by compiling it into CSP Minh Binh Do & Subbarao Kambhampati  

E-Print Network (OSTI)

Solving planning-graph by compiling it into CSP Minh Binh Do & Subbarao Kambhampati Department to adapt CSP search techniques into the backward search phase of Graphplan. This paper describes GP-CSP, a system that does planning by automati- cally converting Graphplan's planning graph into a CSP encoding

Kambhampati, Subbarao


Mountable eddy current sensor for in-situ remote detection of surface and sub-surface fatigue cracks  

DOE Patents (OSTI)

A wireless, integrated, mountable, portable, battery-operated, non-contact eddy current sensor that provides similar accuracy to 1970's laboratory scale equipment (e.g., a Hewlett-Packard GP4194A Impedance Analyzer) at a fraction of the size and cost.

Yepez, III, Esteban (Albuquerque, NM); Roach, Dennis P. (Albuquerque, NM); Rackow, Kirk A. (Albuquerque, NM); DeLong, Waylon A. (Albuquerque, NM)



A regulon conserved in monocot and dicot plants defines a functional module in antifungal plant immunity  

Science Journals Connector (OSTI)

...Ulrike Gobel Kurt Stuber Mariola Pi?lewska-Bednarek Ann Loraine Paul Schulze-Lefert Shauna Somerville Ralph Panstruga a Department...774 . 31 Srinivasasainagendra V Page GP Mehta T Coulibaly I Loraine AE ( 2008 ) CressExpress: A tool for large-scale mining...

Matt Humphry; Pawe? Bednarek; Birgit Kemmerling; Serry Koh; Mnica Stein; Ulrike Gbel; Kurt Stber; Mariola Pi?lewska-Bednarek; Ann Loraine; Paul Schulze-Lefert; Shauna Somerville; Ralph Panstruga



The Fusion Protein of Respiratory Syncytial Virus Triggers p53-Dependent Apoptosis  

Science Journals Connector (OSTI)

...interfering with the fusion activity of the protein...induced. Confocal laser scanning microscopy...human RSV F protein (hF-GFP) was predominantly...either bF-GFP, hF-GFP, or gp40-GFP...analyzed by confocal laser scanning microscopy...postinduction of bF-GFP or hF-GFP expression...

Julia Eckardt-Michel; Markus Lorek; Diane Baxmann; Thomas Grunwald; Gnther M. Keil; Gert Zimmer



Laser Capture Microdissection Assessment of Virus Compartmentalization in the Central Nervous Systems of Macaques Infected with Neurovirulent Simian Immunodeficiency Virus  

Science Journals Connector (OSTI)

...amplify viral RNA from laser capture samples, and...of gp41 increases the fusion activity of the virion by efficient exposure of fusion epitopes followed by binding...for assistance with laser capture microdissection...Gutmann, M Opravil, and HF Gunthard, Swiss HIV Cohort...

Kenta Matsuda; Charles R. Brown; Brian Foley; Robert Goeken; Sonya Whitted; Que Dang; Fan Wu; Ronald Plishka; Alicia Buckler-White; Vanessa M. Hirsch



Unusual Molecular Architecture of the Machupo Virus Attachment Glycoprotein  

Science Journals Connector (OSTI)

...conserved across the New World HF arenaviruses, a third...glycosylation by matrix-assisted laser desorption ionization-time...segment from all New World HF arenaviruses (MACV, JUNV...GP1. Matrix-assisted laser desorption ionization-time...sites across New World HF arenaviruses mapped onto...

Thomas A. Bowden; Max Crispin; Stephen C. Graham; David J. Harvey; Jonathan M. Grimes; E. Yvonne Jones; David I. Stuart



Chimeric human parainfluenza virus bearing the Ebola virus glycoprotein as the sole surface protein is immunogenic and highly protective against Ebola virus challenge  

SciTech Connect

We generated a new live-attenuated vaccine against Ebola virus (EBOV) based on a chimeric virus HPIV3/{delta}F-HN/EboGP that contains the EBOV glycoprotein (GP) as the sole transmembrane envelope protein combined with the internal proteins of human parainfluenza virus type 3 (HPIV3). Electron microscopy analysis of the virus particles showed that they have an envelope and surface spikes resembling those of EBOV and a particle size and shape resembling those of HPIV3. When HPIV3/{delta}F-HN/EboGP was inoculated via apical surface of an in vitro model of human ciliated airway epithelium, the virus was released from the apical surface; when applied to basolateral surface, the virus infected basolateral cells but did not spread through the tissue. Following intranasal (IN) inoculation of guinea pigs, scattered infected cells were detected in the lungs by immunohistochemistry, but infectious HPIV3/{delta}F-HN/EboGP could not be recovered from the lungs, blood, or other tissues. Despite the attenuation, the virus was highly immunogenic, and a single IN dose completely protected the animals against a highly lethal intraperitoneal challenge of guinea pig-adapted EBOV.

Bukreyev, Alexander [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)], E-mail: abukreyev@nih.gov; Marzi, Andrea; Feldmann, Friederike [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Zhang Liqun [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Yang Lijuan; Ward, Jerrold M. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Dorward, David W. [Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Hamilton, Montana (United States); Pickles, Raymond J. [Cystic Fibrosis/Pulmonary Research and Treatment Center, University of North Carolina at Chapel Hill, Chapel Hill, North Carolina (United States); Murphy, Brian R. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States); Feldmann, Heinz [Special Pathogens Program, National Microbiology Laboratory, Canadian Science Centre for Human and Animal Health, Winnipeg (Canada); Department of Medical Microbiology, University of Manitoba (Canada); Collins, Peter L. [National Institute of Allergy and Infectious Diseases, Building 50, Room 6505, NIAID, National Institutes of Health, 50 South Dr. MSC 8007, Bethesda, MD 20892-8007 (United States)



A forward genetic strategy reveals destabilizing mutations in the ebolavirus2 glycoprotein that alter its protease dependence during cell entry3  

E-Print Network (OSTI)

1 1 A forward genetic strategy reveals destabilizing mutations in the ebolavirus2 glycoprotein, Harvard Medical8 School, Boston, MA 021159 10 Running title: CATHEPSIN B-INDEPENDENT ENTRY BY EBOLAVIRUS Ebolavirus entry into cells requires proteolytic disassembly of the viral glycoprotein, GP. This2 proteolytic

Chandran, Kartik

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Spatial interactions among ecosystem services in an urbanizing agricultural watershed  

Science Journals Connector (OSTI)

...R Mulholland P Robertson GP ( 2010 ) Bioenergy sustainability at the Regional Scale...stock values were estimates from the literature (30, 37, 38) and assumed that belowground...Occurrence of nitrate in groundwater--A review. J Environ Qual 22(3):392 ZZQQhy402...

Jiangxiao Qiu; Monica G. Turner



Genetic programming needs better benchmarks  

Science Journals Connector (OSTI)

Genetic programming (GP) is not a field noted for the rigor of its benchmarking. Some of its benchmark problems are popular purely through historical contingency, and they can be criticized as too easy or as providing misleading information concerning ... Keywords: benchmarks, genetic programming

James McDermott; David R. White; Sean Luke; Luca Manzoni; Mauro Castelli; Leonardo Vanneschi; Wojciech Jaskowski; Krzysztof Krawiec; Robin Harper; Kenneth De Jong; Una-May O'Reilly



Cationic Amphiphile with Shikimic Acid Headgroup Shows More Systemic Promise Than Its Mannosyl Analogue as DNA Vaccine Carrier in Dendritic Cell Based Genetic Immunization  

Science Journals Connector (OSTI)

Zhai, Y.; Yang, J. C.; Spiess, P.; Nishimura, M. I.; Overwijk, W. W.; Roberts, B.Cloning and characterization of the genes encoding the murine homologues of the human melanoma antigens MART1 and gp100 J. Immunother. ... Zhai, Yifan; Yang, James C.; Spiess, Paul; Nishimura, Michael I.; Overwijk, Willem W.; Roberts, Bruce; Restifo, Nicholas P.; Rosenberg, Steven A. ...

Ramishetti Srinivas; Priya P. Karmali; Dipankar Pramanik; Arup Garu; Yenugonda Venkata Mahidhar; Bharat K. Majeti; Sistla Ramakrishna; Gunda Srinivas; Arabinda Chaudhuri



Immunosuppression in Melanoma Immunotherapy: Potential Opportunities for Intervention  

Science Journals Connector (OSTI)

...org . Laszlo G. Radvanyi Willem W. Overwijk Patrick Hwu Authors Affiliation: Department...Immunol 2005;174:2591-601. 15 Overwijk WW, Tsung A, Irvine KR, et al. gp100...J Exp Med 1998;188:277-86. 16 Overwijk WW, Theoret MR, Finkelstein SE, et...

Gregory Lize; Laszlo G. Radvanyi; Willem W. Overwijk; Patrick Hwu



Toll-like Receptors in Tumor Immunotherapy  

Science Journals Connector (OSTI)

...1122-34. 43 Surman DR, Dudley ME, Overwijk WW, Restifo NP. Cutting edge: CD4...Acad Sci U S A 2002;99:931-6. 66 Overwijk WW, Tsung A, Irvine KR, et al. gp100...J Immunother 1997;20:15-25. 68 Overwijk WW, Theoret MR, Finkelstein SE, et...

Chrystal M. Paulos; Andrew Kaiser; Claudia Wrzesinski; Christian S. Hinrichs; Lydie Cassard; Andrea Boni; Pawel Muranski; Luis Sanchez-Perez; Douglas C. Palmer; Zhiya Yu; Paul A. Antony; Luca Gattinoni; Steven A. Rosenberg; Nicholas P. Restifo



Elastic parabolic equation solutions for underwater acoustic problems using seismic sources  

E-Print Network (OSTI)

, Washington 98105 Jon M. Collis Department of Applied Mathematics and Statistics, Colorado School of Mines.1121/1.4790355] PACS number(s): 43.30.Ma, 43.30.Dr, 43.20.Gp, 43.30.Zk [MS] Pages: 1358­1367 I. INTRODUCTION A class


Evaluation of a Prototype Flow Cytometry Test for Serodiagnosis of Canine Visceral Leishmaniasis  

Science Journals Connector (OSTI)

...G, Jr , A Teva, AL Ferreira, CB dos Santos, IS Pinto, CT de-Azevedo and A Falqueto...54-59. 12. Borja-Cabrera, GP , FN Santos, FS Bauer, LE Parra, I Menz, AA Morgado...Rocha, RD , CM Gontijo, SM Eloi-Santos, A Teixeira Carvalho, R Correa-Oliveira...

Henrique Gama Ker; Wendel Coura-Vital; Rodrigo Dian de Oliveira Aguiar-Soares; Bruno Mendes Roatt; Ndia das Dores Moreira; Cludia Martins Carneiro; Evandro Marques de Menezes Machado; Andra Teixeira-Carvalho; Olindo Assis Martins-Filho; Rodolfo Cordeiro Giunchetti; Mrcio Sobreira Silva Arajo; Eduardo Antonio Ferraz Coelho; Denise da Silveira-Lemos; Alexandre Barbosa Reis




E-Print Network (OSTI)

EMULATING A GRAVITY MODEL TO INFER THE SPATIOTEMPORAL DYNAMICS OF AN INFECTIOUS DISEASE Roman grid. · Use pre-calculated matrices {Mtk}. GP-EMULATOR - BASED APPROACH · Based on constructing a new (proportions of zeros) on a pre-selected grid of parameters. · Second stage: We make inference based

Bjørnstad, Ottar Nordal


Sparse Gaussian Process Toolbox Lehel Csato  

E-Print Network (OSTI)

process · MATLAB programming language · NETLAB toolbox Provides: · GUI demos for teaching GPs · Variety://www.tuebingen.mpg.de/csatol · http://www.ncrg.aston.ac.uk/Projects/SSGP Gaussian Process Inference Gaussian process (GP) models datasets. Matlab Implementation Uses a matlab structure net. The initialisation of the structure


Genetic Programming of Full Knowledge Bases for Fuzzy Logic Controllers  

E-Print Network (OSTI)

Genetic Programming of Full Knowledge Bases for Fuzzy Logic Controllers Daryl Battle Lucent in fuzzy logic control applications. An extension to a rule learning GP system is presented that achieves and fuzzy logic. These methods have proven to be effective in designing intelligent control systems

Fernandez, Thomas


Air-stable droplet interface bilayers on oil-infused surfaces  

Science Journals Connector (OSTI)

...by Air Force Office of Scientific Research Basic Research Initiative Grant FA9550-12-1-0464 (to S.A.S.) and the SunShot Program of the Office of Energy Efficiency and Renewable Energy (G.P.). The authors declare no conflict of interest...

Jonathan B. Boreyko; Georgios Polizos; Panos G. Datskos; Stephen A. Sarles; C. Patrick Collier



HIV Fusion Peptide Penetrates, Disorders, and Softens T-Cell Membrane Mimics  

E-Print Network (OSTI)

HIV Fusion Peptide Penetrates, Disorders, and Softens T-Cell Membrane Mimics Stephanie Tristram of N-terminal gp41 fusion peptide (FP) of human immunodeficiency virus type 1 (HIV-1) with model membranes in order to elucidate how FP leads to fusion of HIV and T-cell membranes. FP constructs were (i

Weliky, David


Creation of Quasi-One-Dimensional Strontium Rydberg Atoms Shuzhen Ye,1  

E-Print Network (OSTI)

GP-A-17 Creation of Quasi-One-Dimensional Strontium Rydberg Atoms Shuzhen Ye,1 state such as a low- state or a polarized Stark state. Here, we examine the photoexcitation of strontium. In strontium the "nd" states possess high two-photon excitation rates, display a large quantum defect


Statistical Deterministic  

E-Print Network (OSTI)

of OL weights / H 1=2 ). H !1: Posterior of net output converges (with p. 1) to zero-mean Gaussian D) = P (D j #18;)P (#18;) P (D) (1) to calculate P (t j x; D) by marginalizing over #18;. Karlsruhe | November 10, 1998 5 #12; Regression with Gaussian Processes Prior P (y(x)) zero-mean GP with covariance

Seeger, Matthias


Towards Improved Prediction of Ocean Processes Using Statistical Machine Learning  

E-Print Network (OSTI)

on Gaussian Process (GP) regression, which provide improved estimates of ocean currents and also have current estimates from the Southern California Bight provided by the Regional Ocean Modeling System (ROMS with sensors like HF-Radar have allowed accurate predictions of ocean currents, temperature, and other

Sukhatme, Gaurav S.


Classification of Seafloor Habitats using Genetic Programming  

E-Print Network (OSTI)

habitats. The initial motivation to use GP for this task came from a work on diesel engine diagnosis [11 for Marine Science and Technology Curtin University of Technology GPO Box U1987, Perth, WA 6845, Australia y understand- ing of the acoustic backscatter from marine macro-benthos (MMB), including mainly seagrass, algae

Fernandez, Thomas


Mechanisms of protein stabilization at very low pH ISBN 978-7-5487-0356-3  

E-Print Network (OSTI)

ArsH from heterogeneous expression in E.coli BL21 A strategy to produce monoclonal antibodies against gp96 by prime-boost regimen using endogenous protein and E. coli heterologously-expressed fragment limonitic ore Effect of organic extractant, pH and temperature change, on bioleaching The effects of p

Neshich, Goran


Genotyping of 27 Human Papillomavirus Types by Using L1 Consensus PCR Products by a Single-Hybridization, Reverse Line Blot Detection Method  

Science Journals Connector (OSTI)

...Apple C. M. Wheeler Department...Roche Molecular Systems, Inc., Alameda...and cohort studies that HPV infection...Perkin-Elmer, Foster City, Calif...A cohort study of the risk...case-control study in Taiwan...Schiffman M. H. Wheeler C. M. Epidemiology...GP5 primer systems. . Remmink...

P. E. Gravitt; C. L. Peyton; R. J. Apple; C. M. Wheeler



A quadratic cumulative production model for the material balance of an abnormally pressured gas reservoir  

E-Print Network (OSTI)

. .................................................................................. 48 3.28 Summary plot of p/z vs. Gp ? Case 3. ................................................................................... 48 3.29 Plot of pore volume compressibility computed using Fetkovich, et al. approach and compared to laboratory data... aquifers in southern Louisiana and adjacent areas of the continental shelf (ref. 23). .................................................................................................................................. 23 2.3 Geopressure ratio (geostatic...

Gonzalez, Felix Eduardo



Enhancement of the E(J,B) power law characterization for superconducting wires from  

E-Print Network (OSTI)

3GP3-7 1 Enhancement of the E(J,B) power law characterization for superconducting wires from. This method has many advantages compared to the conventional measurements on short samples: voltages's characteristics, according to the winding process, e.g., the bending radius and the tensile strength. I

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Rational HIV Immunogen Design to Target Specific Germline B Cell Receptors  

Science Journals Connector (OSTI)

...multimerized on nanoparticles, this immunogen (eOD-GT6) activates germline and mature VRC01-class B cells. Thus, eOD-GT6 nanoparticles have promise as a vaccine...and mature (Mat) antibodies to gp120 and eOD variants. Values represent KD s in nM measured...

Joseph Jardine; Jean-Philippe Julien; Sergey Menis; Takayuki Ota; Oleksandr Kalyuzhniy; Andrew McGuire; Devin Sok; Po-Ssu Huang; Skye MacPherson; Meaghan Jones; Travis Nieusma; John Mathison; David Baker; Andrew B. Ward; Dennis R. Burton; Leonidas Stamatatos; David Nemazee; Ian A. Wilson; William R. Schief



Bacillus anthracis Diversity in Kruger National Park  

Science Journals Connector (OSTI)

...S. Department of Energy (NN20-CBNP...Klevytska L. B. Price J. M. Schupp G...P. Keim L. B. Price A. M. Klevytska...Klevytska L. B. Price P. Keim D. T...has a recorded history of periodic anthrax...Arizona 86011-5640, USA. Kimothy.Smith...

K. L. Smith; V. DeVos; H. Bryden; L. B. Price; M. E. Hugh-Jones; P. Keim



NEWS & VIEWS NATURE|Vol 441|15 June 2006 A drawback of the Zhu et al. study, and of  

E-Print Network (OSTI)

these regions. The gp120 molecules sit atop the legs, with a sugar-coated face upwards and the variable loops surface chemistry, mainly attach at defects or edge-atom sites in the lattice, where the carbon atoms trigger the break- up of the carbon lattice, ultimately destroying the entire graphitic structure? One

Aksay, Ilhan A.


PWR's xenon oscillation control through a fuzzy expert system automatically designed by means of genetic programming  

Science Journals Connector (OSTI)

This work proposes the use of genetic programming (GP) for automatic design of a fuzzy expert system aimed to provide the control of axial xenon oscillations in pressurized water reactors (PWRs). The control methodology is based on three axial offsets ... Keywords: Axial xenon oscillations control, Fuzzy logic, Genetic programming

Roberto P. Domingos; Gustavo H. F. Caldas; Cludio M. N. A. Pereira; Roberto Schirru



[Faculty of Science Information and Computing Sciences  

E-Print Network (OSTI)

[Faculty of Science Information and Computing Sciences] Indexed fixed points Andres Löh Dept. of Information and Computing Sciences, Utrecht University P.O. Box 80.089, 3508 TB Utrecht, The Netherlands Web pages: http://www.cs.uu.nl/wiki/Center GP meeting, 21 November 2008 #12;[Faculty of Science Information

Löh, Andres


Analytical Challenges and Recent Advances in the Determination of Estrogens in Water Environments  

Science Journals Connector (OSTI)

......MIPs for E2 were synthesized from 4-vinyl pyridine and ethylene dimethacrylate as a functional monomer and cross-linking...2007). 91. D.D. Fine, G.P. Breidenbach, T.L. Price, and S.R. Hutchins. Quantitation of estrogens in ground......

Rodica Domnica Briciu; Agata Kot-Wasik; Jacek Namiesnik



A mutation in the putative Mg(2+)-binding site of Gs alpha prevents its activation by receptors.  

Science Journals Connector (OSTI)

...10 p.M GTPyS and 10 ,uM isoproterenol (Iso) (A, *, *). A wt S49 4 ISO T10 JM o- S~~~~TP GpS 0- - B CYC- /54N a sI 10 AM XGPy S VOL...filled symbols) of 10 puM isoproterenol (Iso). preference for guanine nucleotide diphosphates...

J D Hildebrandt; R Day; C L Farnsworth; L A Feig



Role of RelGsu in Stress Response and Fe(III) Reduction in Geobacter sulfurreducens  

Science Journals Connector (OSTI)

...development and A-factor production in Myxococcus xanthus. Genes...antagonism between opposing active sites in a bifunctional RelA/SpoT...3-monophosphate (ppGp) and antibiotic production in Streptomyces clavuligerus...essential zinc ion in the active site. Cell 97: 371-381. 72...

Laurie N. DiDonato; Sara A. Sullivan; Barbara A. Meth; Kelly P. Nevin; Reg England; Derek R. Lovley



Venezuelan Equine Encephalitis Virus Replicon Particle Vaccine Protects Nonhuman Primates from Intramuscular and Aerosol Challenge with Ebolavirus  

Science Journals Connector (OSTI)

...Reston virus (RESTV), Sudan virus (SUDV), Tai Forest...Sciences, Penzberg, Germany) thermal cycler. Fluorescence was measured...expression of Ebola virus and Sudan virus GP. BHK cells were infected...report the protective efficacy of Sudan ebolavirus (SUDV) and Zaire...

Andrew S. Herbert; Ana I. Kuehne; James F. Barth; Ramon A. Ortiz; Donald K. Nichols; Samantha E. Zak; Spencer W. Stonier; Majidat A. Muhammad; Russell R. Bakken; Laura I. Prugar; Gene G. Olinger; Jennifer L. Groebner; John S. Lee; William D. Pratt; Max Custer; Kurt I. Kamrud; Jonathan F. Smith; Mary Kate Hart; John M. Dye



Bluetongue virus coat protein VP2 contains sialic acid-binding domains, and VP5 resembles enveloped virus fusion proteins  

Science Journals Connector (OSTI)

...of the rotavirus VP4 spike (PDB ID code 1KQR) (14). When the ribbon model...expression of nonstructural protein 2 (NS2) at 16 h after BTV infection of HeLa...fusion proteins gp41 of HIV (PDB ID code 1SZT) (24) and HA2 of influenza...

Xing Zhang; Mark Boyce; Bishnupriya Bhattacharya; Xiaokang Zhang; Stan Schein; Polly Roy; Z. Hong Zhou



Stabilizing Exposure of Conserved Epitopes by Structure Guided Insertion of Disulfide Bond in HIV-1 Envelope Glycoprotein  

E-Print Network (OSTI)

bond will snap Env into a conformation that is less mobile and stably expose conserved sites. Therefore, we analyzed the interface between these gp120 layers (layers 1, 2 and 3) and identified residues that may form disulfide bonds when substituted...

Kassa, Aemro; Dey, Antu K.; Sarkar, Pampi; Labranche, Celia; Go, Eden P.; Clarck, Danile F.; Sun, Yide; Nandi, Avishek; Hartog, Karin; Desaire, Heather; Montefiori, David; Carfri, Andrea; Srivastava, Indresh K.; Barnett, Susan W.



Characterization and assessment of uncertainty in San Juan Reservoir Santa Rosa Field  

E-Print Network (OSTI)

This study proposes a new, easily applied method to quantify uncertainty in production forecasts for a volumetric gas reservoir based on a material balance model (p/z vs. Gp). The new method uses only observed data and mismatches between regression...

Becerra, Ernesto Jose



Estimation of original gas in place from short-term shut-in pressure data for commingled tight gas reservoirs with no crossflow  

E-Print Network (OSTI)

gas production (GP) under these circumstances. This research studies different empirical methods to estimate the original gas in place (OGIP) for one-layer or commingled two-layer tight gas reservoirs without crossflow, from short-term (72-hour) shut...

Khuong, Chan Hung



Exploiting Two Intelligent Models to Predict Water Level: A field study of Urmia lake, Iran  

E-Print Network (OSTI)

Exploiting Two Intelligent Models to Predict Water Level: A field study of Urmia lake, Iran Shahab. The measurements from a single tide gauge at Urmia Lake, Northwest Iran, were used to train and validate the GP of Tabriz, Tabriz, Iran. Tel: 0098-411-3392786 Fax: 0098-411-3345332, (e-mail: sha- hab kvk66@yahoo

Fernandez, Thomas


Fluorescent protein pair emit intracellular FRET signal suitable for FACS screening  

SciTech Connect

The fluorescent proteins ECFP and HcRed were shown to give an easily resolved FRET-signal when expressed as a fusion inside mammalian cells. HeLa-tat cells expressing ECFP, pHcRed, or the fusion protein pHcRed-ECFP were analyzed by flow cytometry after excitation of ECFP. Cells expressing HcRed-ECFP, or ECFP and HcRed, were mixed and FACS-sorted for FRET positive cells: HcRed-ECFP cells were greatly enriched (72 times). Next, cloned human antibodies were fused with ECFP and expressed anchored to the ER membrane. Their cognate antigens (HIV-1 gp120 or gp41) were fused to HcRed and co-expressed in the ER. An increase of 13.5 {+-} 1.5% (mean {+-} SEM) and 8.0 {+-} 0.7% in ECFP fluorescence for the specific antibodies reacting with gp120 or gp41, respectively, was noted after photobleaching. A positive control (HcRed-ECFP) gave a 14.8 {+-} 2.6% increase. Surprisingly, the unspecific antibody (anti-TT) showed 12.1 {+-} 1.1% increase, possibly because overexpression in the limited ER compartment gave false FRET signals.

Johansson, Daniel X. [Karolinska Institutet, Department of Medicine, Karolinska Hospital, 171 76 Stockholm (Sweden); Brismar, Hjalmar [Karolinska Institutet, Department of Woman and Child Health, Karolinska Hospital, 171 76 Stockholm (Sweden); Royal Institute of Technology, Department of Cell Physics, KTH/SCFAB, 106 91 Stockholm (Sweden); Persson, Mats A.A. [Karolinska Institutet, Department of Medicine, Karolinska Hospital, 171 76 Stockholm (Sweden)]. E-mail: mats.persson@ki.se



Herbein et al. Retrovirology 2010, 7:34 http://www.retrovirology.com/content/7/1/34  

E-Print Network (OSTI)

functions in viral pathogenesis, notably by modulating cell signaling. The role of HIV-1 proteins (Nef, Tat Nef, Tat, Vpr, and gp120 proteins have been detected in the serum of HIV-1 infected patients. Possibly-1 pro- teins such as Nef, Tat, and Vpr have been detected in serum of HIV-1 infected patients

Paris-Sud XI, Université de



E-Print Network (OSTI)

. Universitaria O4510 Mexico City, MEXICO Abstract. The paper describes a hybrid approach for dynamic system), relative humidity (H), solar radiation (R) and wind speed (V) and direction (D) were recorded. The time An alternative representation in GP for dynamic system modelling and prediction was presented. This MB

Fernandez, Thomas


Ultra-sensitive Calorimetry for Microwave Cyclotron Resonance in a Two-Dimensional Electron Gas  

E-Print Network (OSTI)

GP-B-1 Ultra-sensitive Calorimetry for Microwave Cyclotron Resonance in a Two-dimensional electron in GaAs quantum wells. We construct a differential nano-calorimetry which can operate at 300 mK the sensitivity for detecting CR heating to several nano-watts. This ultra-sensitive technique opens up


Numer. Math. 19,195-205 (1972) 0 by Springer-Verlag 1972  

E-Print Network (OSTI)

Fractions and Jacobi's Algorithm* W. A. Beyer Los Alamos Scientific Laboratory, Los Alamos, New Mexico M. S. Waterman Idaho State University, Pocatello, Idaho Received March 26,1971 Abstract. Ergodic computational at Los Alamos Scientific Laboratory. The work was also sup- ported in part by NSF grant GP-28313to M

Waterman, Michael S.


Single Molecule Force Spectroscopy of Salt-dependent Bacteriophage T7 Gene 2.5 Protein Binding to  

E-Print Network (OSTI)

Single Molecule Force Spectroscopy of Salt-dependent Bacteriophage T7 Gene 2.5 Protein Binding by single molecule force spectroscopy. T7 gp2.5- 26C, lacking 26 acidic C-terminal residues, also reduces of single DNA molecules by stretch- ing the molecules and measuring the required force for a given extension

Richardson, Charles C.

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Use of Microdosing and Accelerator Mass Spectrometry To Evaluate the Pharmacokinetic Linearity of a Novel Tricyclic GyrB/ParE Inhibitor in Rats  

Science Journals Connector (OSTI)

...Novel Tricyclic GyrB/ParE Inhibitor in Rats Michael A. Malfatti a Victoria Lao a Courtney...preclinical drug candidate (GP-4) in rats as a step toward human microdosing studies...pharmacological dose was assessed in Sprague-Dawley rats. Plasma PKs over the 3 pharmacological...

Michael A. Malfatti; Victoria Lao; Courtney L. Ramos; Voon S. Ong; Kenneth W. Turteltaub



A Class of Stochastic Volatility Models for Environmental Applications  

E-Print Network (OSTI)

Pharmaceuticals Inc. Ke Wang, Pfizer Inc. F. Jay Breidt, Colorado State University Richard A. Davis, Columbia stochastic volatility modeling to this context, resulting in a stochastic heteroscedastic process (SHP), which is unconditionally stationary and non-Gaussian. Conditional on a latent GP, the SHP

Breidt, F. Jay



E-Print Network (OSTI)

pastoral care as well as teaching Take positive steps to promote students well-being Ensure the health students to make contact with their GP or local mental health services. The Duty of Care and Negligence1 STUDENT MENTAL HEALTH POLICY Revised January 2013 #12;2 A. INTRODUCTION 1. Context Widening

Martin, Ralph R.


University of Connecticut Health Center  

E-Print Network (OSTI)

with regarding any aspects of your health care. We will only communicate with those individuals that you note old) Grand Parent (GP) Parent (PA) Cousin (CO) Health Care Agent (HC) Sibling (SB) DCF Worker (PS) In) Cousin (CO) Health Care Agent (HC) Sibling (SB) DCF Worker (PS) In-law (IL) Spouse (SP) Foster Parent (FP

Oliver, Douglas L.


Oriented Attachment of Cytochrome P450 2C9 to a Self-Assembled Monolayer on a Gold Electrode as a Biosensor Design  

E-Print Network (OSTI)

V.V. , Bulko, T.V. , Suprun, E.V. , Kuznetsova, G.P. ,V.V. , Bulko, T.V. , Suprun, E.V. , Chalenko, Y.M. ,V.V. , Bulko, T.V. , Suprun, E.V. , Chalenko, Y.M. ,

Schneider, Elizabeth




E-Print Network (OSTI)

LESSONS LEARNED FROM A LANDFILL SLOPE FAILURE INVOLVING GEOSYTNTHETICS Virginia L. Wilson.L. Soderman and G.P. Raymond November 12, 1998 #12;LESSONS LEARNED FROM A LANDFILL SLOPE FAILURE INVOLVING slopes at waste containment facilities. The Geneva Landfill is located near Geneva, Ohio which


High-resolution reversible folding of hyperstable RNA tetraloops using molecular dynamics simulations  

Science Journals Connector (OSTI)

...according to the approach proposed in the work by Chen and Pappu (20) to eliminate spurious ion-pairing artifacts...constant pressure of 1 atm. Dinucleotide Stacking PMFs. r(ApA), r(GpG), and r(UpU) dinu-cleotides were...

Alan A. Chen; Angel E. Garca



Organisation of the Adaptive Computing in Design and Manufacture 2004 Conference. April 20-22, 2004, Engineers House, Clifton, Bristol, UK.  

E-Print Network (OSTI)

, Engineers House, Clifton, Bristol, UK. GENETIC PROGRAMMING WITHIN CIVIL ENGINEERING David Shaw1 , John Miles or real number strings. · Active vs Passive: Because GP usually evolves computer programs, the solutions binary strings i.e. passive structures, which require post-processing. · Variable vs fixed length

Fernandez, Thomas


Gifts in Memory of LEHIGH UNIVERSITY 1 Anonymous, in memory of  

E-Print Network (OSTI)

Gifts in Memory of LEHIGH UNIVERSITY 1 Anonymous, in memory of Gerald G. Leeman '71P '10GP Michael P. Ament, in memory of Hilda P. Ament and Miles K. Ament '49 Allen M. Barnett, in memory of Matthew A. Yantis '01 Samuel W. Barnhart, in memory of Donald H. Dimmick '55 Dorothy Barrows, in memory

Gilchrist, James F.


An Opto-electric Smart Material Detector with Wavelength-Dependent Bob Zheng,1  

E-Print Network (OSTI)

GP-B-19 An Opto-electric Smart Material Detector with Wavelength-Dependent Logic Bob and Computer Engineering, Rice University, Houston, Texas, U.S.A. Smart materials are artificial materials, or the coherent, collective oscillations of conduction-band electrons, are ideal sensors for smart materials due



E-Print Network (OSTI)

, constructed, operated and maintained Best Management Practices ("BMPs") that discharge or propose to dischargeFACT SHEET For NEW YORK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION Draft New York State) Permit No. GP-0-09-001 Issued Pursuant to Article 17, Titles 7, 8 and Article 70 of the Environmental

Pawlowski, Wojtek


Gender-specific modulation of cocaine-induced place preference by 3,4-methylenedioxymethamphetamine  

E-Print Network (OSTI)

to the case where each drug was administered alone, and it was predicted this effect would be amplified in females relative to males. Adult male and female rats received one of three doses of cocaine (0 mg/kg, 2.5 mg/kg, 5 mg/kg) followed by MDMA (0 mg/kg, 5...

Diller, Anna Jean



Evaluating the Impacts of Gender, Fatness, Muscling, and Weight on Yield Grade 4 Beef Carcasses.  

E-Print Network (OSTI)

(n = 20) and steers (n = 40), and weight groups: lightweight heifers (315.5 - 362.9 kg) and steers (362.9 - 408.2 kg), and heavy weight heifers (362.9 - 408.2 kg) steers (408.2 - 453.6 kg). Within weight classes, carcasses were separated according...

Dillon, James T.



Renewable Hydrogen: Technology Review and Policy Recommendations for State-Level Sustainable Energy Futures  

E-Print Network (OSTI)

et al, 2000 IGT Gasifier 22,737 kg/day Medium $72 mill. cap.al, 2000 IGT Gasifier 75,790 kg/day Medium $169 mill. cap.Battelle/FERCO Gasifier 22,737 kg/day Medium $1.12/kg ($

Lipman, Timothy; Edwards, Jennifer Lynn; Brooks, Cameron



In situ characterization of soil properties using visible near-infrared diffuse reflectance spectroscopy  

E-Print Network (OSTI)

data set had a total clay content root mean squared deviation (RMSD) of 61 g kg-1 and 41 g kg-1 for the field-moist and air-dried in situ cores, respectively. The organic C validation data set had a RMSD of 5.8 g kg-1 and 4.6 g kg-1 for the field...

Waiser, Travis Heath



An Integrated Hydrogen Vision for California  

E-Print Network (OSTI)

day Small $2.56/kg ($18/GJ) (8,750 m heliostat) $2.84/kg ($20/GJ) (4.375 m heliostat) $3.41/kg ($24/GJ) (2,188 m heliostat) $0.92/kg ($6.48/GJ) NG at $

Lipman, Timothy; Kammen, Daniel; Ogden, Joan; Sperling, Dan



Combustion processes (B3)  

Science Journals Connector (OSTI)

The amount of heat required to raise the temperature of 1 kg of a substance 1 C or 1 K is termed the specific heat capacity of that substance (c). For water c is 4.19 kJ/(kg C) or kJ/(kg K). Imagine 1 kg of gas...

P. W. Kett



Identification and control of the pathogen causing Phytophthora blight on sesame in Texas  

E-Print Network (OSTI)

, metalaxyl at 0. 28 kg a. i. /ha to 1. 12 kg a. i. /ha and fenaminosulf at 1. 12 kg a. i. /ha were effective in controlling the disease. In the field experiments, metalaxyl infurrow treatments at rates 1. 12 kg a. i. /ha to 2. 24 kg a. i. /ha were... from the seeds and the soil was covered back. Treatments were comprised of three rates of metalaxyl (0. 28, 0. 56, and 1. 12 kg a. i. /ha respectively), two rates of phosethyl Al(0, 56 and 1. 12 kg a. i. /ha respectively), two rates of fenaminosulf...

Myint, Hla



Kosciusko County Rural E M C | Open Energy Information  

Open Energy Info (EERE)

Kosciusko County Rural E M C Kosciusko County Rural E M C Jump to: navigation, search Name Kosciusko County Rural E M C Place Indiana Utility Id 10448 Utility Location Yes Ownership C NERC Location RFC NERC RFC Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Commercial - Schedule C (Multi Phase) Commercial Commercial - Schedule C (Single Phase) Commercial Distributed Generation-Schedule DG Commercial Green Power-Schedule GP(OPTION A) Residential Green Power-Schedule GP(option B) Residential Industrial - Schedule I Industrial Industrial - Schedule I-2 INDUSTRIAL SERVICE (GREATER THAN 3,000 KW)


Town of Wolfeboro, New Hampshire (Utility Company) | Open Energy  

Open Energy Info (EERE)

Wolfeboro, New Hampshire (Utility Company) Wolfeboro, New Hampshire (Utility Company) Jump to: navigation, search Name Town of Wolfeboro Place New Hampshire Utility Id 20913 Utility Location Yes Ownership M NERC Location NPCC NERC NPCC Yes ISO NE Yes Activity Buying Transmission Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Domestic Service (Residential Schedule D.) Residential General Service (Schedule G.) Commercial General Service-Demand (Schedule GP.) Commercial Commercial General Service-Demand (Schedule GP.) Industrial Commercial Off Peak Water Heating (Schedule OP.) Commercial

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


LEDSGP/about/guidingstructure | Open Energy Information  

Open Energy Info (EERE)

LEDSGP/about/guidingstructure LEDSGP/about/guidingstructure < LEDSGP‎ | about(Redirected from LEDSGP/about/guiding-structure) Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts LEDS-Global-Partnership-Strategic-Vision.pdf Our strategic vision (PDF) provides a vision and a two-year strategy for the LEDS Global Partnership. It presents overarching objectives for the partnership over the next two years, and it defines concrete strategies, actions, and performance metrics to meet these objectives. LEDS-Global-Partnership-TOR.pdf The LEDS GP Terms of Reference serves as a guide to the activities of the


LAC Regional Platform Workshop General Information | Open Energy  

Open Energy Info (EERE)

Information Information Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LAC Workshop Announcement Agenda Participant Package Accommodations Location & Transportation Insurance & Visas Participants Presentations Outcomes Report Links Contact Us General Information (English) General information LEDS GP INCAE English-rev FINAL.pdf Informacion General LEDS GP INCAE Espanol FINAL.pdf Powered by OpenEI ledsgp.org is built on the same platform as the popular Wikipedia site. Like Wikipedia, it is a "wiki" or website developed collaboratively by a community of users. Thanks to our unique relationship with OpenEI.org, you can add or edit most content on ledsgp.org. For more information about this


Research Highlights | ORNL Neutron Sciences  

NLE Websites -- All DOE Office Websites (Extended Search)

phase behavior in carbon pores phase behavior in carbon pores Neutrons measure phase behavior in pores at angstrom size Compelling new methods for assessing carbon pores for hydrogen storage in fuel cells Research Contact: Yuri Melnichenko Jan. 2012, Written by Agatha Bardoel Yuri Melnichenko and Lilin He GP-SANS instrument scientist Yuri Melnichenko (left) and postdoctoral associate Lilin He. Researchers have measured the phase behavior of green house gases in pores at the angstrom level, using small-angle neutron scattering (SANS) at the Oak Ridge National Laboratory's High Flux Isotope Reactor. Yuri Melnichenko, an instrument scientist on the General-Purpose Small-Angle Neutron Scattering (GP-SANS) Diffractometer at ORNL's High Flux Isotope Reactor, his postdoctoral associate Lilin He and collaborators


NETL: News Release - Innovative Mercury Removal Technique Shows Early  

NLE Websites -- All DOE Office Websites (Extended Search)

August 5, 2003 August 5, 2003 Innovative Mercury Removal Technique Shows Early Promise Photochemical Process Developed in Federal Lab Removes Mercury from Flue Gas - NETL scientist Evan Granite prepares a lab test of the UV mercury removal process. - NETL scientist Evan Granite prepares for a lab test of the UV mercury removal process. MORGANTOWN, WV - A promising technology to remove mercury from coal-fired power plants -- dubbed the "GP-254 Process" -- has been developed and is currently being tested at the Department of Energy's National Energy Technology Laboratory (NETL). Newly patented, the GP-254 Process enhances mercury removal using ultraviolet light to induce various components of power plant stack gas to react with the mercury, and changes the


Gaussian Process Modeling: Applications to Building Systems and Algorithmic  

NLE Websites -- All DOE Office Websites (Extended Search)

Gaussian Process Modeling: Applications to Building Systems and Algorithmic Gaussian Process Modeling: Applications to Building Systems and Algorithmic Challenges Speaker(s): Victor M. Zavala Date: November 5, 2013 - 12:00pm - 1:00pm Location: 90-3122 Seminar Host/Point of Contact: Mary Ann Piette Michael Sohn We review applications and algorithmic challenges of Gaussian Process (GP) modeling. GP is a powerful and flexible uncertainty quantification and data analysis technique that enables the construction of complex models without the need to specify algebraic relationships between variables. This is done by working directly in the space of the kernel or covariance matrix. In addition, it derives from a Bayesian framework and, as such, it naturally provides predictive probability distributions. We describe how these features can be exploited in Measurement and Verification (M&V) tasks and


LEDSGP/analysis/impacts | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/analysis/impacts < LEDSGP Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Development Impacts Assessment Working Group A LEDS GP Working Group LEDSGP DIA Flyer.pdf LEDS DIA Pamphlet LEDSGP DIA poster 21x27.pdf LEDS DIA Poster 21x27 One of the highest priorities identified by countries and the regional platforms is the need for enhanced peer learning and strengthened tools on


LEDSGP/about/African Climate and Development Society | Open Energy  

Open Energy Info (EERE)

African Climate and Development Society African Climate and Development Society < LEDSGP‎ | about(Redirected from African Climate and Development Society) Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts African Climate Development Society A LEDS GP Regional Network Lead organizations: Africa Climate Policy Centre (ACPC), Kenya Ministry of State for Planning, National Development and Vision 2030 Member organizations: Climate and Development Knowledge Network (CDKN), Energy Center of the Kwame Nkrumah University of Science and Technology of Ghana, European Commission, Global Green Growth Institute (GGGI),


,"U.S. Natural Gas Plant Field Production"  

U.S. Energy Information Administration (EIA) Indexed Site

Annual",2012,"6/30/1981" Annual",2012,"6/30/1981" ,"Release Date:","9/27/2013" ,"Next Release Date:","9/26/2014" ,"Excel File Name:","pet_pnp_gp_dc_nus_mbbl_a.xls" ,"Available from Web Page:","http://www.eia.gov/dnav/pet/pet_pnp_gp_dc_nus_mbbl_a.htm" ,"Source:","Energy Information Administration" ,"For Help, Contact:","infoctr@eia.gov" ,,"(202) 586-8800",,,"11/25/2013 11:17:57 AM" "Back to Contents","Data 1: U.S. Natural Gas Plant Field Production" "Sourcekey","MNGFPUS1","MPPFPUS1","MLPFPUS1","METFPUS1","MPRFPUS1","MBNFPUS1","MBIFPUS1"


,"U.S. Natural Gas Plant Field Production"  

U.S. Energy Information Administration (EIA) Indexed Site

Monthly","9/2013","1/15/1981" Monthly","9/2013","1/15/1981" ,"Release Date:","11/27/2013" ,"Next Release Date:","Last Week of December 2013" ,"Excel File Name:","pet_pnp_gp_dc_nus_mbbl_m.xls" ,"Available from Web Page:","http://www.eia.gov/dnav/pet/pet_pnp_gp_dc_nus_mbbl_m.htm" ,"Source:","Energy Information Administration" ,"For Help, Contact:","infoctr@eia.gov" ,,"(202) 586-8800",,,"11/25/2013 11:17:57 AM" "Back to Contents","Data 1: U.S. Natural Gas Plant Field Production" "Sourcekey","MNGFPUS1","MPPFPUS1","MLPFPUS1","METFPUS1","MPRFPUS1","MBNFPUS1","MBIFPUS1"


Shell model study of $^{40}$Ca muon capture and the $(0^+, 0)$$\\to$$(0^-, 2626)$ axial charge transition  

E-Print Network (OSTI)

We report results from shell model studies of muon capture on $^{40}$Ca to low-lying levels of $^{40}$K. We discuss the comparison between calculated capture rates, measured capture rates and analogous transitions in ($e$,$e^{\\prime}$) scattering in terms of the particle-hole structure of the $^{40}$Ca-$^{40}$K nuclei. We highlight the $^{40}$Ca$(0^+, 0)$$\\to$$^{40}$K$(0^-, 2626)$ axial charge transition and its sensitivity to the induced pseudoscalar coupling $g_p$ of the proton's weak interaction. In addition, we address the hindrance of unique first-forbidden transitions due to particle-hole interactions and the emergence of allowed Gamow-Teller transitions due to ground state correlations. Lastly, we examine the longitudinal alignment of $^{40}$K recoils following muon capture, and discuss this possibility for independently determining the induced coupling $g_p$.

T. P. Gorringe



Muon Capture on the Proton  

E-Print Network (OSTI)

The MuCap experiment measures the singlet rate Lambda_S of muon capture on the proton. A negative muon beam is stopped in a time projection chamber filled with ultra-pure hydrogen gas at 10 bar and room temperature. In combination with the surrounding decay electron detectors, the lifetime of muons in hydrogen can be measured to determine LS to a final precision of 1%. The capture rate is then used to derive the nucleon's pseudoscalar form factor gP. Our first-stage result, gP= 7.3\\pm1., will soon be updated with the final analysis of the full statistics reducing the error by a factor of ~2.

P. Winter



Soft computing systems applied to PWR's xenon  

Science Journals Connector (OSTI)

The present work intends to introduce a soft computing technique as an effective and robust tool available to deal with nuclear engineering problems. This goal is reached by the presentation of an application: a genetic programming system (GP) able to automatically design a controller for the axial xenon oscillations in a pressurized water reactors (PWRs). The axial xenon oscillations control methodology is based on three axial offsets: the xenon axial offset (AOx), the iodine axial offset (AOi) and the neutron flux axial offset (AOf), effectively used in former work. Simulations were made using a two-point xenon oscillation model which employs the non-linear xenon and iodine balance equations and the one group, one-dimensional neutron diffusion equation, with non-linear power reactivity feedback, also proposed in the literature. Obtained results showed the ability of the GP in finding a strategy which can effectively control the axial xenon oscillations.

Roberto P. Domingos; Roberto Schirru; Aquilino Senra Martinez



PWR's xenon oscillation control through a fuzzy expert system automatically designed by means of genetic programming  

Science Journals Connector (OSTI)

This work proposes the use of genetic programming (GP) for automatic design of a fuzzy expert system aimed to provide the control of axial xenon oscillations in pressurized water reactors (PWRs). The control methodology is based on three axial offsets of xenon (AOx), iodine (AOi) and neutron flux (AOf), effectively used in former work. Simulations were made using a two-point xenon oscillation model, which employs the non-linear xenon and iodine balance equations and the one group, one-dimensional neutron diffusion equation, with non-linear power reactivity feedback, also proposed in the literature. Results have demonstrated the ability of the GP in finding a good fuzzy strategy, which can effectively control the axial xenon oscillations.

Roberto P. Domingos; Gustavo H.F. Caldas; Cludio M.N.A. Pereira; Roberto Schirru



Muon Capture on the Proton and Deuteron  

E-Print Network (OSTI)

By measuring the lifetime of the negative muon in pure protium (hydrogen-1), the MuCap experiment determines the rate of muon capture on the proton, from which the proton's pseudoscalar coupling g_p may be inferred. A precision of 15% for g_p has been published; this is a step along the way to a goal of 7%. This coupling can be calculated precisely from heavy baryon chiral perturbation theory and therefore permits a test of QCD's chiral symmetry. Meanwhile, the MuSun experiment is in its final design stage; it will measure the rate of muon capture on the deuteron using a similar technique. This process can be related through pionless effective field theory and chiral perturbation theory to other two-nucleon reactions of astrophysical interest, including proton-proton fusion and deuteron breakup.

Frederick Gray



Flavor decomposition of the elastic nucleon electromagnetic form factors  

SciTech Connect

The u- and d-quark contributions to the elastic nucleon electromagnetic form factors have been determined using experimental data on GEn , GMn , GpE , and GpM . Such a flavor separation of the form factors became possible up to 3.4 GeV2 with recent data on GEn from Hall A at JLab. At a negative four-momentum transfer squared Q2 above 1 GeV2, for both the u- and d-quark components, the ratio of the Pauli form factor to the Dirac form factor, F2/F1, was found to be almost constant, and for each of F2 and F1 individually, the d-quark component drops continuously with increasing Q2.

C.D. Cates, C.W. Jager, S. Riordan, B. Wojtsekhowski



Quantitative evaluation of ammonium hydrosulfide reagent for precipitation of group II cations at 1.0 molar hydrogen ion concentration and for separation of group II and group III cations  

E-Print Network (OSTI)

, . 9 melen by~@en ion oenoen4xatien when eeyanaClen ef 1i yLtatmg a Grid XX ea4Xen, ne 4' evlfMe, e4 X. O ? CXt &44k O@KLCGXAX'8. '49. GB 8%6. l)p' pX'4IQigi484~ S 6M'gp XXX - ed%. ee @+~&9. 8e xi@@ ed, MXg ~eniermX ee1u41ea. Ree~qMee ' eX' 8k@ ~i...~es--'ljx'emefex'xe@ Co e $09 @1? Be'DexGGotp f ' -T sekima'&XameChate AzemJo, . (XXX) . Dlengaxwtee (XI) . Gep@rnexomt . , %'ice. exeemlomp yxldte, ewxyle i eea:4keaqgve@ e45h. ; . %+8 . 8@Xggi@@' Wee '48gef Q$Xg 5894?elkee8 bp' @g'gp@@S! ~N$'45' 1 @f"8" eLL~ -?OS...

Ramsey, Jerry Warren



A study of the plant composition and utilization by mixed classes of livestock and white-tailed deer on the Kerr Wildlife Management area  

E-Print Network (OSTI)


May, Morton



LEDSGP/about/Asia LEDS Partnership | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/about/Asia LEDS Partnership < LEDSGP‎ | about(Redirected from Asia LEDS Partnership) Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Asia LEDS Partnership (ALP) A LEDS GP Regional Network ALT Steering Committee ALP Steering Committee The Asia LEDS Partnership Steering Committee met on March, 2013 in Pattaya, Thailand following the LEDS Global Partnership second annual workshop to



U.S. Energy Information Administration (EIA) Indexed Site

ES190","='Parts1-2'!$V$37","Whole number: 0 - 100,000","Value must be between 0 and 100,000." ES190","='Parts1-2'!$V$37","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_ES191","='Parts1-2'!$V$38","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP190","='Parts1-2'!$R$37","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_GP191","='Parts1-2'!$R$38:$U$38","Whole number: 0 - 100,000","Value must be between 0 and 100,000." "_PCITY","='Parts1-2'!$C$26","-","-" "_PSTAT","='Parts1-2'!$L$26","=STCodes List","Value must be a valid State Code from the drop down"



NLE Websites -- All DOE Office Websites (Extended Search)

GENERAL PROVISIONS GENERAL PROVISIONS FOR COST REIMBURSEMENT CONTRACTS This set of General Provisions consists of Sections A through C. Section C clauses apply only if specifically stated in the Subcontract. (GP/CR 10/12, Rev. 0) Waste Isolation Pilot Plant Carlsbad, New Mexico Rev. 0, October 1, 2012 1 TABLE OF CONTENTS GENERAL PROVISIONS FOR COST REIMBURSEMENT SUBCONTRACTS ARTICLE ................................................................................................................................ PAGE DEFINITIONS .................................................................................................................................. 3 GENERAL........................................................................................................................................ 4

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

LIVROS DIDÁTICOS E SUAS FUN??ES PARA O PROFESSOR DE MATEMÁTICA NO BRASIL E NA FRAN?A. Clovis Gomes (França) GP 0517 Psicologia da educação matemática ­UNICAMP Campinas SP (Brasil) Jean dois países. No Brasil a compra de livros didáticos pelo governo brasileiro envolve volumes e cifras de

Paris-Sud XI, Université de


Seite 1 von 6 Fachgebiet Rechnerarchitektur  

E-Print Network (OSTI)

, C, Gout, Pout); input [4 : 1] G, P; input Cin; output [4 : 2] C; output Gout, Pout; assign Gout = G cla4(A, B, Cin, S, Cout, Gout, Pout); input [4 : 1] A, B; input Cin; output [4 : 1] S; output Cout, Gout, Pout; wire [4 : 1] G, P; wire [4 : 2] C; adderGP agp1(A[1], B[1], Cin, S[1], G[1], P[1]), agp2(A

Hoffmann, Rolf


Prototyping method for Bragg-type atom interferometers  

SciTech Connect

We present a method for rapid modeling of new Bragg ultracold atom-interferometer (AI) designs useful for assessing the performance of such interferometers. The method simulates the overall effect on the condensate wave function in a given AI design using two separate elements. These are (1) modeling the effect of a Bragg pulse on the wave function and (2) approximating the evolution of the wave function during the intervals between the pulses. The actual sequence of these pulses and intervals is then followed to determine the approximate final wave function from which the interference pattern can be calculated. The exact evolution between pulses is assumed to be governed by the Gross-Pitaevskii (GP) equation whose solution is approximated using a Lagrangian variational method to facilitate rapid estimation of performance. The method presented here is an extension of an earlier one that was used to analyze the results of an experiment [J. E. Simsarian et al., Phys. Rev. Lett. 85, 2040 (2000)], where the phase of a Bose-Einstein condensate was measured using a Mach-Zehnder-type Bragg AI. We have developed both 1D and 3D versions of this method and we have determined their validity by comparing their predicted interference patterns with those obtained by numerical integration of the 1D GP equation and with the results of the above experiment. We find excellent agreement between the 1D interference patterns predicted by this method and those found by the GP equation. We show that we can reproduce all of the results of that experiment without recourse to an ad hoc velocity-kick correction needed by the earlier method, including some experimental results that the earlier model did not predict. We also found that this method provides estimates of 1D interference patterns at least four orders-of-magnitude faster than direct numerical solution of the 1D GP equation.

Benton, Brandon; Krygier, Michael; Heward, Jeffrey; Edwards, Mark [Department of Physics, Georgia Southern University, Statesboro, Georgia 30460-8031 (United States); Clark, Charles W. [Joint Quantum Insitute, National Institute of Standards and Technology and the University of Maryland, Gaithersburg, Maryland 20899 (United States)



LEDS Global Partnership in Action: Advancing Climate-Resilient Low Emission Development Around the World (Fact Sheet)  

SciTech Connect

Many countries around the globe are designing and implementing low emission development strategies (LEDS). These LEDS seek to achieve social, economic, and environmental development goals while reducing long-term greenhouse gas (GHG) emissions and increasing resiliency to climate change impacts. The LEDS Global Partnership (LEDS GP) harnesses the collective knowledge and resources of more than 120 countries and international donor and technical organizations to strengthen climate-resilient low emission development efforts around the world.

Not Available



Taming rogue waves in vector Bose-Einstein condensates  

Science Journals Connector (OSTI)

Using gauge transformation method, we generate rogue waves for the two-component Bose-Einstein condensates (BECs) governed by the symmetric coupled Gross-Pitaevskii (GP) equations and study their dynamics. We also suggest a mechanism to tame the rogue waves either by manipulating the scattering length through Feshbach resonance or the trapping frequency, a phenomenon not witnessed in the domain of BECs, and we believe that these results may have wider ramifications in the management of rogons.

P. S. Vinayagam; R. Radha; K. Porsezian




E-Print Network (OSTI)

. D. Cess, R.E. Davis, M. Ghil, M.M. Hall, T.R. Karl, J.T. Kiehl, D.G. Martinson, C.L. Parkinson, B-to-Century Time Scales, D. G. Martinson, K. Bryan, M. Ghil, M. M. Hall, T. R. Karl, E. S. Sarachik, S. Sorooshian. Collective Works 1. Panel on Model-Assimilated Data Sets (D.R. Johnson, J.R. Bates, G.P. Brasseur, M. Ghil, A

Ghil, Michael


Corrections to \\Self-dual instantons and holomorphic curves"  

E-Print Network (OSTI)

; )k L 1 ! 0 and (2) does not hold with c = #23;, " = " #23; , A = A #23; , #8; = #8; #23; . Then A #23 The estimate f 00 #21; #26; 2 f in [2, page 623] does not follow from the preceding inequalities. The error; + #30; ds on P f and every 2 0 (#6; h ; gP f ). Proof. Suppose not. Then there are sequences " #23

Dostoglou, Stamatis


Disease pathogenesis, treatment effectiveness, and co-morbid burden among adult patients with primary immune thrombocytopenia (ITP)  

E-Print Network (OSTI)

review of the report from Dr. Mark Crowther and colleagues. Chapter 6 I composed the text, produced the tables, and adapted the figures in this chapter. Shirley Watson, Howard Anderson, and Dr. John Grainger conceived the health-related lifestyle... tomography DVT: Deep vein thrombosis EGA: European Genome-phenome Archive EMA: European Medicines Agency FBC: Full blood count FDA: Food and Drug Administration GP: Glycoprotein GPRD: General Practice Research Database GSK: GlaxoSmithKline HCV: Hepatitis...

Sarpatwari, Ameet Vilas



Enhanced Operation Strategies for Air-Conditioning and Lighting Systems Toward Peak Power Reduction for an Office Building in Kuwait  

E-Print Network (OSTI)

Enhanced?Operation?Strategies?for?Air? Conditioning?and?Lighting? Systems?Toward?Peak?Power?Reduction? for?an?Office?Building?in?Kuwait F. Alghimlas A. Al-Mulla G.P. Maheshwari D. Al-Nakib Building and Energy Technologies Department... Environment and Urban Development Division ICEBO 2012 Manchester, United Kingdom October 23-26, 2012 Electricity?Use?by?Sector?in?Kuwait Percentages?of?Primary?Energy?Utilization Percentages?of?Electricity?Utilization Yearly?Increase?in...

Alghimlas, F.; Al-Mulla, A.; Maheshwari, G.P.; Al-Nakib, D.



A clarifier design technique for contact - stabilization plants in Texas  

E-Print Network (OSTI)

on 2 800 gp ? overflow rate). The organic loading intensity was 0. 5 lb. d ft 80D per lb. MLSS, with 2000 ? mixed liquor suspended solids and 33 200 ~ DOS. Dick's example showed that when clarifiers for an ll, activated sludge process have... suspended solids concentration. The curve describing this relationship could be used to replace the Texas state standard and, thus, assure proper clarifier design for clarification and thickening. ACKNOWLEDGMENTS The author w1shes to express his...

Boles, Michael Hayden



Total All Countries Exports of Crude Oil and Petroleum Products by  

U.S. Energy Information Administration (EIA) Indexed Site

Destination: Total All Countries Afghanistan Albania Algeria Andora Angola Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahama Islands Bahrain Barbados Belarus Belgium Belize Benin Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Bermuda Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Fiji Finland France French Guiana French Pacific Islands Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Iran Iraq Ireland Israel Italy Ivory Coast Jamaica Japan Jordon Kazakhstan Kenya Korea, South Korea, North Kyrgyzstan Kutubu Kuwait Latvia Lebanon Liberia Libya Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands/Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Qatar Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Saudi Arabia Senegal Serbia and Montenegro Seychelles Sierra Leone Singapore Slovakia Slovenia Soloman Islands South Africa Spain Spratly Islands Sri Lanka Sudan Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Tonga Togo Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Arab Emirates United Kingdom Uruguay Uzbekistan Vanuatu Venezuela Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Zambia Period-Unit: Monthly-Thousand Barrels Monthly-Thousand Barrels per Day Annual-Thousand Barrels Annual-Thousand Barrels per Day


Total Net Imports of Crude Oil and Petroleum Products into the U.S.  

U.S. Energy Information Administration (EIA) Indexed Site

Country: Total All Countries Persian Gulf OPEC Algeria Angola Ecuador Iran Iraq Kuwait Libya Nigeria Qatar Saudi Arabia United Arab Emirates Venezuela Non OPEC Afghanistan Albania Andora Anguilla Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bolivia Bosnia and Herzegovina Brazil Brunei Bulgaria Burma Cambodia Cameroon Canada Cayman Islands Chad Chile China Colombia Congo (Brazzaville) Congo (Kinshasa) Cook Islands Costa Rica Croatia Cyprus Czech Republic Denmark Djbouti Dominica Dominican Republic Egypt El Salvador Equatorial Guinea Ethiopia Eritrea Estonia Fiji Finland France French Pacific Islands French Guiana Gabon Georgia, Republic of Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guatemala Guinea Guyana Haiti Honduras Hong Kong Hungary Iceland India Indonesia Ireland Israel Italy Ivory Coast Jamaica Japan Jordan Kazakhstan Kenya Korea, South Kutubu Kyrgyzstan Latvia Lebanon Liberia Lithuania Macau S.A.R. Macedonia Madagascar Malaysia Maldives Mali Malta Marshall Islands Mauritania Mauritius Mexico Micronesia, Federated States of Midway Islands Moldova Monaco Mongolia Montenegro Montserrat Morocco Mozambique Namibia Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Niue Norway Oman Pakistan Panama Papau New Guinea Paracel Islands Paraguay Peru Philippines Poland Portugal Puerto Rico Romania Russia St. Kitts and Nevis St. Lucia St. Pierre and Miquelon St. Vincent and the Grenadines Samoa San Marino Senegal Serbia and Montenegro Sierra Leone Singapore Slovakia Slovenia South Africa Spain Spratly Islands Sri Lanka Suriname Swaziland Sweden Switzerland Syria Taiwan Tanzania Thailand Togo Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Uganda Ukraine United Kingdom Uruguay Uzbekistan Vanuatu Vietnam Virgin Islands (British) Virgin Islands (U.S.) Yemen Yugoslavia Other Non OPEC Period-Unit: Monthly-Thousand Barrels per Day Annual-Thousand Barrels per Day


P-Glycoprotein Structure and Chemotherapy Resistance  

NLE Websites -- All DOE Office Websites (Extended Search)

P-Glycoprotein Structure and Chemotherapy Resistance Print P-Glycoprotein Structure and Chemotherapy Resistance Print A research team from the Scripps Research Institute and the Texas Tech University Health Sciences Center has obtained the first glimpse of a protein that keeps certain substances, including many drugs, out of cells. The protein, called P-glycoprotein, or P-gp for short, is one of the main reasons cancer cells are resistant to chemotherapy drugs. Understanding its structure may help scientists design more effective drugs. The structure is a nice tool for understanding how drugs are transported out of cells by P-gp and for designing drugs to evade P-gp, preventing drug resistance. The Toll of Multidrug Resistance The American Cancer Society reported over 12 million new cancer cases and 7.6 million cancer deaths worldwide in 2007. Many cancers fail to respond to chemotherapy by acquiring multidrug resistance (MDR), to which has been attributed the failure of treatment in over 90% of patients with metastatic cancer. Although MDR can have several causes, one major form of chemotherapy resistance has been correlated with the presence of molecular "pumps" that transport drugs out of the cell.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9 2001 13:12 FR IPL DOE CH 630 252 2779 TO RGCP-HQ P.02/05 9 2001 13:12 FR IPL DOE CH 630 252 2779 TO RGCP-HQ P.02/05 STATEMENT OF CONSIDERATIONS REQUEST BY GEORGIA-PACIFIC CORPORATION(G-P) FOR AN ADVANCE WAIVER OF DOMESTIC AND FOREIGN PATENT RIGHTS TO INVENTIONS MADE UNDER CONTRACT NO. DE-FC26-00NT40772 ENTITLED "BLACK LIQUOR/BIOMASS GASIFICATION IN THE FOREST PRODUCTS INDUSTRY'; W(A)-00-024, CH1039. G-P has requested an advance waiver of domestic and foreign patent rights to inventions its employees may conceive or first actually reduce to practice in the performance of Cooperative Agreement No. DE-FC26-00NT40772. Fluor Enterprises, Inc., a subcontractor to G-P under the cooperative agreement, has agreed all patents rights to inventions its employees may conceive or first reduce to practice in the performance of the contract belong to G-P as per


The General-Purpose Small-Angle Neutron Scattering Diffractometer at HFIR -  

NLE Websites -- All DOE Office Websites (Extended Search)

General-Purpose Small-Angle Neutron Scattering Diffractometer at HFIR General-Purpose Small-Angle Neutron Scattering Diffractometer at HFIR Instrument scientist Ken Littrell at GP-SANS. Instrument scientist Ken Littrell at GP-SANS. The General-Purpose Small-Angle Neutron Scattering Diffractometer (GP-SANS) instrument is optimized for providing information about structure and interactions in materials in the size range of 0.5 - 200 nm. It has a cold neutron flux on sample and capabilities comparable to those of the best SANS instruments worldwide, including a wide range of neutron wavelengths λ 5 - 30 Å, resolution Δλ ⁄ λ 9=45%, and a 1m2 area detector with 5 × 5mm2 pixel resolution with a maximum counting capability of up to 2.5 kHz. The sample-to-detector distance can be varied from 1 to 20 m, and the detector can be offset horizontally by up to 45 cm, allowing


P-Glycoprotein Structure and Chemotherapy Resistance  

NLE Websites -- All DOE Office Websites (Extended Search)

P-Glycoprotein Structure and Chemotherapy Resistance Print P-Glycoprotein Structure and Chemotherapy Resistance Print A research team from the Scripps Research Institute and the Texas Tech University Health Sciences Center has obtained the first glimpse of a protein that keeps certain substances, including many drugs, out of cells. The protein, called P-glycoprotein, or P-gp for short, is one of the main reasons cancer cells are resistant to chemotherapy drugs. Understanding its structure may help scientists design more effective drugs. The structure is a nice tool for understanding how drugs are transported out of cells by P-gp and for designing drugs to evade P-gp, preventing drug resistance. The Toll of Multidrug Resistance The American Cancer Society reported over 12 million new cancer cases and 7.6 million cancer deaths worldwide in 2007. Many cancers fail to respond to chemotherapy by acquiring multidrug resistance (MDR), to which has been attributed the failure of treatment in over 90% of patients with metastatic cancer. Although MDR can have several causes, one major form of chemotherapy resistance has been correlated with the presence of molecular "pumps" that transport drugs out of the cell.


Quantum Bose liquids with logarithmic nonlinearity: Self-sustainability and emergence of spatial extent  

E-Print Network (OSTI)

The Gross-Pitaevskii (GP) equation is a long-wavelength approach widely used to describe the dilute Bose-Einstein condensates (BEC). However, in many physical situations, such as higher densities, this approximation unlikely suffices hence one might need models which would account for long-range correlations and multi-body interactions. We show that the Bose liquid described by the logarithmic wave equation has a number of drastic differences from the GP one. It possesses the self-sustainability property: while the free GP condensate tends to spill all over the available volume the logarithmic one tends to form a Gaussian-type droplet - even in the absence of an external trapping potential. The quasi-particle modes of the logarithmic BEC are shown to acquire a finite size despite the bare particles being assumed point-like, i.e., the spatial extent emerges here as a result of quantum many-body correlations. Finally, we study the elementary excitations and demonstrate that the background density changes the topological structure of their momentum space which, in turn, affects their dispersion relations. Depending on the density the latter can be of the massive relativistic, massless relativistic, tachyonic and quaternionic type.

Alexander V. Avdeenkov; Konstantin G. Zloshchastiev



Evaluation of strain caused by coherent precipitates in an Al alloy using TEM techniques  

SciTech Connect

Elastic strains, caused by GP zones in an aged Al alloy, were determined quantitatively using two techniques: Dark Field In-line Holography (DFH) and High Resolution Transmission Electron Microscopy-Geometric Phase Analysis (HRTEM-GPA). The results obtained by both techniques showed that the elastic strain was not uniform along the precipitate-matrix interface. In some areas, it was found that strain had negligible value and this was attributed to the loss of coherence between the lattices. It is suggested that a possible explanation for this fact could be a variation in the 'vacancies pump mechanism' kinetics. To obtain a better interpretation of the experimental deformation maps, a reference GP precipitate-matrix structure was built using QSTEM software. The main advantages of DFH over HRTEM-GPA were a bigger field of view and low electron dose requirements without spatial resolution loss. Another difference found was that crystalline defects such as dislocations were evidenced by HRTEM-GPA in contrast to the result obtained by DFH. However, strain measurements were affected by mask size effect in the former. - Highlights: Black-Right-Pointing-Pointer Strain around GP precipitates was not uniform and was in a more relaxed state. Black-Right-Pointing-Pointer Strain values determined by HRTEM had more artifacts compared with holography ones. Black-Right-Pointing-Pointer Strain distribution was attributed to differences in the release of vacancies. Black-Right-Pointing-Pointer Holography showed important advantages over HRTEM regarding field of view mainly.

Hernandez-Rivera, J.L., E-mail: jose.hernandez@cimav.edu.mx [Centro de Investigacion en Materiales Avanzados (CIMAV), Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Z.C. 31109, Chihuahua (Mexico); Universidad del Valle de Mexico, Robles 600, Fraccionamiento Jacarandas, Z. C. 78220, San Luis Potosi (Mexico); Rivera, J.J. Cruz; Garay-Reyes, C.G.; Azpeitia, M. Ramos; Zuniga-Alonso, I. [Facultad de Ingenieria-Instituto de Metalurgia, Universidad Autonoma de San Luis Potosi, Sierra Leona 550, Lomas 2a seccion, Z.C. 78210, San Luis Potosi (Mexico)] [Facultad de Ingenieria-Instituto de Metalurgia, Universidad Autonoma de San Luis Potosi, Sierra Leona 550, Lomas 2a seccion, Z.C. 78210, San Luis Potosi (Mexico); Martinez-Sanchez, R. [Centro de Investigacion en Materiales Avanzados (CIMAV), Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Z.C. 31109, Chihuahua (Mexico)] [Centro de Investigacion en Materiales Avanzados (CIMAV), Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Z.C. 31109, Chihuahua (Mexico)



Ecological factors affecting growth and formation of sclerotia in Sclerotium rolfsii  

E-Print Network (OSTI)

L I B R A R Y A ft M COLLEGE OF TEXAS AftMtCOfLM ELfGFAT LXXAfGOSC CPtaG; LSe gtPcLGOtS tX TfMAhtGOL OP TfGiGAcurGGG2I PtMGTnn osg StAcLS el XMLetT L e2ddpgv*v2lr T3o02vvp! vl vHp Cg*!3*vp TJHll- lI vHp Lmg2J3-v3g*- *r! cpJH*r2J*- fl--pmp l...I GpD*d 2r 5*gv2*- I3-I2--0prv lI vHp gp132gp0prvd Ilg vHp !pmgpp lI etfGth t. .;OMtTt.;4 c*6 8)7? c*slg T3ospJv, .-*rv .*vHl-lm6 MOPhLh4

Flados, Norman D.



Exergy efficiency of a counterflow air/air heat exchanger with vapour condensation  

Science Journals Connector (OSTI)

The exergy efficiency of a counterflow hot moist air/...?1 for the temperature and humidity ratio of hot moist air respectively are considered. Constant ambient air conditions of 20C and 0.01 kgkg?1 were assume...

J. Jilek; J. H. Young


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Download Full-text PDF  

Science Journals Connector (OSTI)

marine ecosystems (Mills 2001; Purcell 2005; Hay 2006). Under climate .... wind stress (kg m21 s22); and ra is the air density (1.22 kg m23). Cumulative z-score...



An Assessment of the Near-Term Costs of Hydrogen Refueling Stations and Station Components  

E-Print Network (OSTI)

4-12: Hydrogen Cost Comparison for Electrolysis Station WithAnalysis: Electrolysis, 30 kg/day, grid Hydrogen Cost ($/kg)the hydrogen costs from the HSCM for electrolysis stations

Lipman, T E; Weinert, Jonathan X.



Ex 9.8(a) The equilibrium constant for the reaction 2 C3H6(g) W C2H4(g) + C4H8(g) is found to fit the expression  

E-Print Network (OSTI)

coefficient for CaCl2 in a solution that is 0.020 mol kg-1 CaCl2(aq) and 0.030 mol kg-1 NaF(aq). #12;

Findley, Gary L.


Determining the Lowest-Cost Hydrogen Delivery Mode  

E-Print Network (OSTI)

while liquefaction electricity costs ($/kg) are independent0.10/kg while higher electricity costs ($0.075 vs $0.05/kWh)the cost of electricity and the cost of storage lead to

Yang, Christopher; Ogden, Joan M



Memantine, amantadine, and L-deprenyl potentiate the action of L-DOPA in monoamine-depleted rats  

Science Journals Connector (OSTI)

Some treatments used for Parkinson's disease attenuate locomotor depression in rats treated with reserpine and ?-methyl-p-tyrosine. In the present study memantine (2.5, 5.0mg/kg), ... 100 mg/kg). At higher doses,...

G. Skuza; Z. Rogoz; G. Quack; W. Danysz



An evaluation of floor surfaces on the basis of skin temperature during constrained standing  

E-Print Network (OSTI)

weight for an indrvidual was assumed to be 170 lb (77. 3 kg). Pressure = 0. 15 + 0. 0026 X weight(kgl (1) 0. 35 kg/cm' This pressure per unit surface area will generate 17. 2 kg (37. 8 lb) for the 7 cm X 7 cm mat samples. An 18 kg force was used... weight for an indrvidual was assumed to be 170 lb (77. 3 kg). Pressure = 0. 15 + 0. 0026 X weight(kgl (1) 0. 35 kg/cm' This pressure per unit surface area will generate 17. 2 kg (37. 8 lb) for the 7 cm X 7 cm mat samples. An 18 kg force was used...

Monford, Leo Gabriel



Understanding Wind Turbine Price Trends in the U.S. Over the Past Decade  

E-Print Network (OSTI)

from total primary energy consumption. Table 3. Primary1.65 MW kg/kW Primary Energy Consumption MJ/kg GJ/kW B C Bfor 9% of total primary energy consumption during the life

Bolinger, Mark



E-Print Network 3.0 - accidental airborne releases Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

release in: 1987 12 kg TEQs 1995 3 kg TEQs 12;Human... Exposure to Dioxins Airborne dioxins bind to particles and deposit on plants, soil and in waterways Primary... ;Accidental...


HyPro: Modeling the Hydrogen Transition  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

improvements in 2020 (300 psi Gaseous) HP Tank (358 kg) Disp (1500 kgd) Comp (1500 kgd) Pipeline Station H 2 from onsite production unit Comp (750 kgd) HP Tank (1193 kg) Disp...


The Adsorption of 2-Ketogluconate by Goethite.  

E-Print Network (OSTI)

??The low-molecular-mass-organic acid, 2-ketogluconate (kG), has been found to exist in significant concentrations in the rhizosphere of agricultural soils. Adsorption of kG by constant potential (more)

Journey, Jessica Suzanne



E-Print Network 3.0 - atmospherically deposited nitrogen Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

& Hydrology Summary: where nitrogen deposition is high 0 2 4 6 8 10 12 14 10 15 20 25 30 Atmospheric N pollution (kg ha-1 yr... ) Atmospheric N pollution (kg ha-1 yr-1) 12;What...


E-Print Network 3.0 - atmospheric nitrogen deposition Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

& Hydrology Summary: where nitrogen deposition is high 0 2 4 6 8 10 12 14 10 15 20 25 30 Atmospheric N pollution (kg ha-1 yr... ) Atmospheric N pollution (kg ha-1 yr-1) 12;What...


External load can alter the energy cost of prolonged exercise  

Science Journals Connector (OSTI)

The present study was undertaken to examine the energy cost of prolonged walking while carrying a backpack...?1 and 5% elevation with a well fitted backpack load of 25 and 40 kg alternately. Carrying 40 kg elicit...

Y. Epstein; J. Rosenblum; R. Burstein



Human-Centered Sustainable Product Design  

E-Print Network (OSTI)

2 (2006) Food 1kg of rice: 200 litres 1kg of potatoes: 500 litres 1 orange: 53 litres 1 serving, and elsewhere) !!Automobiles !! Packaging !! Waste electronics and appliances (e.g., WEEE) !! Hazardous

Agogino, Alice M.


Application of Gaussian Process Modeling to Analysis of Functional Unreliability  

SciTech Connect

This paper applies Gaussian Process (GP) modeling to analysis of the functional unreliability of a passive system. GPs have been used widely in many ways [1]. The present application uses a GP for emulation of a system simulation code. Such an emulator can be applied in several distinct ways, discussed below. All applications illustrated in this paper have precedents in the literature; the present paper is an application of GP technology to a problem that was originally analyzed [2] using neural networks (NN), and later [3, 4] by a method called Alternating Conditional Expectations (ACE). This exercise enables a multifaceted comparison of both the processes and the results. Given knowledge of the range of possible values of key system variables, one could, in principle, quantify functional unreliability by sampling from their joint probability distribution, and performing a system simulation for each sample to determine whether the function succeeded for that particular setting of the variables. Using previously available system simulation codes, such an approach is generally impractical for a plant-scale problem. It has long been recognized, however, that a well-trained code emulator or surrogate could be used in a sampling process to quantify certain performance metrics, even for plant-scale problems. Response surfaces were used for this many years ago. But response surfaces are at their best for smoothly varying functions; in regions of parameter space where key system performance metrics may behave in complex ways, or even exhibit discontinuities, response surfaces are not the best available tool. This consideration was one of several that drove the work in [2]. In the present paper, (1) the original quantification of functional unreliability using NN [2], and later ACE [3], is reprised using GP; (2) additional information provided by the GP about uncertainty in the limit surface, generally unavailable in other representations, is discussed; (3) a simple forensic exercise is performed, analogous to the inverse problem of code calibration, but with an accident management spin: given an observation about containment pressure, what can we say about the system variables? References 1. For an introduction to GPs, see (for example) Gaussian Processes for Machine Learning, C. E. Rasmussen and C. K. I. Williams (MIT, 2006). 2. Reliability Quantification of Advanced Reactor Passive Safety Systems, J. J. Vandenkieboom, PhD Thesis (University of Michigan, 1996). 3. Z. Cui, J. C. Lee, J. J. Vandenkieboom, and R. W. Youngblood, Unreliability Quantification of a Containment Cooling System through ACE and ANN Algorithms, Trans. Am. Nucl. Soc. 85, 178 (2001). 4. Risk and Safety Analysis of Nuclear Systems, J. C. Lee and N. J. McCormick (Wiley, 2011). See especially 11.2.4.

R. Youngblood



PROPRIETARY MATERIAL. 2011 The McGraw-Hill Companies, Inc. Limited distribution permitted only to teachers and educators for course preparation. If you are a student using this Manual, you are using it without permission.  

E-Print Network (OSTI)

of exergy destruction, and the second-law efficiency are to be determined. Assumptions 1 Steady operating.830.2792(C)350400(C)kJ/kg3kg/s)(1.068.0( )()( 3421 4231 (b) The specific exergy changes of each stream.910 )kJ/kg.K29649.0K)(6.4302273(20kJ/kg)91.830.2792( )( 34034 ssThhw The exergy destruction

Bahrami, Majid


EINDHOVEN UNIVERSITY OF TECHNOLOGY Department of Mathematics and Computer Science  

E-Print Network (OSTI)

tail (m) mj mass of particle j (kg) pdry dry perimeter of conduit cross-section (air) (m) Pa driving

Eindhoven, Technische Universiteit


Active Transport of Iron by Intestine : Effect of Erythropoiesis stimulated by Phenylhydrazine  

Science Journals Connector (OSTI)

... Male, albino, Sherman strain rats, 80-140 g, were injected subcutaneously with 100 mg/kg body-weight ...




Alcdia > UIB (en transport pblic)  

E-Print Network (OSTI)

min. Cost mitjà del viatge1 : 9'44 Emissions addicionals (CO2): 10,56 Kg Emissions addicionals (SO2): 0,006 Kg Durada: 80 min. Cost mitjà del viatge2 : 1'52 Emissions addicionals (CO2): 0 kg Emissions acumulat3 : 11,24 dies Despesa per any3 : 3.322'88 Emissions addicionals (CO2): 3.117,06 Kg Emissions

Oro, Daniel


Algaida > UIB (en transport pblic)  

E-Print Network (OSTI)

min. Cost mitjà del viatge1 : 4,75 Emissions addicionals (CO2): 5,32 Kg Emissions addicionals (SO2): 0,003 Kg Durada: 55 min. Cost mitjà del viatge2 : 0,64 Emissions addicionals (CO2): 0 kg Emissions acumulat3 : 7,58 dies Despesa per any3 : 1.672'70 Emissions addicionals (CO2): 1.871,13 Kg Emissions

Oro, Daniel

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Lifecycle Assessment of Beijing-Area Building Energy Use and Emissions: Summary Findings and Policy Applications  

E-Print Network (OSTI)

Production Intensity Material kg/m Section Steel Steel Bar Aluminum Cement Glass Gypsum board* Acrylic Rubber -

Aden, Nathaniel



Multidrug Toxicity Involving Sumatriptan  

Science Journals Connector (OSTI)

......kg in heart, 0.32 mg/kg in spleen, 0.01 mg/kg in brain, 15.99 mg/kg in lung and 78.54 mg/45 mL in the stomach...5.01 Liver 0.51 Kidney 3.66 Heart 0.09 Spleen 0.32 Brain 0.01 Lung 15.99 Gastric 78.54 mg (45 mL submitted) Review......

Jessica L. Knittel; Shawn P. Vorce; Barry Levine; Rhome L. Hughes; Thomas Z. Bosy



Robotica 1 1 Corso di Robotica 1  

E-Print Network (OSTI)

) Robotica 1 9 #12;Sminamento · PEMEX (EPFL, Lausanne), rilevatore leggero di mine antiuomo · peso: 16 kg

De Luca, Alessandro


Untersuchungen ber die Vertrglichkeit von 5-Hydroxymethylfurfural (HMF)  

Science Journals Connector (OSTI)

Mnnliche Sprague-Dawley Ratten erhielten 250 mg/kg 5-Hydroxymethylfurfural (HMF) 40 Wochen hindurch verfttert. Bezgl...

K. Lang; W. Kieckebusch; K. H. Bssler; W. Griem



Umfang und Beschreibung der Tafel  

Science Journals Connector (OSTI)

Die Tafel umfat ein Temperaturgebiet von 100 bis...2 bis 30 kg/cm2. Die Gewichtseinheit ist 1 kmol.

O. Lutz; F. Wolf



On the Disposition of Graphite Containing TRISO Particles and the Aqueous Transport of Radionuclides via Heterogeneous Geological Formations  

E-Print Network (OSTI)

Nwptunium, Plutonium, Americium, and Technetium, Amsterdam,Database. Table 4.5 Americium Solubility (mol/kg) Calculated42 Americium

van den Akker, Bret Patrick



PROPRIETARY MATERIAL. 2011 The McGraw-Hill Companies, Inc. Limited distribution permitted only to teachers and educators for course preparation. If you are a student using this Manual, you are using it without permission.  

E-Print Network (OSTI)

fluid. The exergy destruction in the total system per 1000 m3 of dry air is to be determined the condenser is kg350,66kJ/kg)32.10729.275)(kg0.395()( 32 hhmQ RH Next, we calculate the exergy destruction

Bahrami, Majid


Chemical inhibition of the thyroid gland and its effects on E. coli O157:H7 fecal shedding patterns in sheep  

E-Print Network (OSTI)

. Twenty-four crossbred sheep (68.6 kg BW) were randomly assigned to pen and either 0.0 mg/kg BW PTU or 20 mg/kg BW PTU for 5, 11, or 14 days. Sheep were experimentally infected (d 0) with E. coli O157:H7 11 days prior to PTU treatment. Fecal and serum...

Schroeder, Sasha Brooke



Heterogeneity of distribution for growth traits between Angus and Brahman backcross embryo transfer cattle  

E-Print Network (OSTI)

was significant for all traits and SEX was significant for all traits excluding FG. Birth year and birth season were significant effects for WW, GG, FG, and SW. Classes set according to industry standards were BW (4 kg increments), WW (50 kg increments), GG (40 kg...

Cleere, Jason James



UBC Social Ecological Economic Development Studies (SEEDS) Student Report Life Cycle Assessment of UBC Faculty of Pharmaceutical Sciences Building  

E-Print Network (OSTI)

potential, human health respiratory effects, and fossil fuel use more than other assemblies. Also, columns: 5.60E+07 ecologically weighted kg Fossil fuel use: 1.08E+08 MJ After performing Sensitivity potential: 4.99E+04 kg NOx eq Human health respiratory effects: 4.14E+04 kg PM2.5 eq Weighted resource use


Digestive utilization of different sources of supplemental protein by heifers grazing bermudagrass  

E-Print Network (OSTI)

al. (1991) found that a supplement of kg/d of corn gluten meal fed to a 300-kg steers receiving ammoniated wheat straw produced similar improvement in daily gain to a corn supplement fed at 2. 5 kg/d, even though steers supplemented with corn...

Cabello Cordova, Luis Carlos



Effect of level of fish meal on intake and performance in calves grazing sorghum  

E-Print Network (OSTI)

) supplement intake protein (SIP, g/kg BW) while to daily digestible forage organic matter and potentially digestible fiber as well as daily gains were unrelated. Fecal crude protein excreted (FCP, g/kg BW) and concentration (g/kg fecal OM) were positively...

Scaglia Alonso, Guillermo



Bevacizumab Has Differential and Dose-Dependent Effects on Glioma Blood Vessels and Tumor Cells  

Science Journals Connector (OSTI)

...5, 5, and 25 mg/kg every other day (eod), respectively. Survival dose dependently...Bevacizumab at a dose of 5 and 25 mg/kg eod lead to a significant reduction of glioma...reaching significance in the medium (5 mg/kg eod, blue line) and in the high (25 mg...

Louisa von Baumgarten; David Brucker; Anca Tirniceru; Yvonne Kienast; Stefan Grau; Steffen Burgold; Jochen Herms; Frank Winkler



Phase I Dose-Escalating Study of SU11654, a Small Molecule Receptor Tyrosine Kinase Inhibitor, in Dogs with Spontaneous Malignancies ,  

Science Journals Connector (OSTI)

...two groups were expanded to 16 (2.5 mg/kg EOD) and 20 dogs (3.25 mg/kg EOD) to better define the toxicity, activity, and...began therapy at a dose of 2.5-3.25 mg/kg EOD, the current recommended dose and schedule is well...

Cheryl A. London; Alison L. Hannah; Regina Zadovoskaya; May B. Chien; Cynthia Kollias-Baker; Mona Rosenberg; Sue Downing; Gerald Post; Joseph Boucher; Narmada Shenoy; Dirk B. Mendel; Gerald McMahon; Julie M. Cherrington



Environmental Effects of Industrial Farming  

E-Print Network (OSTI)

·Water contamination ·Soil contamination ·Solutions #12;US Meat Industry Animals (2009) kg produced (2009 contamination #12;Water contamination ·~9x108 kg of dry waste produced in the US per day day in 2001 #12;Water!" #12;Air contamination ·220kg of CH4 produced in the lifetime of a cow "Smells like money!" #12;Air

Budker, Dmitry


Renewable Hydrogen: Technology Review and Policy Recommendations for State-Level Sustainable Energy Futures  

E-Print Network (OSTI)

al, 2000 Battelle/FERCO Gasifier 113,685 kg/day Large $172Spath et al, 2000 IGT Gasifier 22,737 kg/day Medium $72Spath et al, 2000 IGT Gasifier 75,790 kg/day Medium $169

Lipman, Timothy; Edwards, Jennifer Lynn; Brooks, Cameron



PAHs And Parking Lots: A Field Study on PAHs Exported From Sealed and Unsealed Parking  

E-Print Network (OSTI)

2010 3.08 51.2 58.3 27.8 1.58 95.7 89.6 9.96 #12;10 4% of surface sealed 109-162 mg/kg (Gravel Wetland/kg (Bioretention) #12;Stormwater sediments (16PAH): Unsealed area sealed 100 mg/kg 100% sealed 1


Minotaur V is a 5-stage evolutionary version of the Minotaur IV Space  

E-Print Network (OSTI)

into high energy trajectories, including Geosynchronous Transfer Orbits (GTO) as well as translunar success ensured by mature systems and processes including Orbital's rigorous mission assurance programFM): - GTO: 640 kg - TLI: 447 kg · 3-Axis stabilized upper stage (Star 37FMV): - GTO: 594 kg - TLI

Christian, Eric


Renewable Hydrogen: Technology Review and Policy Recommendations for State-Level Sustainable Energy Futures  

E-Print Network (OSTI)

2002 $2.56/kg ($18/GJ) (8,750 m 2 heliostat) $2.84/kg ($20/GJ) (4.375 m 2 heliostat) $3.41/kg ($24/GJ) (2,188 m 2 heliostat) NG at $3.72/GJ Research and

Lipman, Timothy; Edwards, Jennifer Lynn; Brooks, Cameron



Radiological Habits Survey, Rosyth Business Park, 2005  

E-Print Network (OSTI)

;2 #12;3 SUMMARY 5 1. BACKGROUND 5 1.1 Regulation of radioactive waste discharges 5 1.2 The critical area (kg/y) Table 15. Adults' consumption rates of potato in the Rosyth area (kg/y) Table 16. Adults rates of root vegetables in the Rosyth area (kg/y) Table 29. Children's consumption rates of potato

Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Radiological Habits Survey, Hunterston 2001  

E-Print Network (OSTI)

;3 SUMMARY 6 1. BACKGROUND 7 1.1 Regulation of radioactive waste discharges 7 1.2 The critical group concept rates of root vegetables from the Hunterston area (kg/y) Table 15. Adult consumption rates of potatoes the Hunterston area (kg/y) Table 31. Children's consumption rates of potatoes from the Hunterston area (kg


Fertility-Based Herbicide Injury Recovery from Clomazone in Hybrid Rice (Oryza sativa L.)  

E-Print Network (OSTI)

of clomazone in Texas rice production is Command 3ME?. The label recommends a single PRE application rate of 0.28 kg a.i./ha on coarse-textured soils and up to 0.67 kg ha-1 on fine-textured soils. A split application may also be administered, where the first... application is made PRE followed by a second application EPOST. Rates for the first PRE application range from 0.28 kg/ha on coarse-textured soils to 0.56 kg ha-1 on fine-textured soils. For the second EPOST application, recommended rates range from 0.11 kg...

McKnight, Benjamin 1985-



Correlation of injury occurrence data with estimated maximal aerobic capacity and body composition in a high frequency manual materials handling task  

E-Print Network (OSTI)

as follows (Nieman, 1986): 1. Low - V 0, ?( 36 ml/min/kg. 2. Medium ? VO, & 36 ml/min/kg and ( 46 ml/min/kg. 3. High - VO, & 46 ml/min/kg. The descriptive statistics of the 222 data points (9 missing data points) for the relative aerobic capacity... shows the trend of decreased injury occurrences with respect to higher step test estimated relative VO, ?(measured in ml/min/kg). The relative VO, appears to have a highly significant correlation to injury occurrence (p=0. 002). More specifically...

Craig, Brian Nichols



Evaluation of alterations in gene expression in MCF-7 cells induced by the agricultural chemicals Enable and Diazinon  

E-Print Network (OSTI)

. Reactions catalyzed by sterol 14? -demethylase (1) and aromatase (2) are indicated (7). Animal Studies Oral toxicity, rat: LD50 > 2000 mg/kg body weight. Dermal toxicity, rat: LD50 > 5000 mg/kg body weight. Inhalation toxicity, rat: LC50 > 2.1 mg.../l of inhaled air. 13- week study of hepatotoxicity in mice; 60 ppm, equal to 14 mg/kg body weight per day. Developmental toxicity studies, rat: 30 mg/kg body weight per day. Two-generation study of reproductive toxicity, rat: 5.8 mg/kg body weight per day (8...

Mankame, Tanmayi Pradeep



MCMC methods for wavelet representations in single index models  

E-Print Network (OSTI)

, (see Subsection 3.5.1). 3.3.1 Posterior inference for no shrinkage Recall W1 = fc0;kg; fwj;kg; t; s2; q and let W1 x denote W1 without the parameter x which could be any of fc0;kg, fwj;kg, t, s2, or q. We show the following calculations in Appendix... explic- itly. See B-6 in Appendix B. 3.3.2 Posterior inference for wavelet shrinkage Recall that W2 = fc0;kg; fsj;kg; fwj;kg; a; t; s2; q . We show the following calculations in Appendix C. From (3.7), (3.9), and (3.19), the joint distribution...

Park, Chun Gun



LEDSGP/about/steering-committee | Open Energy Information  

Open Energy Info (EERE)

LEDSGP/about/steering-committee LEDSGP/about/steering-committee < LEDSGP‎ | about Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Steering Committee for the Partnership Our Steering Committee provides guidance, oversight, and fundraising support. Members of the Steering Committee are gathered from among our member organizations: Africa Climate and Development Society (ACD-Soc) Asia LEDS Partnership Children's Investment Fund Foundation (CIFF) Chile Ministry of Environment Climate and Development Knowledge Network (CDKN) ClimateWorks Foundation (CWF)


LEDSGP/about/contacts | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/about/contacts < LEDSGP‎ | about Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Contact Us Sadie Cox LEDS Global Partnership Secretariat US National Renewable Energy Laboratory Caroline Uriarte LEDS Global Partnership Secretariat US National Renewable Energy Laboratory Caroline Spencer Climate and Development Knowledge Network


Radiological Dose Assessment Related to Management of Naturally Occurring Radioactive Materials Generated by the Petroleum Industry  

NLE Websites -- All DOE Office Websites (Extended Search)

Tebes is affiliated with the University of Illinois. Tebes is affiliated with the University of Illinois. ANL/EAD-2 Radiological Dose Assessment Related to Management of Naturally Occurring Radioactive Materials Generated by the Petroleum Industry by K.P. Smith, D.L. Blunt, G.P. Williams, and C.L. Tebes * Environmental Assessment Division Argonne National Laboratory, 9700 South Cass Avenue, Argonne, Illinois 60439 September 1996 Work sponsored by the United States Department of Energy, Office of Policy iii CONTENTS ACKNOWLEDGMENTS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . vii NOTATION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . viii ABSTRACT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 SUMMARY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


Cooling of hot gases by use of a spray tower  

E-Print Network (OSTI)

no effort to collect perfoz. mance data while main- taining the spray at the adiabatic saturation temperature of the air. In the experiments discussed herein, this was done in order to both improve the potential accuracy of the data and to simplify... at the entrance and at th. . throat oi' the venturi were connected by rubber tubing to a sensitive Meziam Company Yodel GP-5 inclined manometer, The maximum r. ading of this gauge was three inches of water while the cali- brationn intervals were 0. 02...

Pendleton, Elmer Lee



Distributively generated near rings on the dihedral group of order eight  

E-Print Network (OSTI)

DISTRIBHvlri "LY GEZERKTED NEZR RINGS ON THE DIH ', DRAL GRODP OP ORDER EIGHT A Thesis INRy LING VILLHITE Submitted to the Gra~', . ate ' allege of Tezas jan& Rnid e'r, si!, y in Parti "1 fulfillment of the reGui rom nt fo- the eSree o MASTER... GP BC. E. ":lOE December le~70 Major Subject: llathematics DISTRIBUTIVELY GMWRA ED NEAR RINGE ON THE DIHED tAL GROUP OF ORDER EIGHT A Thesis NARY LYNN VILLHITE Approved as to st'yle and. content 'by: ax man. of Gom; i ee , member A &. ~;g...

Willhite, Mary Lynn



Synthetic Fusion Peptides of Tick-Borne Encephalitis Virus as Models for Membrane Fusion  

Science Journals Connector (OSTI)

Initial coordinates for the L107F and L107T mutants were generated by modifying residue 107 into the appropriate residue types using CHIMERA (57). ... The ability of human immunodeficiency virus type 1 (HIV-1) to fuse its membrane with the membrane of the target cell is a function of a ?23-amino-acid amino-terminal segment of the gp41 subunit of the envelope glycoprotein complex, known as the fusion peptide. ... At the optimum pH for fusion and 37, the rate and extent of fusion were very high, with >50% of the virus fusing within 2 s and the final extent of fusion being 70%. ...

Jinhe Pan; C. Benjamin Lai; Walter R. P. Scott; Suzana K. Straus



Scalable time series change detection for biomass monitoring using gaussian process  

SciTech Connect

Biomass monitoring, specifically detecting changes in the biomass or vegetation of a geographical region, is vital for studying the carbon cycle of the system and has significant implications in the context of understanding climate change and its impacts. Recently, several time series change detection methods have been proposed to identify land cover changes in temporal profiles (time series) of vegetation collected using remote sensing instruments. In this paper, we adapt Gaussian process regression to detect changes in such time series in an online fashion. While Gaussian process (GP) has been widely used as a kernel based learning method for regression and classification, their applicability to massive spatio-temporal data sets, such as remote sensing data, has been limited owing to the high computational costs involved. In this paper we address the scalability aspect of GP based time series change detection. Specifically, we exploit the special structure of the covariance matrix generated for GP analysis to come up with methods that can efficiently estimate the hyper-parameters associated with GP as well as identify changes in the time series while requiring a memory footprint which is linear in the size of input data, as compared to traditional method which involves solving a linear system of equations for the Choleksy decomposition of the quadratic sized covariance matrix. Experimental results show that our proposed method achieves significant speedups, as high as 1000, when processing long time series, while maintaining a small memory footprint. To further improve the computational complexity of the proposed method, we provide a parallel version which can concurrently process multiple input time series using the same set of hyper-parameters. The parallel version exploits the natural parallelization potential of the serial algorithm and is shown to perform significantly better than the serial version, with speedups as high as 10. Finally, we demonstrate the effectiveness of the proposed change detection method in identifying changes in Normalized Difference Vegetation Index (NDVI) data. Moreover, we show that the scalable solution is able to process NDVI data for the entire Iowa region significantly faster than the standard method.

Chandola, Varun [ORNL; Vatsavai, Raju [ORNL



A Scalable Gaussian Process Analysis Algorithm for Biomass Monitoring  

SciTech Connect

Biomass monitoring is vital for studying the carbon cycle of earth's ecosystem and has several significant implications, especially in the context of understanding climate change and its impacts. Recently, several change detection methods have been proposed to identify land cover changes in temporal profiles (time series) of vegetation collected using remote sensing instruments, but do not satisfy one or both of the two requirements of the biomass monitoring problem, i.e., {\\em operating in online mode} and {\\em handling periodic time series}. In this paper, we adapt Gaussian process regression to detect changes in such time series in an online fashion. While Gaussian process (GP) have been widely used as a kernel based learning method for regression and classification, their applicability to massive spatio-temporal data sets, such as remote sensing data, has been limited owing to the high computational costs involved. We focus on addressing the scalability issues associated with the proposed GP based change detection algorithm. This paper makes several significant contributions. First, we propose a GP based online time series change detection algorithm and demonstrate its effectiveness in detecting different types of changes in {\\em Normalized Difference Vegetation Index} (NDVI) data obtained from a study area in Iowa, USA. Second, we propose an efficient Toeplitz matrix based solution which significantly improves the computational complexity and memory requirements of the proposed GP based method. Specifically, the proposed solution can analyze a time series of length $t$ in $O(t^2)$ time while maintaining a $O(t)$ memory footprint, compared to the $O(t^3)$ time and $O(t^2)$ memory requirement of standard matrix manipulation based methods. Third, we describe a parallel version of the proposed solution which can be used to simultaneously analyze a large number of time series. We study three different parallel implementations: using threads, MPI, and a hybrid implementation using threads and MPI. Experimental results show that the hybrid implementation scales better than the multi-threaded and MPI based implementations. The application of the proposed scalable algorithm is demonstrated in analyzing massive remote sensing observation data. The hybrid implementation, using 1536 computing cores, can analyze an NDVI data set for the Iowa study area in nearly 5 seconds, while a serial algorithm, using standard Cholesky decomposition based routines, takes several days to process the same data set.

Chandola, Varun [ORNL; Vatsavai, Raju [ORNL



EnergyPlus vs DOE-2: The Effect of Ground Coupling on Heating and Cooling Energy Consumption of a Slab-On-Grade Code House in a Cold Climate  

E-Print Network (OSTI)

.066 513 32 1381 0.33 IN 0.043 0.025 96 6 837 0.20 GP 0.16 0.093 801 50 837 0.20 AR - - 1121 70 1464 0.35 System Simulation The house had a direct expansion (DX) cooling system with heat pump both in EPlus and in DOE-2. This system controlled only... the cooling electricity consumption in all loading conditions in all models. The decreases in cooling electricity consumption with ground coupling were higher in EPlus GCS (38%- 100%) than in DOE-2 GCW (19%-95%) and in EPlus GCW (15%-91%). The highest...

Andolsun, S.; Culp, C.; Haberl, J.


The Incidence of Healthcare Use, Ill-Health, and Mortality in Adults with Intellectual Disabilities and Mealtime Support Needs  

E-Print Network (OSTI)

mostly lie between our samples figures in years one and two. (See Appendix 2 for details.) Specialist Referrals related to EDS Specialists include SLTs, dietitians, OTs, clinical psychologists and other healthcare practitioners (excluding GPs... .079; mean difference, year two: -6.1, 95% CI -15.0 to 2.8, t(125)=0.175, p=0.297). In contrast with the decline in GP visits and specialist referrals from year one to two, the incidence of emergency hospitalisations for EDS problems increased, while...

Perez, C. M.; Ball, S. L.; Wagner, A. P.; Clare, I. C. H.; Holland, A. J.; Redley, M.



BWR In-Core Monitor Housing Replacement Under Dry Condition of Reactor Pressure Vessel  

SciTech Connect

A new method of In-Core Monitor Housing replacement has been successfully applied to Tokai Unit 2 (BWR with 1100 MWe) in April of 2001. It was designed to replace a housing under dry condition of reactor pressure vessel (RPV): this enabled the elimination of water filled-up and drained processes during the replacement procedure resulting in the reduction of implementation schedule. To realize the dry condition, the radiation shields were placed in the RPV and the hollow guide pipe (GP) was adopted to transfer the apparatuses from the top to the bottom work area. (authors)

Tatsuo Ishida; Shoji Yamamoto; Fujitoshi Eguchi [Japan Atomic Power Company (Japan); Motomasa Fuse; Kouichi Kurosawa; Sadato Shimizu; Minoru Masuda [Hitachi Ltd. (Japan); Shinya Fujii; Junji Tanaka [General Electric International Inc. (Japan); Jacobson, Bryce A. [General Electric Company (United States)



Design, Synthesis, and Biological Evaluation of Highly Potent Small MoleculePeptide Conjugates as New HIV-1 Fusion Inhibitors  

Science Journals Connector (OSTI)

Among them, conjugates Aoc??AlaP26 and Noc??AlaP26 exhibited a low nanomolar IC50 in the cellcell fusion assay and effectively inhibited T20-sensitive and -resistant HIV-1 strains. ... (15) Although C-peptide fusion inhibitors are very potent at inhibiting HIV-1 infection, appearance of T20-resisitant strains, high production cost, and lack of oral bioavailability hinder its further development; thus, these drawbacks have led to a blooming discovery of small molecule fusion inhibitors targeting the gp41 fusion intermediate. ...

Chao Wang; Weiguo Shi; Lifeng Cai; Lu Lu; Qian Wang; Tianhong Zhang; Jinglai Li; Zhenqing Zhang; Kun Wang; Liang Xu; Xifeng Jiang; Shibo Jiang; Keliang Liu



A model of the large hydraulic gradient at Yucca Mountain, Nevada Test Site, based on hydraulic conductivity contrasts between Cenozoic and Paleozoic rocks  

E-Print Network (OSTI)


Strom, Eric William



Modulational instability of a modified Gross-Pitaevskii equation with higher-order nonlinearity  

Science Journals Connector (OSTI)

We consider the modulational instability (MI) of Bose-Einstein condensate (BEC) described by a modified Gross-Pitaevskii (GP) equation with higher-order nonlinearity both analytically and numerically. A new explicit time-dependent criterion for exciting the MI is obtained. It is shown that the higher-order term can either suppress or enhance the MI, which is interesting for control of the system, instability. Importantly, we predict that with the help of the higher-order nonlinearity, the MI can also take place in a BEC with repulsively contact interactions. The analytical results are confirmed by direct numerical simulations.

Xiu-Ying Qi and Ju-Kui Xue



Photocurrent in bulk heterojunction solar cells with similar electron and hole mean free path  

SciTech Connect

We present photocurrents at several temperatures carried out in a bulk heterojunction photovoltaic device. To explain the results, we developed an analytical model assuming non-injecting contacts and equal mean free paths for electrons and holes. The fitting of the equation to the experimental data provided the temperature evolution of the charge transfer state dissociation probability (P) and ??, where ? is the charge carrier mobility and ? is the charge carrier lifetime. The photocurrent expression tends towards a saturation value of eGPL for high electric fields, where GP is the generation rate of charge carriers.

Coutinho, Douglas Jos; Faria, Roberto Mendona, E-mail: faria@ifsc.usp.br [Instituto de Fsica de So Carlos, Universidade de So Paulo, C.P. 369, 13560-970 So Carlos, SP (Brazil)


Note: This page contains sample records for the topic "gp guadeloupe kg" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Photoproduction of the omega meson off the proton near threshold  

E-Print Network (OSTI)

An experimental study of omega photoproduction off the proton has been conducted by using the Crystal Ball and TAPS multiphoton spectrometers together with the photon tagging facility at the Mainz Microtron MAMI. The gp-->omega p differential cross sections are measured from threshold to the incident-photon energy Eg=1.4 GeV with ~15 MeV binning and full production-angle coverage. The quality of the present data near threshold gives access to a variety of interesting physics, including an estimation of the omegaN scattering length alpha_{omega p}.

Strakovsky, I I; Azimov, Ya I; Aguar-Bartolome, P; Annand, J R M; Arends, H J; Bantawa, K; Beck, R; Bekrenev, V; Berghaeuser, H; Braghieri, A; Briscoe, W J; Brudvik, J; Cherepnya, S; Codling, R F B; Collicott, C; Costanza, S; Demissie, B T; Downie, E J; Drexler, P; Fil'kov, L V; Glazier, D I; Gregor, R; Hamilton, D J; Heid, E; Hornidge, D; Jaegle, I; Jahn, O; Jude, T C; Kashevarov, V L; Keshelashvili, I; Kondratiev, R; Korolija, M; Kotulla, M; Koulbardis, A; Kruglov, S; Krusche, B; Lisin, V; Livingston, K; MacGregor, I J D; Maghrbi, Y; Manley, D M; Marinides, Z; McGeorge, J C; McNicoll, E F; Mekterovic, D; Metag, V; Middleton, D G; Mushkarenkov, A; Nefkens, B M K; Nikolaev, A; Novotny, R; Ortega, H; Ostrick, M; Otte, P B; Oussena, B; Pedroni, P; Pheron, F; Polonski, A; Robinson, J; Rosner, G; Rostomyan, T; Schumann, S; Sikora, M H; Starostin, A; Supek, I; Taragin, M F; Tarbert, C M; Thiel, M; Thomas, A; Unverzagt, M; Watts, D P; Werthmueller, D; Zehr, F



Photoproduction of the omega meson off the proton near threshold  

E-Print Network (OSTI)

An experimental study of omega photoproduction off the proton has been conducted by using the Crystal Ball and TAPS multiphoton spectrometers together with the photon tagging facility at the Mainz Microtron MAMI. The gp-->omega p differential cross sections are measured from threshold to the incident-photon energy Eg=1.4 GeV with ~15 MeV binning and full production-angle coverage. The quality of the present data near threshold gives access to a variety of interesting physics, including an estimation of the omegaN scattering length alpha_{omega p}.

I. I. Strakovsky; S. Prakhov; Ya. I. Azimov; P. Aguar-Bartolome; J. R. M. Annand; H. J. Arends; K. Bantawa; R. Beck; V. Bekrenev; H. Berghaeuser; A. Braghieri; W. J. Briscoe; J. Brudvik; S. Cherepnya; R. F. B. Codling; C. Collicott; S. Costanza; B. T. Demissie; E. J. Downie; P. Drexler; L. V. Fil'kov; D. I. Glazier; R. Gregor; D. J. Hamilton; E. Heid; D. Hornidge; I. Jaegle; O. Jahn; T. C. Jude; V. L. Kashevarov; I. Keshelashvili; R. Kondratiev; M. Korolija; M. Kotulla; A. Koulbardis; S. Kruglov; B. Krusche; V. Lisin; K. Livingston; I. J. D. MacGregor; Y. Maghrbi; D. M. Manley; Z. Marinides; J. C. McGeorge; E. F. McNicoll; D. Mekterovic; V. Metag; D. G. Middleton; A. Mushkarenkov; B. M. K. Nefkens; A. Nikolaev; R. Novotny; H. Ortega; M. Ostrick; P. B. Otte; B. Oussena; P. Pedroni; F. Pheron; A. Polonski; J. Robinson; G. Rosner; T. Rostomyan; S. Schumann; M. H. Sikora; A. Starostin; I. Supek; M. F. Taragin; C. M. Tarbert; M. Thiel; A. Thomas; M. Unverzagt; D. P. Watts; D. Werthmueller; F. Zehr



Compleximetric determination of sulfate with ethylenediaminetetraacetic acid  

E-Print Network (OSTI)

prexies 4ao to the estrone ver ~ stQ. ity of gpT1 se a eoaplexiag or chelating agent nader a wide range of conditions oad with aasy ieas ss reported by varione worhers (k, 6, 7e 0) ~ It is deeide4, therefore to sorry ost farther oxporiaeatstiea ia... of sulfate detersinktien the soot siaple, 4iroet approach would be that of quantitatively preoip- itatind the sulfate by the a4ditioa to it of a hnown otoiohio nutria aaenat of a natal iea snob as a stsa4ar4 solutiea of bariun ehlsri4e aa4 of observing a...

Spurlock, William W



Brief Report: Emergence of Zaire Ebola Virus Disease in Guinea  

Science Journals Connector (OSTI)

...gene to test samples obtained from 20 hospitalized patients who were suspected of being infected with a hemorrhagic fever virus. In addition, we performed EBOV-specific real-time RT-PCR assays targeting the glycoprotein (GP) or nucleoprotein (NP) gene. Samples from 15 of 20 patients tested positive... In March 2014, an outbreak of Ebola virus disease associated with a high fatality rate was identified in Guinea, with evidence of ongoing person-to-person transmission. In this update to the preliminary report, the virus is found to be a new strain related to Zaire ebolavirus.

Baize S.; Pannetier D.; Oestereich L.



Design of a twelve channel GPS receiver and a DGPS reference station - Data processing part  

E-Print Network (OSTI)

. The satellite signal measurements include timer interface clock (TIC) number, one millisecond epoch counter value sampled at TIC event, 20 millisecond epoch counter value sampled at 27 TIC event, number of carrier DCO cycles which have occurred during... the last TIC period ending at a TIC, and carrier DCO phase. The TIC is an output of GP1020 and its period is 0. 0999999 second [15]. The navigation component is the major portion of this research. Figure 1 shows the main program flowchart. The program...

Ren, Juxiang



Design and synthesis of disubstituted thiophene and thiazole based inhibitors of JNK  

SciTech Connect

From high throughput screening, we discovered compound 1, the prototype for a series of disubstituted thiophene inhibitors of JNK which is selective towards closely related MAP kinases p38 and Erk2. Herein we describe the evolution of these compounds to a novel class of thiophene and thiazole JNK inhibitors that retain favorable solubility, permeability, and P-gp properties for development as CNS agents for treatment of neurodegeneration. Compound 61 demonstrated JNK3 IC{sub 50} = 77 nM and retained the excellent broad kinase selectivity observed for the series.

Hom, Roy K.; Bowers, Simeon; Sealy, Jennifer M.; Truong, Anh P.; Probst, Gary D.; Neitzel, Martin L.; Neitz, R. Jeffrey; Fang, Larry; Brogley, Louis; Wu, Jing; Konradi, Andrei W.; Sham, Hing L.; Tth, Gergely; Pan, Hu; Yao, Nanhua; Artis, Dean R.; Quinn, Kevin; Sauer, John-Michael; Powell, Kyle; Ren, Zhao; Bard, Frdrique; Yednock, Ted A.; Griswold-Prenner, Irene (Elan)



Radiative Muon Capture in Calcium  

Science Journals Connector (OSTI)

The branching ratio relative to ordinary muon capture and the photon asymmetry relative to the muon-spin direction were measured for radiative muon capture in Ca40. For ~ 1200 photon events, the partial branching ratio is Rk>57MeV=(21.11.4)10-6, and the asymmetry for k>63.5 MeV is +0.900.50. A fit of the photon spectrum to the theory of Rood, Yano, and Yano gives the value gP?=(6.51.6)gA for the pseudoscalar-coupling constant. These results are in disagreement with earlier experiments.

R. D. Hart; C. R. Cox; G. W. Dodson; M. Eckhause; J. R. Kane; M. S. Pandey; A. M. Rushton; R. T. Siegel; R. E. Welsh



Controllable optical switch using a Bose-Einstein condensate in an optical cavity  

E-Print Network (OSTI)

. ?? is the field amplitude of the parallel driving laser and gc is the atom-atom interaction strength. In the mean-field approximation, we take the matter-wave field and the cavity electromagnetic field as classical fields, i.e., ?#3;(x,t) ? #3;(x,t) and a...? ? ?. The GP equation for the condensate then becomes i ?#3;(x,t) ?t = [ ? 1 2m d2 d2x + U0 cos2(kx)|?|2 + ?? cos(kx)(? + ??)+ gc|#3;(x,t)|2 ] #3;(x,t), (2) and the corresponding equation of motion for the cavity field is ?? ?t = ?i [ #2...

Yang, Shuai; Al-Amri, M.; Evers, Joerg; Zubairy, M. Suhail



Targeting carrier-mediated transport to improve the blood-brain barrier permeation of paclitaxel  

E-Print Network (OSTI)

with an amide ester of succinate attached at the C7 position shows a dramatic increase in interaction with P-gp as compared to JO1-57 in which the amide ester of succinate is attached at the C10 position. The difference between TX-295 and JO 3-57 is less...TARGETING CARRIER-MEDIATED TRANSPORT TO IMPROVE THE BLOOD-BRAIN BARRIER PERMEATION OF PACLITAXEL Kelly E. Desino1, Kenneth L. Audus1, Haibo Ge2, Gunda I. Georg2, Jariat Oyetunji2, Jared T. Spletstoser2, and Brandon J. Turunen2 University of Kansas...

Desino, Kelly Elizabeth; Audus, Kenneth L.; Ge, Haibo; Georg, Gunda I.; Oyetunji, Jariat; Spletstoser, J. T.; Turunen, B. J.



A study of linear programming and methods for programming the simplex method  

E-Print Network (OSTI)

Techniques, Johns Hopkins Press, Maryland (1958). 8. Symonds, G. H. , Linear Programmin: The Solution of Refinin Problems, Esso Standard Oil Company, New York (1955). CM*R*h' 1 dW tth, ~tt-ot t Anal sis: An A praisal, Volume 18, Princeton University Press... of the Air Force organized a research group under the title Project SCOOP (Scientific Computation of Optimal Programs) ~ As a direct result of thts research project Dantzig devised the first system- t' p d 1*~ii tg g 11' p g ' gp gt . Tli new method...

Watson, Warren Wallace



Atomic and nuclear interference phenomena and their applications  

E-Print Network (OSTI)

Numerical solution of the system Eqs.(4.42)-(4.45) in the retarded frame in terms of dimensionless variables u, tau and xi after various propagation distances: a) u(tau,xi); b) rho11(tau,xi); c) rho22(tau,xi); pa- rameter Omega0 = 2?221/Gp2 defines the pulse... Numerical solution of the system Eqs.(4.42)-(4.45) in the retarded frame for u (black curve), rho11 (red curve) and rho22 (green curve) in terms of dimensionless parameters tau and xi = 320, taking into account optical coherence relaxation. All parameters...

Kuznetsova, Yelena Anatolyevna



Acetone as a solvent for extraction of cottonseed oil  

E-Print Network (OSTI)

ACETONE AS A SOLVENT FOR EXTRACTION GP COTTONSEED OIL A Thesis In-Wai Hui June 1950 Approval as to style and content recommended c t Head oi' the Department of Chemical Engineering ACETONE AS A SOLVENT FOR EXT "ACTION OF COTTONSEED OIL A... Thesis In-Nai Hui June 1950 ACETONE AS A SOLVENT FOR EXTRACTION QF COTTONSEED OIL A Thesis Submitted to the Faculty of the Agricultural and Mechanical College of Texas Partis1 Fulfillment of the Recuirements for the Degree of Master of Science...

Hui, In-Wai



Continuous-time model reference adaptive control with improved transient performance  

E-Print Network (OSTI)

) for any piecewise continuous, uniformly bounded reference input signal r(t). In order to meet the control objective, we make the following standard assump- tions [26, 53] concerning the plant Gp(s) and the reference model I4 (s) ~ (Al) Rp(s) is a monic... polynomial of degree n. ~ (A2) Zp(s) is a monic Hurwitz polynomial of degree n, ( n. ~ (A3) The sign of kr and an upper bound k, ) 0 on [k?[ are known. Without any loss of generality, kr is assumed to be positive. Thus kr ( k ~ (A4) The relative degree n...

Ho, Ming-Tzu



Oxygen and Carbon Isotopes and Coral Growth in the Gulf of Mexico and Caribbean Sea as Environmental and Climate Indicators  

E-Print Network (OSTI)

thanks goes to the crew of the M/V Fling; the Flower Garden Banks National Marine Sanctuary (FGBNMS) staff, E. Hickerson, G.P. Schmal, L. Kurjelja; the Florida Keys National Marine Sanctuary staff, J. Halas, B. Causey, A. Massey; U.S. Geological Survey... OXYGEN AND CARBON ISOTOPES AND CORAL GROWTH IN THE GULF OF MEXICO AND CARIBBEAN SEA AS ENVIRONMENTAL AND CLIMATE INDICATORS A Dissertation by AMY JO WAGNER Submitted to the Office of Graduate Studies of Texas A&M University...

Wagner, Amy Jo



Newsletter Signup Form  

NLE Websites -- All DOE Office Websites (Extended Search)

EETD NEWSLETTER - MANAGE SUBSCRIPTIONS EETD NEWSLETTER - MANAGE SUBSCRIPTIONS (red fields are required) Manage subscriptions: Subscribe Unsubscribe Name E-Mail Affiliation Address Address (line 2) City State/Province Zip/Postal Code Country (please select a country) none Afghanistan Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua and Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegowina Botswana Bouvet Island Brazil British Indian Ocean Territory Brunei Darussalam Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Congo, the Democratic Republic of the Cook Islands Costa Rica Cote d'Ivoire Croatia (Hrvatska) Cuba Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France France, Metropolitan French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guinea Guinea-Bissau Guyana Haiti Heard and Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic of) Iraq Ireland Israel Italy Jamaica Japan Jordan Kazakhstan Kenya Kiribati Korea, Democratic People's Republic of Korea, Republic of Kuwait Kyrgyzstan Lao People's Democratic Republic Latvia Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia, The Former Yugoslav Republic of Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia, Federated States of Moldova, Republic of Monaco Mongolia Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island Northern Mariana Islands Norway Oman Pakistan Palau Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russian Federation Rwanda Saint Kitts and Nevis Saint LUCIA Saint Vincent and the Grenadines Samoa San Marino Sao Tome and Principe Saudi Arabia Senegal Seychelles Sierra Leone Singapore Slovakia (Slovak Republic) Slovenia Solomon Islands Somalia South Africa South Georgia and the South Sandwich Islands Spain Sri Lanka St. Helena St. Pierre and Miquelon Sudan Suriname Svalbard and Jan Mayen Islands Swaziland Sweden Switzerland Syrian Arab Republic Taiwan, Province of China Tajikistan Tanzania, United Republic of Thailand Togo Tokelau Tonga Trinidad and Tobago Tunisia Turkey Turkmenistan Turks and Caicos Islands Tuvalu Uganda Ukraine United Arab Emirates United Kingdom United States United States Minor Outlying Islands Uruguay Uzbekistan Vanuatu Venezuela Viet Nam Virgin Islands (British) Virgin Islands (U.S.) Wallis and Futuna Islands Western Sahara Yemen Yugoslavia Zambia Zimbabwe


Property:FirstWellFlowRate | Open Energy Information  

Open Energy Info (EERE)

Property Property Edit with form History Facebook icon Twitter icon » Property:FirstWellFlowRate Jump to: navigation, search Property Name FirstWellFlowRate Property Type Quantity Use this type to express a quantity of flow rate by mass. The default unit is kilogram per second (kg/s). Acceptable units (and their conversions) are: Kilogram per second - 1 kg/s,kilogram per second Kilogram per minute - 60 kg/min,kilogram per minute Kilogram per hour - 3600 kg/hour,kilogram per hour,kg/h Kilogram per day - 86400 kg/day,kilogram per day Liter per second - 1.0000000001 L/s,l/s,liters per second,l/sec,L/sec,liters/sec,Liters/sec Gallon per minute - 15.85032 gal/min,gallons per minute,gpm,gallons/min,Gallons/min Barrel per minute - 0.00839 bar/min,barrels per minute,barrel/min,barrels/min,Barrels/min


Compact methods for inverting matrices and solving simultaneous equations by use of Gauss-Jordan elimination  

E-Print Network (OSTI)

(5) kg k1 (k) . A($) kg kg Case lb. J ~ Jk (3?) , (k) . , (k) (k-1) ikJk kik ~kJk By definition g f (k-1) (k-1) kk kk ( !k) k'k f k k thus g J ? 1 giving as anticipated (k) 'dk , (k) . g(k) kk kk Case Zc. J g J, 1~)~k. (k) (k) (k-1) (3oc...

Clayton, Elden Gray Nash



PROPRIETARY MATERIAL. 2011 The McGraw-Hill Companies, Inc. Limited distribution permitted only to teachers and educators for course preparation. If you are a student using this Manual, you are using it without permission.  

E-Print Network (OSTI)

C as the heat source. The mass flow rate of steam through the turbine, the isentropic efficiency of the turbine flow rate of steam through the turbine is kg/s38.20 kg/s)230)(1661.0(123 mxm (b) Turbine: kJ/kg7 production well reinjection well separator steam turbine 1 condenser 2 3 4 5 6 Flash chamber #12;

Bahrami, Majid


Life-cycle Assessment of Semiconductors  

E-Print Network (OSTI)

nm node 120 nm kg/wafer GWG CF4 CHF3 C2F6 CH4 CO2 NF3 C4F6120 nm node 90nm kg/wafer GWG CF4 CHF3 C2F6 CH4 CO2 NF3 C4F690 nm node 65 nm kg/wafer GWG CF4 CHF3 C2F6 CH4 CO2 NF3 C4F6

Boyd, Sarah B.



(en transport pblic) Temps total del trajecte: 53 minuts  

E-Print Network (OSTI)

viatge Durada: 28 min. Cost mitjà del viatge1 : 5,57 Emissions addicionals (CO2): 6,23 Kg Emissions addicionals (SO2): 0,004 Kg Durada: 53min. Cost mitjà del viatge2 : 0,91 Emissions addicionals (CO2): 0 kg 1 any Temps acumulat3 : 6,84 dies Despesa per any3 : 1.959'94 Emissions addicionals (CO2): 2

Oro, Daniel